| Basic Information | |
|---|---|
| Family ID | F084775 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 112 |
| Average Sequence Length | 42 residues |
| Representative Sequence | PAAHKLLPPTLDWDVAPHVTANVRDKTVDVDLIYSVKAPK |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.89 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 89.29 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (60.714 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (8.036 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.893 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.893 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.88% β-sheet: 29.41% Coil/Unstructured: 64.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF01862 | PvlArgDC | 23.21 |
| PF00106 | adh_short | 1.79 |
| PF01916 | DS | 1.79 |
| PF04365 | BrnT_toxin | 0.89 |
| PF04371 | PAD_porph | 0.89 |
| PF10282 | Lactonase | 0.89 |
| PF07519 | Tannase | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG1945 | Pyruvoyl-dependent arginine decarboxylase | Amino acid transport and metabolism [E] | 23.21 |
| COG1899 | Deoxyhypusine synthase | Translation, ribosomal structure and biogenesis [J] | 1.79 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.89 |
| COG2957 | Agmatine/peptidylarginine deiminase | Amino acid transport and metabolism [E] | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 60.71 % |
| All Organisms | root | All Organisms | 39.29 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573000|GPBTN7E02JKYD7 | Not Available | 502 | Open in IMG/M |
| 3300001166|JGI12694J13545_1016335 | Not Available | 726 | Open in IMG/M |
| 3300001471|JGI12712J15308_10125908 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101192946 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300004635|Ga0062388_100383744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1213 | Open in IMG/M |
| 3300005526|Ga0073909_10111409 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
| 3300005538|Ga0070731_10188315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1370 | Open in IMG/M |
| 3300005541|Ga0070733_10990908 | Not Available | 564 | Open in IMG/M |
| 3300005542|Ga0070732_10939130 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300005555|Ga0066692_10647528 | Not Available | 659 | Open in IMG/M |
| 3300005764|Ga0066903_105539345 | Not Available | 665 | Open in IMG/M |
| 3300006028|Ga0070717_10505828 | Not Available | 1092 | Open in IMG/M |
| 3300006052|Ga0075029_100840758 | Not Available | 627 | Open in IMG/M |
| 3300006163|Ga0070715_10516323 | Not Available | 687 | Open in IMG/M |
| 3300006172|Ga0075018_10274241 | Not Available | 824 | Open in IMG/M |
| 3300006175|Ga0070712_101237986 | Not Available | 650 | Open in IMG/M |
| 3300006176|Ga0070765_100197017 | Not Available | 1826 | Open in IMG/M |
| 3300009521|Ga0116222_1297179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 698 | Open in IMG/M |
| 3300009545|Ga0105237_11917997 | Not Available | 600 | Open in IMG/M |
