Basic Information | |
---|---|
Family ID | F084727 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 112 |
Average Sequence Length | 42 residues |
Representative Sequence | MKLGNLIERITYYTGIKWLWKKLYPDCKCKERQEQLNDIELW |
Number of Associated Samples | 93 |
Number of Associated Scaffolds | 112 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 6.31 % |
% of genes near scaffold ends (potentially truncated) | 40.18 % |
% of genes from short scaffolds (< 2000 bps) | 76.79 % |
Associated GOLD sequencing projects | 78 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (41.964 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater (23.214 % of family members) |
Environment Ontology (ENVO) | Unclassified (54.464 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (91.964 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 69.05% β-sheet: 0.00% Coil/Unstructured: 30.95% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 112 Family Scaffolds |
---|---|---|
PF00145 | DNA_methylase | 12.50 |
PF04466 | Terminase_3 | 9.82 |
PF01555 | N6_N4_Mtase | 8.04 |
PF08299 | Bac_DnaA_C | 1.79 |
PF01507 | PAPS_reduct | 0.89 |
PF00271 | Helicase_C | 0.89 |
PF01844 | HNH | 0.89 |
COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
---|---|---|---|
COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 12.50 |
COG1783 | Phage terminase large subunit | Mobilome: prophages, transposons [X] | 9.82 |
COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 8.04 |
COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 8.04 |
COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 8.04 |
COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 1.79 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 58.04 % |
Unclassified | root | N/A | 41.96 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000101|DelMOSum2010_c10152437 | Not Available | 845 | Open in IMG/M |
3300000101|DelMOSum2010_c10209864 | Not Available | 645 | Open in IMG/M |
3300000101|DelMOSum2010_c10239237 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300000115|DelMOSum2011_c10013348 | All Organisms → Viruses → Predicted Viral | 4201 | Open in IMG/M |
3300000116|DelMOSpr2010_c10181369 | Not Available | 690 | Open in IMG/M |
3300000929|NpDRAFT_10253464 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 691 | Open in IMG/M |
3300001351|JGI20153J14318_10111905 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
3300001351|JGI20153J14318_10124582 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 662 | Open in IMG/M |
3300003580|JGI26260J51721_1050400 | Not Available | 653 | Open in IMG/M |
3300003580|JGI26260J51721_1058850 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 583 | Open in IMG/M |
3300004097|Ga0055584_101926197 | Not Available | 607 | Open in IMG/M |
3300004279|Ga0066605_10034659 | All Organisms → Viruses → Predicted Viral | 2384 | Open in IMG/M |
3300006029|Ga0075466_1074735 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 953 | Open in IMG/M |
3300006164|Ga0075441_10078087 | All Organisms → Viruses → Predicted Viral | 1283 | Open in IMG/M |
3300006165|Ga0075443_10012564 | All Organisms → Viruses → Predicted Viral | 2904 | Open in IMG/M |
3300006165|Ga0075443_10273250 | Not Available | 616 | Open in IMG/M |
3300006752|Ga0098048_1045502 | All Organisms → Viruses → Predicted Viral | 1389 | Open in IMG/M |
3300006947|Ga0075444_10111681 | Not Available | 1183 | Open in IMG/M |
3300006947|Ga0075444_10199544 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Aestuariibaculum → Aestuariibaculum marinum | 810 | Open in IMG/M |
3300007276|Ga0070747_1156276 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
3300007540|Ga0099847_1168456 | Not Available | 647 | Open in IMG/M |
3300007555|Ga0102817_1020287 | All Organisms → Viruses → Predicted Viral | 1478 | Open in IMG/M |