| 3300010159|Ga0099796_10287635 | Not Available | 693 | Open in IMG/M |
| 3300010359|Ga0126376_10766269 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 938 | Open in IMG/M |
| 3300010361|Ga0126378_10163703 | Not Available | 2277 | Open in IMG/M |
| 3300010366|Ga0126379_10618468 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1170 | Open in IMG/M |
| 3300010376|Ga0126381_100609455 | Not Available | 1554 | Open in IMG/M |
| 3300010379|Ga0136449_100488862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2142 | Open in IMG/M |
| 3300012096|Ga0137389_10609794 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 938 | Open in IMG/M |
| 3300012189|Ga0137388_11592676 | Not Available | 589 | Open in IMG/M |
| 3300012683|Ga0137398_10997942 | Not Available | 580 | Open in IMG/M |
| 3300012685|Ga0137397_10906655 | Not Available | 653 | Open in IMG/M |
| 3300012929|Ga0137404_11318791 | Not Available | 665 | Open in IMG/M |
| 3300012944|Ga0137410_11153071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
| 3300012948|Ga0126375_11228438 | Not Available | 625 | Open in IMG/M |
| 3300012984|Ga0164309_10801463 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 758 | Open in IMG/M |
| 3300012986|Ga0164304_11638647 | Not Available | 537 | Open in IMG/M |
| 3300013100|Ga0157373_11092990 | Not Available | 598 | Open in IMG/M |
| 3300014165|Ga0181523_10581168 | Not Available | 616 | Open in IMG/M |
| 3300014489|Ga0182018_10082723 | Not Available | 1903 | Open in IMG/M |
| 3300014501|Ga0182024_12592475 | Not Available | 544 | Open in IMG/M |
| 3300014654|Ga0181525_10013936 | All Organisms → cellular organisms → Bacteria | 5213 | Open in IMG/M |
| 3300014655|Ga0181516_10615405 | Not Available | 561 | Open in IMG/M |
| 3300014657|Ga0181522_10103224 | Not Available | 1648 | Open in IMG/M |
| 3300015262|Ga0182007_10179427 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 732 | Open in IMG/M |
| 3300015265|Ga0182005_1286155 | Not Available | 518 | Open in IMG/M |
| 3300015357|Ga0134072_10473335 | Not Available | 510 | Open in IMG/M |
| 3300015373|Ga0132257_102761891 | Not Available | 640 | Open in IMG/M |
| 3300017822|Ga0187802_10073049 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1273 | Open in IMG/M |
| 3300017930|Ga0187825_10225494 | Not Available | 681 | Open in IMG/M |
| 3300017933|Ga0187801_10416615 | Not Available | 560 | Open in IMG/M |
| 3300017934|Ga0187803_10358089 | Not Available | 587 | Open in IMG/M |
| 3300017936|Ga0187821_10079305 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1195 | Open in IMG/M |
| 3300017946|Ga0187879_10328109 | Not Available | 849 | Open in IMG/M |
| 3300017955|Ga0187817_10217183 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1219 | Open in IMG/M |
| 3300017970|Ga0187783_10509402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 872 | Open in IMG/M |
| 3300017975|Ga0187782_11595700 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300017988|Ga0181520_10533543 | Not Available | 825 | Open in IMG/M |