3300007647|Ga0102855_1024894 | All Organisms → Viruses → Predicted Viral | 1648 | Open in IMG/M |
3300007708|Ga0102859_1010750 | All Organisms → Viruses → Predicted Viral | 2267 | Open in IMG/M |
3300007862|Ga0105737_1102503 | Not Available | 723 | Open in IMG/M |
3300009076|Ga0115550_1054135 | All Organisms → Viruses → Predicted Viral | 1629 | Open in IMG/M |
3300009076|Ga0115550_1131572 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Polaribacter → unclassified Polaribacter → Polaribacter sp. IC073 | 891 | Open in IMG/M |
3300009076|Ga0115550_1164417 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 766 | Open in IMG/M |
3300009079|Ga0102814_10514070 | Not Available | 653 | Open in IMG/M |
3300009422|Ga0114998_10037507 | All Organisms → Viruses → Predicted Viral | 2648 | Open in IMG/M |
3300009428|Ga0114915_1156761 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Polaribacter → unclassified Polaribacter → Polaribacter sp. IC073 | 644 | Open in IMG/M |
3300009428|Ga0114915_1164849 | Not Available | 623 | Open in IMG/M |
3300009432|Ga0115005_10083105 | All Organisms → Viruses → Predicted Viral | 2454 | Open in IMG/M |
3300009434|Ga0115562_1118546 | All Organisms → Viruses → Predicted Viral | 1022 | Open in IMG/M |
3300009441|Ga0115007_10182343 | Not Available | 1352 | Open in IMG/M |
3300009442|Ga0115563_1005215 | Not Available | 8697 | Open in IMG/M |
3300009447|Ga0115560_1163681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → unclassified Pelagibacterales → Pelagibacterales bacterium | 877 | Open in IMG/M |
3300009507|Ga0115572_10331900 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 858 | Open in IMG/M |
3300011118|Ga0114922_10215629 | Not Available | 1616 | Open in IMG/M |
3300011251|Ga0151676_1057059 | All Organisms → Viruses → Predicted Viral | 1348 | Open in IMG/M |
3300011254|Ga0151675_1007588 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1236 | Open in IMG/M |
3300012182|Ga0136556_1015241 | All Organisms → Viruses → Predicted Viral | 2686 | Open in IMG/M |
3300020169|Ga0206127_1028069 | All Organisms → Viruses → Predicted Viral | 3314 | Open in IMG/M |
3300020169|Ga0206127_1067637 | Not Available | 1677 | Open in IMG/M |
3300020169|Ga0206127_1227873 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 658 | Open in IMG/M |
3300020263|Ga0211679_1006713 | All Organisms → Viruses → Predicted Viral | 3041 | Open in IMG/M |
3300020347|Ga0211504_1010549 | All Organisms → Viruses → Predicted Viral | 2782 | Open in IMG/M |
3300020352|Ga0211505_1028587 | All Organisms → Viruses | 1417 | Open in IMG/M |
3300020389|Ga0211680_10019313 | Not Available | 3530 | Open in IMG/M |
3300020595|Ga0206126_10186533 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 971 | Open in IMG/M |
3300021957|Ga0222717_10159828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → unclassified Pelagibacterales → Pelagibacterales bacterium | 1365 | Open in IMG/M |
3300021959|Ga0222716_10065059 | All Organisms → Viruses → Predicted Viral | 2546 | Open in IMG/M |
3300021959|Ga0222716_10372160 | Not Available | 839 | Open in IMG/M |
3300021960|Ga0222715_10502283 | Not Available | 643 | Open in IMG/M |
3300021964|Ga0222719_10106802 | All Organisms → Viruses → Predicted Viral | 2038 | Open in IMG/M |
3300022061|Ga0212023_1001568 | Not Available | 2281 | Open in IMG/M |
(restricted) 3300023112|Ga0233411_10090582 | Not Available | 975 | Open in IMG/M |
3300023567|Ga0228694_124426 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
3300023568|Ga0228696_1029922 | Not Available | 627 | Open in IMG/M |
3300024180|Ga0228668_1002541 | Not Available | 5530 | Open in IMG/M |
3300024180|Ga0228668_1028174 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1215 | Open in IMG/M |
3300024185|Ga0228669_1043503 | Not Available | 941 | Open in IMG/M |
3300024191|Ga0228636_1051643 | Not Available | 978 | Open in IMG/M |
3300024223|Ga0228601_1023459 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Polaribacter → unclassified Polaribacter → Polaribacter sp. IC073 | 775 | Open in IMG/M |
3300024236|Ga0228655_1015585 | Not Available | 1948 | Open in IMG/M |
3300024267|Ga0228623_1047586 | Not Available | 846 | Open in IMG/M |
3300024293|Ga0228651_1140453 | Not Available | 530 | Open in IMG/M |
3300024297|Ga0228658_1082345 | Not Available | 803 | Open in IMG/M |
3300024314|Ga0228657_1012426 | All Organisms → Viruses → Predicted Viral | 2094 | Open in IMG/M |
3300024314|Ga0228657_1045585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → unclassified Pelagibacterales → Pelagibacterales bacterium | 957 | Open in IMG/M |
3300024319|Ga0228670_1009098 | All Organisms → Viruses → Predicted Viral | 2841 | Open in IMG/M |
3300024320|Ga0233398_1034297 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1378 | Open in IMG/M |
3300024328|Ga0228635_1060475 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 973 | Open in IMG/M |
3300024343|Ga0244777_10394577 | Not Available | 862 | Open in IMG/M |
3300024343|Ga0244777_10498993 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 748 | Open in IMG/M |
3300024343|Ga0244777_10890620 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 520 | Open in IMG/M |
3300024417|Ga0228650_1023057 | Not Available | 1902 | Open in IMG/M |
3300024508|Ga0228663_1019518 | Not Available | 1342 | Open in IMG/M |
3300025098|Ga0208434_1047695 | Not Available | 947 | Open in IMG/M |
3300025266|Ga0208032_1021712 | All Organisms → Viruses → Predicted Viral | 1834 | Open in IMG/M |
3300025276|Ga0208814_1006196 | All Organisms → Viruses → Predicted Viral | 4566 | Open in IMG/M |
3300025276|Ga0208814_1107892 | Not Available | 688 | Open in IMG/M |
3300025508|Ga0208148_1074215 | Not Available | 781 | Open in IMG/M |
3300025577|Ga0209304_1010959 | All Organisms → Viruses → Predicted Viral | 3321 | Open in IMG/M |
3300025577|Ga0209304_1092938 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 696 | Open in IMG/M |
3300025594|Ga0209094_1073224 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Polaribacter → unclassified Polaribacter → Polaribacter sp. IC073 | 826 | Open in IMG/M |
3300025620|Ga0209405_1084914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → unclassified Pelagibacterales → Pelagibacterales bacterium | 949 | Open in IMG/M |
3300025621|Ga0209504_1110543 | Not Available | 705 | Open in IMG/M |
3300025640|Ga0209198_1001628 | Not Available | 16674 | Open in IMG/M |
3300026453|Ga0228644_1079428 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 583 | Open in IMG/M |
3300026483|Ga0228620_1003956 | All Organisms → Viruses → Predicted Viral | 4975 | Open in IMG/M |
3300026483|Ga0228620_1058973 | Not Available | 851 | Open in IMG/M |
3300026491|Ga0228641_1110386 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 582 | Open in IMG/M |
3300026505|Ga0228647_1123729 | Not Available | 603 | Open in IMG/M |
3300027204|Ga0208924_121712 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 524 | Open in IMG/M |
3300027212|Ga0208554_1068144 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 552 | Open in IMG/M |
3300027367|Ga0208801_1061926 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 555 | Open in IMG/M |
3300027668|Ga0209482_1000849 | Not Available | 24189 | Open in IMG/M |
3300027687|Ga0209710_1027064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → unclassified Legionellales → Legionellales bacterium | 2884 | Open in IMG/M |
3300027714|Ga0209815_1015541 | All Organisms → Viruses → Predicted Viral | 3325 | Open in IMG/M |
3300027771|Ga0209279_10206892 | Not Available | 586 | Open in IMG/M |