| 3300018019|Ga0187874_10231943 | Not Available | 761 | Open in IMG/M |
| 3300018042|Ga0187871_10316308 | Not Available | 863 | Open in IMG/M |
| 3300018062|Ga0187784_10699442 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 811 | Open in IMG/M |
| 3300018062|Ga0187784_11042181 | Not Available | 650 | Open in IMG/M |
| 3300018085|Ga0187772_10793080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 684 | Open in IMG/M |
| 3300018086|Ga0187769_10238976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1350 | Open in IMG/M |
| 3300018086|Ga0187769_10436419 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 986 | Open in IMG/M |
| 3300018088|Ga0187771_10566861 | Not Available | 962 | Open in IMG/M |
| 3300019888|Ga0193751_1040539 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2085 | Open in IMG/M |
| 3300020579|Ga0210407_10032981 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3853 | Open in IMG/M |
| 3300020579|Ga0210407_11266770 | Not Available | 552 | Open in IMG/M |
| 3300020580|Ga0210403_10399423 | Not Available | 1122 | Open in IMG/M |
| 3300021401|Ga0210393_10926019 | Not Available | 707 | Open in IMG/M |
| 3300021401|Ga0210393_11217898 | Not Available | 606 | Open in IMG/M |
| 3300021405|Ga0210387_11770057 | Not Available | 521 | Open in IMG/M |
| 3300021407|Ga0210383_10139940 | All Organisms → cellular organisms → Bacteria | 2054 | Open in IMG/M |
| 3300021477|Ga0210398_11602164 | Not Available | 505 | Open in IMG/M |
| 3300021560|Ga0126371_11277395 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 868 | Open in IMG/M |
| 3300022722|Ga0242657_1064236 | Not Available | 836 | Open in IMG/M |
| 3300024225|Ga0224572_1043540 | Not Available | 843 | Open in IMG/M |
| 3300025404|Ga0208936_1000272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7369 | Open in IMG/M |
| 3300025898|Ga0207692_10807794 | Not Available | 613 | Open in IMG/M |
| 3300025915|Ga0207693_10960419 | Not Available | 654 | Open in IMG/M |
| 3300025916|Ga0207663_11216114 | Not Available | 607 | Open in IMG/M |
| 3300025920|Ga0207649_10526275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 902 | Open in IMG/M |
| 3300025939|Ga0207665_11106898 | Not Available | 631 | Open in IMG/M |
| 3300026294|Ga0209839_10010959 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3795 | Open in IMG/M |
| 3300027266|Ga0209215_1020272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 857 | Open in IMG/M |
| 3300027842|Ga0209580_10280514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 829 | Open in IMG/M |
| 3300027874|Ga0209465_10003115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7199 | Open in IMG/M |
| 3300027889|Ga0209380_10498084 | Not Available | 711 | Open in IMG/M |
| 3300027895|Ga0209624_10697849 | Not Available | 670 | Open in IMG/M |
| 3300027911|Ga0209698_10218170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1536 | Open in IMG/M |
| 3300027986|Ga0209168_10117276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1365 | Open in IMG/M |
| 3300028017|Ga0265356_1042478 | Not Available | 501 | Open in IMG/M |