3300027849|Ga0209712_10336917 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 853 | Open in IMG/M |
3300027858|Ga0209013_10163812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → unclassified Mycoplasmatota → Tenericutes bacterium 4572_104 | 1382 | Open in IMG/M |
(restricted) 3300027861|Ga0233415_10488495 | Not Available | 595 | Open in IMG/M |
3300028129|Ga0228634_1099628 | Not Available | 640 | Open in IMG/M |
3300028130|Ga0228619_1078002 | Not Available | 832 | Open in IMG/M |
3300028336|Ga0247583_1059967 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 896 | Open in IMG/M |
3300031589|Ga0307996_1061760 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
3300031601|Ga0307992_1104042 | Not Available | 1145 | Open in IMG/M |
3300031631|Ga0307987_1164470 | Not Available | 552 | Open in IMG/M |
3300031645|Ga0307990_1200290 | Not Available | 783 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 23.21% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 11.61% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 11.61% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 8.93% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 6.25% |
Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 4.46% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.46% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 4.46% |
Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 4.46% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 3.57% |
Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 3.57% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 2.68% |
Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 2.68% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.79% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.79% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.89% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.89% |
Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.89% |
Marine | Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine | 0.89% |
Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.89% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
3300001351 | Pelagic Microbial community sample from North Sea - COGITO 998_met_03 | Environmental | Open in IMG/M |
3300003580 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA | Environmental | Open in IMG/M |
3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
3300004279 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10m | Environmental | Open in IMG/M |
3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
3300006165 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA | Environmental | Open in IMG/M |
3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
3300007647 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02 | Environmental | Open in IMG/M |
3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
3300007862 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2um | Environmental | Open in IMG/M |
3300009076 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 | Environmental | Open in IMG/M |
3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
3300009422 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 | Environmental | Open in IMG/M |
3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
3300009432 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome | Environmental | Open in IMG/M |
3300009434 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 | Environmental | Open in IMG/M |
3300009441 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome | Environmental | Open in IMG/M |
3300009442 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 | Environmental | Open in IMG/M |
3300009447 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509 | Environmental | Open in IMG/M |
3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
3300011251 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.2 | Environmental | Open in IMG/M |
3300011254 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.02 | Environmental | Open in IMG/M |
3300012182 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Torckler E6 #831 | Environmental | Open in IMG/M |
3300013108 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 103m, 250-2.7um, replicate b | Environmental | Open in IMG/M |
3300020169 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1 | Environmental | Open in IMG/M |
3300020263 | Marine microbial communities from Tara Oceans - TARA_B100000809 (ERX555942-ERR599125) | Environmental | Open in IMG/M |
3300020347 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994) | Environmental | Open in IMG/M |
3300020352 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556084-ERR599144) | Environmental | Open in IMG/M |
3300020389 | Marine microbial communities from Tara Oceans - TARA_B100000809 (ERX556139-ERR599008) | Environmental | Open in IMG/M |
3300020595 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1 | Environmental | Open in IMG/M |
3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
3300022061 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2) | Environmental | Open in IMG/M |
3300023112 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MG | Environmental | Open in IMG/M |
3300023567 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 80R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023568 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 84R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024180 | Seawater microbial communities from Monterey Bay, California, United States - 82D | Environmental | Open in IMG/M |
3300024185 | Seawater microbial communities from Monterey Bay, California, United States - 84D | Environmental | Open in IMG/M |
3300024191 | Seawater microbial communities from Monterey Bay, California, United States - 45D | Environmental | Open in IMG/M |
3300024223 | Seawater microbial communities from Monterey Bay, California, United States - 1D | Environmental | Open in IMG/M |
3300024236 | Seawater microbial communities from Monterey Bay, California, United States - 67D | Environmental | Open in IMG/M |
3300024267 | Seawater microbial communities from Monterey Bay, California, United States - 28D | Environmental | Open in IMG/M |
3300024293 | Seawater microbial communities from Monterey Bay, California, United States - 63D | Environmental | Open in IMG/M |
3300024297 | Seawater microbial communities from Monterey Bay, California, United States - 71D | Environmental | Open in IMG/M |
3300024314 | Seawater microbial communities from Monterey Bay, California, United States - 70D | Environmental | Open in IMG/M |
3300024319 | Seawater microbial communities from Monterey Bay, California, United States - 85D | Environmental | Open in IMG/M |
3300024320 | Seawater microbial communities from Monterey Bay, California, United States - 38D | Environmental | Open in IMG/M |
3300024328 | Seawater microbial communities from Monterey Bay, California, United States - 44D | Environmental | Open in IMG/M |
3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
3300024417 | Seawater microbial communities from Monterey Bay, California, United States - 62D | Environmental | Open in IMG/M |
3300024508 | Seawater microbial communities from Monterey Bay, California, United States - 77D | Environmental | Open in IMG/M |
3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025266 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 (SPAdes) | Environmental | Open in IMG/M |
3300025276 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) | Environmental | Open in IMG/M |
3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025577 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 (SPAdes) | Environmental | Open in IMG/M |