| 3300028788|Ga0302189_10331909 | Not Available | 607 | Open in IMG/M |
| 3300028806|Ga0302221_10143137 | Not Available | 1053 | Open in IMG/M |
| 3300028906|Ga0308309_10132962 | All Organisms → cellular organisms → Bacteria | 1978 | Open in IMG/M |
| 3300029882|Ga0311368_10211374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1529 | Open in IMG/M |
| 3300029951|Ga0311371_10273963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2409 | Open in IMG/M |
| 3300029992|Ga0302276_10307803 | Not Available | 683 | Open in IMG/M |
| 3300030813|Ga0265750_1013422 | Not Available | 975 | Open in IMG/M |
| 3300031231|Ga0170824_116743497 | Not Available | 644 | Open in IMG/M |
| 3300031231|Ga0170824_117157743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1004 | Open in IMG/M |
| 3300031446|Ga0170820_17077275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1000 | Open in IMG/M |
| 3300031708|Ga0310686_106745000 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4327 | Open in IMG/M |
| 3300031718|Ga0307474_10562405 | Not Available | 897 | Open in IMG/M |
| 3300031718|Ga0307474_11189595 | Not Available | 603 | Open in IMG/M |
| 3300031753|Ga0307477_10215003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1335 | Open in IMG/M |
| 3300031823|Ga0307478_11753154 | Not Available | 511 | Open in IMG/M |
| 3300031962|Ga0307479_11938937 | Not Available | 539 | Open in IMG/M |
| 3300032076|Ga0306924_11270970 | Not Available | 792 | Open in IMG/M |
| 3300032783|Ga0335079_10212399 | All Organisms → cellular organisms → Bacteria | 2142 | Open in IMG/M |
| 3300032783|Ga0335079_10711448 | Not Available | 1048 | Open in IMG/M |
| 3300032892|Ga0335081_10637762 | Not Available | 1306 | Open in IMG/M |
| 3300032895|Ga0335074_10652081 | Not Available | 1031 | Open in IMG/M |
| 3300033826|Ga0334847_020118 | Not Available | 724 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.04% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 7.14% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.25% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.25% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.36% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.36% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 5.36% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 4.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.46% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.46% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.46% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.57% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.68% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.68% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.68% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.68% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.68% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.79% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.79% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.79% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.79% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.89% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.89% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.89% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.89% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.89% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.89% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573000 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms) | Environmental | Open in IMG/M |
| 3300001166 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
| 3300025404 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300027266 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Host-Associated | Open in IMG/M |
| 3300028788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029992 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300030813 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300033826 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 E2 1-5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N55_01478610 | 2189573000 | Grass Soil | YDSTYLSEYLPAAQKLLPPALDWEVVPHVTANVRDKSVDVDLIYSVKAPK |
| JGI12694J13545_10163351 | 3300001166 | Forest Soil | AALKLLPPTLDWDVASHVTANGRDKTVDIDLIYTVKAPK* |
| JGI12712J15308_101259081 | 3300001471 | Forest Soil | NRLLPASLDWEVVPHVTPNIRDKTVDVDLQYSVKAPKQ* |
| JGIcombinedJ26739_1011929461 | 3300002245 | Forest Soil | RLLPASLDWEVVPHVTPNIRDKTVDVDLQYSVKAPKQ* |
| Ga0062388_1003837443 | 3300004635 | Bog Forest Soil | LPEAHKLLAANLDWEVTPHVTANIREKSVDVDLIYSVKAPK* |
| Ga0073909_101114093 | 3300005526 | Surface Soil | EAQKLLPPSLDWEVASHVTANVRDKSVDVDLIYSVKAPK* |
| Ga0070731_101883153 | 3300005538 | Surface Soil | KLLPANLDWDVASHVTANVKDKSVDVDLIYSAKAPK* |
| Ga0070733_109909083 | 3300005541 | Surface Soil | AQKLLPPSLDWEVASHVTANIRDKSVDVDIIYTAKAPK* |
| Ga0070732_109391301 | 3300005542 | Surface Soil | AAQKLLPPAFDWEVSSHVTANERDKTVDVDLIYSVKAAK* |
| Ga0066692_106475282 | 3300005555 | Soil | YLTAAQKLLPPSLDWEVASHVTANVRDKTVDVDLIYSVKAPK* |
| Ga0066903_1055393451 | 3300005764 | Tropical Forest Soil | LSDYLPQAQKLLPSSLDWDVASHVTANVREKTVDVDIIYTVKAPK* |
| Ga0070717_105058281 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | KLLPSGLDWDVSPHVTANARDRTVDVDLIYSVKAPK* |
| Ga0075029_1008407581 | 3300006052 | Watersheds | YLPAAHKLLPSGLDWDVSSHVTANVRDKTVDVDLIYSVKAPK* |
| Ga0070715_105163231 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | LPAAHKLLPSGLDWDVSPHVTANTRDKTVDVDLIYSVKAPK* |
| Ga0075018_102742412 | 3300006172 | Watersheds | TYIDEYLPAAHKLLPANLDWDVTPHVTANVRDKTVDVDIIYSVKAPK* |
| Ga0070712_1012379862 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | NSTYLSEYLPAAERLLPPTLDWEVSPHVTPNVRDKTVDVDLIYTAKAPK* |
| Ga0070765_1001970174 | 3300006176 | Soil | SEYLPAAHKLLPPTLDWDVAPHVTANVRDKTVDVDLIYSVKAPK* |
| Ga0116222_12971791 | 3300009521 | Peatlands Soil | PAALDWEVSSHMTANIHDKTVDVDLIYTVKAPTEAR* |
| Ga0105237_119179971 | 3300009545 | Corn Rhizosphere | LPPTLDWEVSPHVTPNVRDKTVDVDLIYTAKAPK* |
| Ga0099796_102876351 | 3300010159 | Vadose Zone Soil | EYLPAAHKLLPANLDWDVAPHVTANVRDKTVDVDIIYSVKAPK* |
| Ga0126376_107662692 | 3300010359 | Tropical Forest Soil | EFLPDARKLLPASLDWEVASHVTANVREKTVDVDLIYSAKAPR* |
| Ga0126378_101637031 | 3300010361 | Tropical Forest Soil | SEYLPQARKLLPPTLDWDVSSHVTANVREKTVDIDLIYSVKAPK* |
| Ga0126379_106184681 | 3300010366 | Tropical Forest Soil | LLPAALDWDVTPHVTANVRDKTVDVDLTYSAKAPR* |
| Ga0126381_1006094551 | 3300010376 | Tropical Forest Soil | PTARKLLPPSLDWEVDPHVTANVGEKTVDVDLVYTVKAPK* |
| Ga0136449_1004888621 | 3300010379 | Peatlands Soil | YLPEAQKLLPTRLDWEVSPHVTANVRDKTVDVDLIYSVRAPN* |
| Ga0137389_106097941 | 3300012096 | Vadose Zone Soil | LKEYLPEANRLLPVNLDWGVTPHVTANVRDKTVDVDLQYTAKAPK* |
| Ga0137388_115926762 | 3300012189 | Vadose Zone Soil | PQARKLLPANLDWEVSPHVTALSRDKTVDVDLQYTAKAPR* |
| Ga0137398_109979422 | 3300012683 | Vadose Zone Soil | LPANLDWEVEPHVTAITRDKTVDVDLQYTAKATQ* |
| Ga0137397_109066551 | 3300012685 | Vadose Zone Soil | LPAGFDWEVSTHATANVRDKTVDVDLIYSVKVPK* |
| Ga0137404_113187911 | 3300012929 | Vadose Zone Soil | YIDEYLPAAQKLLPANLDWDVVSHVTANVHDKTVDVDIIYSVKAPK* |
| Ga0137410_111530711 | 3300012944 | Vadose Zone Soil | STYLREYLAHANKLLPAALDWEVTPHVTANVRDKTVDVDLQYTARAPK* |
| Ga0126375_112284381 | 3300012948 | Tropical Forest Soil | SEYLPAAHKLLPSGLDWDVTPHVTANVRDKTVDVDLIYAVKAPK* |
| Ga0164309_108014631 | 3300012984 | Soil | QRLLPPTLDWEVSPHVTPNVRDKTVDVDLIYTAKAPK* |
| Ga0164304_116386471 | 3300012986 | Soil | NSTYLSEYLPAARKALPANLDWDVASHVTANVKDKTVDIDLIYSAKAPK* |
| Ga0157373_110929901 | 3300013100 | Corn Rhizosphere | TYLSEYLPAAQRLLPATLDWEVSPHVTPNVRDKTVDVDLIYTAKAPK* |
| Ga0181523_105811682 | 3300014165 | Bog | FLPAARKLLPPTLDWDVSPHVTGNQRDKSVDVDLIYSVKAPK* |
| Ga0182018_100827233 | 3300014489 | Palsa | PLARKLLPASLDWEVSTHVTALPSSKTVDVDLQYMAKAPQ* |
| Ga0182024_125924751 | 3300014501 | Permafrost | ALKLLPPTLDWDVASHVTANGRDKTVDIDLIYTVKAPK* |
| Ga0181525_100139361 | 3300014654 | Bog | EFLPQARKLLPPSLDWEVTPHVTALSRDKTVDVDLHYSAKAPQ* |
| Ga0181516_106154051 | 3300014655 | Bog | SEYLPAAHKLLPPTLDWEVQPHVTANVRDKTVDVDLIYSVKAPK* |
| Ga0181522_101032244 | 3300014657 | Bog | LPTTVDWDVTPHVTPMTADKTVDVDLQYTAKATR* |
| Ga0182007_101794271 | 3300015262 | Rhizosphere | LPSAQKLLPPTLDWEVSPHVTANVGDKTVDVDLMYSAKAPK* |
| Ga0182005_12861551 | 3300015265 | Rhizosphere | LLPPTLDWEVSPHVTANVKDKTVDVDLIYSAKAPK* |
| Ga0134072_104733352 | 3300015357 | Grasslands Soil | YLPQAQKLLPPSLDWEVTPHVTANVKDKTVDVDLIYSAKAPK* |
| Ga0132257_1027618912 | 3300015373 | Arabidopsis Rhizosphere | LSDYLPEARKLLPASLDWDVASHVTANVREKTVDVDLIYSAKAPR* |
| Ga0187802_100730493 | 3300017822 | Freshwater Sediment | AQKLLPASLDWEVASHVTPNVRDKTVDVDLVYSVKAPK |
| Ga0187825_102254942 | 3300017930 | Freshwater Sediment | YLPAAHKLLPSTLDWDVTPHVTANQRDKTVDVDLIYSVKAPK |
| Ga0187801_104166151 | 3300017933 | Freshwater Sediment | LLPPSLDWEVASHVTPNVRDKTVDVDLVYSVKAPK |
| Ga0187803_103580891 | 3300017934 | Freshwater Sediment | YLDAYLPEAHKLLPSRLDWEVEPHVTANVRDKTVDVDIVYSVRAPN |
| Ga0187821_100793051 | 3300017936 | Freshwater Sediment | NTTYLDEYLPAAHKLLPAALDWDVDPHVTANQRDKTVDVDLIYSVKAPK |