3300025594 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 (SPAdes) | Environmental | Open in IMG/M |
3300025620 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 (SPAdes) | Environmental | Open in IMG/M |
3300025621 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 (SPAdes) | Environmental | Open in IMG/M |
3300025640 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 (SPAdes) | Environmental | Open in IMG/M |
3300026453 | Seawater microbial communities from Monterey Bay, California, United States - 56D | Environmental | Open in IMG/M |
3300026483 | Seawater microbial communities from Monterey Bay, California, United States - 23D | Environmental | Open in IMG/M |
3300026491 | Seawater microbial communities from Monterey Bay, California, United States - 52D | Environmental | Open in IMG/M |
3300026505 | Seawater microbial communities from Monterey Bay, California, United States - 59D | Environmental | Open in IMG/M |
3300027204 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-3 (SPAdes) | Environmental | Open in IMG/M |
3300027212 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 (SPAdes) | Environmental | Open in IMG/M |
3300027367 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02 (SPAdes) | Environmental | Open in IMG/M |
3300027668 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA (SPAdes) | Environmental | Open in IMG/M |
3300027687 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes) | Environmental | Open in IMG/M |
3300027714 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes) | Environmental | Open in IMG/M |
3300027771 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA (SPAdes) | Environmental | Open in IMG/M |
3300027849 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes) | Environmental | Open in IMG/M |
3300027858 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 2 (SPAdes) | Environmental | Open in IMG/M |
3300027861 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG | Environmental | Open in IMG/M |
3300028129 | Seawater microbial communities from Monterey Bay, California, United States - 42D | Environmental | Open in IMG/M |
3300028130 | Seawater microbial communities from Monterey Bay, California, United States - 22D | Environmental | Open in IMG/M |
3300028336 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 42R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031589 | Marine microbial communities from David Island wharf, Antarctic Ocean - #35 | Environmental | Open in IMG/M |
3300031601 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #133 | Environmental | Open in IMG/M |
3300031631 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #181 | Environmental | Open in IMG/M |
3300031645 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #129 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
DelMOSum2010_101524373 | 3300000101 | Marine | IERITYYTGIKWLWKKLYPDCKCKERQEQLNDIELW* |
DelMOSum2010_102098642 | 3300000101 | Marine | GNLIERITYYTGIKWLWKKLYPDCKCKERQENLNDIELW* |
DelMOSum2010_102392371 | 3300000101 | Marine | MKLGNLIERITYYTGIKWLWKKLYPDCKCKERQXQLNDIELW* |
DelMOSum2011_100133489 | 3300000115 | Marine | MKLGNLIERITYYTGIKWIWKKLYPDCKCKERQEHLNDIELW* |
DelMOSpr2010_101813694 | 3300000116 | Marine | GDLIERITYYTGIKWLWKKLYPNCKCDERQNNLNGIELW* |
NpDRAFT_102534643 | 3300000929 | Freshwater And Marine | MKLGNLIERITYYTGIKWLWSKLYPECKCKQRQENLNDIELW* |
JGI20153J14318_101119052 | 3300001351 | Pelagic Marine | MKLGNLIERITYYTGXKWLWKKLYPDCKCKERQEQLNEIELW* |
JGI20153J14318_101245824 | 3300001351 | Pelagic Marine | MKLGNLIERITYYTGIKWIWKKLYPDCKCKERQEQLNEIELW* |
JGI26260J51721_10504002 | 3300003580 | Marine | IKRKTKRMKLGNLIERITYYTGIKWLWKKLYPDCKCKERQEELNDIELW* |
JGI26260J51721_10588501 | 3300003580 | Marine | KLGNLIERITYYTGIKWLWKKLYPDCKCKERQENLNDIELW* |
Ga0055584_1019261972 | 3300004097 | Pelagic Marine | MKLGNLIERITYYTGIKWLWKKLYPDCKCKERQEQLNDIELW* |
Ga0066605_100346596 | 3300004279 | Marine | MKLGNLIERITYYTGIKWLWKKLYPDCKCKERQENLNDIELW* |
Ga0075466_10747352 | 3300006029 | Aqueous | MKLGNLIERITYYTGIKWIWKKLYPDCKCKERQEQLNDIELW* |
Ga0075441_100780872 | 3300006164 | Marine | MKLGNLIELITRYTGIKWIWKKMSPDCKCDERRESLNDIELW* |
Ga0075443_100125643 | 3300006165 | Marine | MKLGNLIERITYYTGIKWLWKKLYPDCKCKERQESLNDIELW* |
Ga0075443_102732502 | 3300006165 | Marine | MKLGNLIELITRYTGIKWVWKKMSPDCNCDERRESLNDIELW* |
Ga0098048_10455022 | 3300006752 | Marine | MKLGNLIERITYYTGIKWLWKKLYPDCKCKERQEKLNHIELW* |
Ga0075444_101116812 | 3300006947 | Marine | MKLGNLIELITRYSGIKWVWKKVSPNCKCDERQEKLNDIELW* |
Ga0075444_101995442 | 3300006947 | Marine | MKLGNLIELITRYSGIKWVWKKVSPNCKCDERQESLNDIELW* |
Ga0070747_11562762 | 3300007276 | Aqueous | ERITYYTGIKWLWKKLYPDCKCKERQENLNDIELW* |
Ga0099847_11684561 | 3300007540 | Aqueous | MKLGNLIERITYYTGIKWLWKKLYPDCKCKERQEQLNDIE |
Ga0102817_10202873 | 3300007555 | Estuarine | MKLGNLIERITYYTGIKWLWKKLYPDCKCKERQEKLNDIELW* |
Ga0102855_10248941 | 3300007647 | Estuarine | GKRQIKRKTKRMKLGNLIERITYYTGIKWLWKKLYPQCKCKERQENLNDIELW* |
Ga0102859_10107504 | 3300007708 | Estuarine | MKLGNLIERITYYTGIKWLWKKLYPQCKCKERQENLNDIELW* |
Ga0105737_11025032 | 3300007862 | Estuary Water | MKLGNLIERITYYTGIKWLWKKLYPNCKCKERQENLNDIELW* |
Ga0115550_10541352 | 3300009076 | Pelagic Marine | MKLGNLIERITYYTGIKWIWKKLYPDCKCKERQEQLNHIELW* |
Ga0115550_11315723 | 3300009076 | Pelagic Marine | MKLGNLIERITYYTGIKWLWKKLYPDCKCKERQEQLNDI |
Ga0115550_11644174 | 3300009076 | Pelagic Marine | KLGNLIERITYYTGIKWLWKKLYPDCKCKERQEQLNDIELW* |
Ga0102814_105140702 | 3300009079 | Estuarine | MKLGNLIERITYYTGIKWLWKKLYPDCKCKERQEHLNDIELW* |
Ga0114998_100375078 | 3300009422 | Marine | MKLGNLIERITYYTGIKWIWKKLYPNCKCDERQNNLNGIELW* |
Ga0114915_11567611 | 3300009428 | Deep Ocean | MKLGNLIERITYYTGIKWLWKKLYPDCKCKERQESLND |
Ga0114915_11648493 | 3300009428 | Deep Ocean | MKLGNLIELITRYTGIKWVWKKVSPNCKCDERQESLNDIELW* |
Ga0115005_100831057 | 3300009432 | Marine | MKLGNLIERITYYTGIKWLWKKLYPNCKCDERQNNLNSIELW* |
Ga0115562_11185462 | 3300009434 | Pelagic Marine | MKLGNLIERITYYTGIKWLWKKLYPECKCKQRQENLNDIELW* |
Ga0115007_101823433 | 3300009441 | Marine | MRLGDFIELFTKFTGIKRLWKKIHPNCKCDERKQNLNDIELW* |
Ga0115563_100521510 | 3300009442 | Pelagic Marine | MKLGNLIERITYYTGIKWLWKKLYPECKCKQRQENLNHIELF* |
Ga0115560_11636812 | 3300009447 | Pelagic Marine | MKLGNLIERITYYTGIKWLWRKLYPECKCKQRQENLNDIELW* |
Ga0115572_103319003 | 3300009507 | Pelagic Marine | MKLGDFIELITYYTGIKWIWKKLYPNCKCKERQEQLNDIELW* |
Ga0114922_102156294 | 3300011118 | Deep Subsurface | MKLGNLIERITYYTGIKWLWRKLYPECKCKQRQNYLNDIELW* |
Ga0151676_10570592 | 3300011251 | Marine | MKLGNLIERITYYTGIKWLWKRLYPDCKCKERQEQLNEIELW* |
Ga0151675_10075881 | 3300011254 | Marine | MKLGNLIERITYYTGIKWLWKKLYPDCKCKERQEQLNEIELW* |
Ga0136556_10152416 | 3300012182 | Saline Lake | MKLGNLIELITRYTGIKWIWKKVSPDCNCDERQESLNDIELW* |
Ga0171648_1309951 | 3300013108 | Marine | MKLGDLIERITFYTGIKWFVKKIFGDDCGCDERQEQLN |
Ga0206127_10280695 | 3300020169 | Seawater | MKLGNLIERITYYTGIKWLWKKLYPDCKCKERQEQLNDIELW |
Ga0206127_10676373 | 3300020169 | Seawater | MKLGNLIERITYYTGIKWIWKKLYPNCKCKERQEQLNHIELW |
Ga0206127_12278731 | 3300020169 | Seawater | NLIERITYYTGIKWLWKKLYPDCKCKERQEQLNEIELW |
Ga0211679_10067132 | 3300020263 | Marine | MKLGNFIERFTRYTGIKWAWKKISPDCKCDERQKSLNDIELW |
Ga0211504_10105492 | 3300020347 | Marine | MKLGNLIERITHYTGIKWLWKKLYPDCKCKERQEQLNDIELW |
Ga0211505_10285872 | 3300020352 | Marine | MKLGNLIERITHYTGIKWIWKKLYPDCKCKERQEQLNDIELW |
Ga0211680_100193132 | 3300020389 | Marine | MKLGNLIELITRYSGIKWVWKKVSPNCKCDERQEKLNDIELW |
Ga0206126_101865332 | 3300020595 | Seawater | MKLGNLIERITYYTGIKWLWKKLYPDCKCKERQEQLNEIELW |