| Ga0187879_103281092 | 3300017946 | Peatland | QFLPLARKLLPPNLDWEVDPHVTAITRDKAVDVDLQYTAKATQ |
| Ga0187817_102171831 | 3300017955 | Freshwater Sediment | SEYLPAAHKLLPPNLDWEVASHVTANVRDKSVDVDLIYSVKAPK |
| Ga0187783_105094021 | 3300017970 | Tropical Peatland | VYDANYLAEYLPAAHKLLPASLDWEVDPHVTANIRDKTVDVDLIYSVKAPK |
| Ga0187782_115957001 | 3300017975 | Tropical Peatland | AAHKLLPASLDWEVEPHVTANIRDKTVDVDLIYSVKAPK |
| Ga0181520_105335432 | 3300017988 | Bog | LLPPTLDWEVASHVTANVRDKSVDVDLVYSVKAPK |
| Ga0187874_102319432 | 3300018019 | Peatland | AAQKLLPPTLDWEVASHVTANVRDKSVDVDLVYSVKAPK |
| Ga0187871_103163081 | 3300018042 | Peatland | RKLLPANMDWEVAPHVTAMARDKTVDVDLQYTAKAPQ |
| Ga0187784_106994421 | 3300018062 | Tropical Peatland | YLPQAQKLLPANLDWEVADHVTANSHDKTVDVDLNYTAKAPR |
| Ga0187784_110421812 | 3300018062 | Tropical Peatland | KLLPTTVDWDVSSHVTPIAVDKTVDVDLQYTAKALR |
| Ga0187772_107930801 | 3300018085 | Tropical Peatland | LPAARKLLPANMDWDVASHVTAMAKDRTVDVDLQYTAKAPQ |
| Ga0187769_102389761 | 3300018086 | Tropical Peatland | SYLSEARKLLPSRLDWEISPHATANVRDKTVDVDMIFSVKAPS |
| Ga0187769_104364192 | 3300018086 | Tropical Peatland | ARKLLPSRLDWEISPHATANIRDKTVDVDMIFSVKAPS |
| Ga0187771_105668611 | 3300018088 | Tropical Peatland | LTEAHKLLPSRLDWQVDPHVTANLRDKTVDVDIIYSVKAPN |
| Ga0193751_10405391 | 3300019888 | Soil | PAANHLLPPALDWDVAPHVTANIRDKTVDVDLIYSVRAPK |
| Ga0210407_100329811 | 3300020579 | Soil | FDSTYLSEYLPTAHKLLPSGLDWDVSPHVTANARDRTVDVDLIYSVKAPK |
| Ga0210407_112667702 | 3300020579 | Soil | VFDSTYLSEYLPAAHKLLPSGLDWDVSPHVTANARDKTVDVDLIYSVKAPK |
| Ga0210403_103994233 | 3300020580 | Soil | SEYLPAAQKLLPANFDWDVTHHETANFRDKSVDVDLIYSVKAPK |
| Ga0210393_109260191 | 3300021401 | Soil | PKARKLLPANLDWEVAPHVTAMARDKTVDVDLQYTAKAPQ |
| Ga0210393_112178981 | 3300021401 | Soil | LPAAQKLLPVNFDWDVASHVTSNLRDKSVDVDLIYTVKAPK |
| Ga0210387_117700572 | 3300021405 | Soil | ARKLLPPAFDWDVDPHVTPIVRDKTVDVDLQYTVKATQ |
| Ga0210383_101399404 | 3300021407 | Soil | KARQLLPANRDWEVAPHVTAMARDKTVDVDLQYTAKAPQ |
| Ga0210398_116021641 | 3300021477 | Soil | LPAAQKLLPANFDWDVASHVTANIRDKSVDVDLIYSVKVPK |
| Ga0126371_112773952 | 3300021560 | Tropical Forest Soil | LPTARKLLPPSLDWEVDPHVTANVGEKTVDVDLVYTVKAPK |
| Ga0242657_10642361 | 3300022722 | Soil | PAAHKLLPPTLDWDVAPHVTANVRDKTVDVDLIYSVKAPK |
| Ga0224572_10435401 | 3300024225 | Rhizosphere | ALKLLPPTLDWEVAPHVTANVRDKSVDVDLIYSVKAPK |
| Ga0208936_10002728 | 3300025404 | Peatland | RKLLPASVDWEVSSHVTAISRDKTIDVDLQYMAKAPR |
| Ga0207692_108077941 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | EAHKLLPASLDWDVASHVTANVREKTVDVDLIYSAKAPR |
| Ga0207693_109604192 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | NSTYLSEYLPAAERLLPPTLDWEVSPHVTPNVRDKTVDVDLIYTAKAPK |
| Ga0207663_112161142 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | AQRLLPPTLDWEVSPHVTPNVRDKTVDVDLIYTAKAPK |
| Ga0207649_105262752 | 3300025920 | Corn Rhizosphere | QRLLPPTLDWEVSPHVTANVKDKTVDVDLIYSAKAPK |
| Ga0207665_111068982 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MSWSRPGTIDEYLPAAQKLLPANLDWDVTPHVTANVRDKTVDVDIIYSV |
| Ga0209839_100109591 | 3300026294 | Soil | YLPAAHKLLPPTLDWDVAPHVTANGRDKTVDVDLIYSVKAPK |
| Ga0209215_10202721 | 3300027266 | Forest Soil | EYLPAAHKLLPSGLDWDVSPHVTANARDKTVDVDLIYSVKAPK |
| Ga0209580_102805142 | 3300027842 | Surface Soil | FDATYLKQYLPEAQKLLPTRLDWDIAPHVTDNLRDKTVDVDFQLTVKAPK |
| Ga0209465_100031151 | 3300027874 | Tropical Forest Soil | ARKILPANLDWDVASHVTANVKDKSVDVDLIYTAKAPK |
| Ga0209380_104980842 | 3300027889 | Soil | PAALKLLPASLDWDVASHVTANVRDKSVDVDLIYSVKAPK |
| Ga0209624_106978491 | 3300027895 | Forest Soil | QEYLPQARKLLTATVDWEVSSHTTANARDKTVDVDLQYSAKAPR |
| Ga0209698_102181703 | 3300027911 | Watersheds | DQYLPAAQKLLPASLDWEVASHVTANVRDKTVDVDLVYSVKAPK |
| Ga0209168_101172763 | 3300027986 | Surface Soil | LGEYLPDARKLLPSNFDWDVSSHVTANVREKTVDVDLIYAVKAAPK |
| Ga0265356_10424782 | 3300028017 | Rhizosphere | TYLDEYLPAALKLLPPTLDWDVASHATANDRDKTVDIDLIYTVKAPK |
| Ga0302189_103319091 | 3300028788 | Bog | QKLLPPTMDWEVTPHVTALSRDKTVDVDLQYTAKAPQ |
| Ga0302221_101431371 | 3300028806 | Palsa | LLPPTLDWDVATHVTALTGNKTVDVDLQYTAKAPQ |
| Ga0308309_101329625 | 3300028906 | Soil | PEARKLLPPSLDWEVDPHVTAITRDKTVDVDLQYTAKATQ |
| Ga0311368_102113741 | 3300029882 | Palsa | KLLPASVDWEVSTHVTALVRDKTIDVDLQYMAKAPH |
| Ga0311371_102739631 | 3300029951 | Palsa | PAAHKLLPGRFDWEVSSHVTANAKDKTVDVDLIYTVKAPK |
| Ga0302276_103078031 | 3300029992 | Bog | PQARKLLPPSLDWEVSSHVTAIAREKTVDVDLQYTAKAPK |
| Ga0265750_10134221 | 3300030813 | Soil | PAALKLLPPTLDWEVAPHVTANVRDKSVDVDLIYSVKAPK |
| Ga0170824_1167434971 | 3300031231 | Forest Soil | QEYLPEALKLLPTALDWDVAPHVTANVRDKSVDVDLIYSVKAPK |
| Ga0170824_1171577432 | 3300031231 | Forest Soil | ATYLGEYLPTAQKLLPAALDWEVASHVTANVRDKTVDVDLIYSVKAPK |
| Ga0170820_170772752 | 3300031446 | Forest Soil | TYLGEYLPTAQKLLPAALDWEVASHVTANVRDKTVDVDLIYSVKAPK |
| Ga0310686_1067450006 | 3300031708 | Soil | LPQARKLLPVTVDWDVSSHVTAIAREKTVDVDLQYTAKATH |
| Ga0307474_105624052 | 3300031718 | Hardwood Forest Soil | QARRLLPASLDWEVEPHVTAMIRDKTVDVDLQYTAKAPR |
| Ga0307474_111895952 | 3300031718 | Hardwood Forest Soil | DSTYLSEYLPAAHKLLPATLDWDVAPHVTANGRDKTVDVDLIYSVKAPK |
| Ga0307477_102150033 | 3300031753 | Hardwood Forest Soil | LLPATLDWDVAPHVTANAHDKTVDVDLIYSVKAPK |
| Ga0307478_117531541 | 3300031823 | Hardwood Forest Soil | TYLEQYLPEARKLLTANLDWLVSAHVTANVKDKTVDVDLIYSVKAPK |
| Ga0307479_119389371 | 3300031962 | Hardwood Forest Soil | YVPQARKLLPASLDWDITPHVTANLRDKTVDVDFQLTPNAPK |
| Ga0306924_112709701 | 3300032076 | Soil | ARKLLPSGLDWDVSSHVTANVRDKTVDVDLIYSVKAPK |
| Ga0335079_102123994 | 3300032783 | Soil | ATYLSDYLAEAHELLPANLDWEVSSHVTANIREKTVDVDLIYSAKAPK |
| Ga0335079_107114481 | 3300032783 | Soil | DSTYLSEYLPQARKLLPSSALDWEVQSHVTANVRDKTVDVDLIYTAKAVPL |
| Ga0335081_106377623 | 3300032892 | Soil | NASYLDEYLPIAHKLLPSNFDWDVASHVTPNLRDKTVDVDLIYTVKALQSQ |
| Ga0335074_106520811 | 3300032895 | Soil | LLPTTLDWDVASHVTPNIGDKTVDVDLIYTAKAPLSR |
| Ga0334847_020118_568_723 | 3300033826 | Soil | VYDATYLSEYLPAAQKLLPPSLDWDVASHVTANIKDKTVDVDLIYSVKAPK |
| ⦗Top⦘ |