Ga0222717_101598281 | 3300021957 | Estuarine Water | MKLGNLIERITYYTGIKWLWKKLYPDCKCKERQEQ |
Ga0222716_100650593 | 3300021959 | Estuarine Water | MKLGDFIERITYYTGIKWIWKKLYPNCKCKERQDQLNDIQLW |
Ga0222716_103721602 | 3300021959 | Estuarine Water | MKLGNLIERITYYTGIKWLWKKLYPDCKCKERQEKLNHIELW |
Ga0222715_105022831 | 3300021960 | Estuarine Water | MKLGNLIERITYYTGIKWLWKKLYPDCKCKERQEQLNDIEL |
Ga0222719_101068024 | 3300021964 | Estuarine Water | MKLGNLIERITYYTGIKWLWKKLYPDCKCKERQEKLNDIELW |
Ga0212023_10015688 | 3300022061 | Aqueous | MKLGNLIERITYYTGIKWIWKKLYPDCKCKERQEQLNDIELW |
(restricted) Ga0233411_100905822 | 3300023112 | Seawater | MKLGNLIERITYYTGIKWLWKKLYPDCKCKERQENLNDIELW |
Ga0228694_1244262 | 3300023567 | Seawater | QKGKRQIKRKTKRMKLGNLIERITYYTGIKWLWKKLYPDCKCKERQEQLNDIELW |
Ga0228696_10299222 | 3300023568 | Seawater | MKLGNLIERITYYTGIKWLWEKLYPDCKCKERQEQLNDIELW |
Ga0228668_100254113 | 3300024180 | Seawater | MKLGDFIERITYYTGIKWIWKKLYPNCKCKERQEQLNDIQLW |
Ga0228668_10281741 | 3300024180 | Seawater | RQIKRKTKRMKLGNLIERITYYTGIKWLWKKLYPDCKCKERQEKLNHIELW |
Ga0228669_10435032 | 3300024185 | Seawater | MKLGNFIERITYYTGIKWLWKKLYPDCKCKERQEQLNDIELW |
Ga0228636_10516432 | 3300024191 | Seawater | MKLGNLIERITYYTGIKWLWKKIYPDCKCKERQEQLNDIELW |
Ga0228601_10234593 | 3300024223 | Seawater | MKLGNLIERITYYTGIKWLWKKLYPDCKCKERQEKLNHI |
Ga0228655_10155851 | 3300024236 | Seawater | KRMKLGNLIERITYYTGIKWLWKKLYPDCKCKERQEKLNHIELW |
Ga0228623_10475862 | 3300024267 | Seawater | MKLGDFIERITYYTGIKWIWKKLYPNCKCKERQDQLN |
Ga0228651_11404531 | 3300024293 | Seawater | MKLGNLIERITYYTGIKWLWKKLYPDCKCKERQEK |
Ga0228658_10823451 | 3300024297 | Seawater | MKLGNLIERITYYTGIKWLWKKLYPDCKCKERQEHLNDIE |
Ga0228657_10124261 | 3300024314 | Seawater | IQKGKRQIKRKTKRMKLGNLIERITYYTGIKWLWEKLYPDCKCKERQEQLNDIELW |
Ga0228657_10455851 | 3300024314 | Seawater | MKLGNLIERITYYTGIKWLWKKLYPDCKCKERQEHLN |
Ga0228670_100909810 | 3300024319 | Seawater | KNFIKFKRMKLGNLIERITYYTGIKWLWKKLYPDCKCKERQEKLNHIELW |
Ga0233398_10342977 | 3300024320 | Seawater | KNFIKFKRMKLGNLIERITYYTGIKWLWKKLYPDCKCKERQEQLNDIELW |
Ga0228635_10604752 | 3300024328 | Seawater | MKLGNLIERITYYTGIKWIWKKLYPDCKCKERQENLNDIELW |
Ga0244777_103945771 | 3300024343 | Estuarine | MKLGNLIERITYYTGIKWLWKKLYPDCKCKERQEELND |
Ga0244777_104989931 | 3300024343 | Estuarine | GNLIERITYYTGIKWLWKKLYPDCKCKERQEQLNDIELW |
Ga0244777_108906201 | 3300024343 | Estuarine | QIKRKTKRMKLGNLIERITYYTGIKWLWKKLYPDCKCKERQENLNDIELW |
Ga0228650_10230571 | 3300024417 | Seawater | IKNFIKFKRMKLGNLIERITYYTGIKWLWKKLYPDCKCKERQEQLNDIELW |
Ga0228663_10195183 | 3300024508 | Seawater | MKLGDFIERVTYYTGIKWIWKKLYPNCKCKERQDQLNDIQLW |
Ga0208434_10476953 | 3300025098 | Marine | KLGNLIERITYYTGIKWLWKKLYPDCKCKERQEQLNDIELW |
Ga0208032_10217126 | 3300025266 | Deep Ocean | MKLGNLIELITRYSGIKWVWKKVSPNCKCDERQESLNDIELW |
Ga0208814_10061969 | 3300025276 | Deep Ocean | MKLGNLIELITRYSGIKWVWKKVSPNCKCDERQESLNDINLWD |
Ga0208814_11078923 | 3300025276 | Deep Ocean | MKLGNLIELITRYTGIKWVWKKVSPNCKCDERQESLNDIELW |
Ga0208148_10742153 | 3300025508 | Aqueous | FIERITYYTGIKWLVKKLFKDCGCDKRQEELNDIELW |
Ga0209304_10109594 | 3300025577 | Pelagic Marine | MKLGNLIERITYYTGIKWIWKKLYPDCKCKERQEQLNHIELW |
Ga0209304_10929382 | 3300025577 | Pelagic Marine | MKLGNLIERITYYTGIKWIWKKLYPDCKCKERQEQLNEIELW |
Ga0209094_10732243 | 3300025594 | Pelagic Marine | MVVIKNFIKFKRMKLGNLIERITYYTGIKWLWKKLYPDCKCKERQEQLNEIELW |
Ga0209405_10849142 | 3300025620 | Pelagic Marine | MKLGNLIERITYYTGIKWLWKKLYPECKCKQRQENLNDIELW |
Ga0209504_11105431 | 3300025621 | Pelagic Marine | LIERITYYTGIKWLWKKLYPDCKCKERQEQLNEIELW |
Ga0209198_100162813 | 3300025640 | Pelagic Marine | MKLGNLIERITYYTGIKWLWKKLYPECKCKQRQENLNHIELF |
Ga0228644_10794281 | 3300026453 | Seawater | MKLGNLIERITYYIGIKWLWKKLYPDCKCKERQEQLNDIELW |
Ga0228620_10039561 | 3300026483 | Seawater | KFKRMKLGNLIERITYYTGIKWLWKKLYPDCKCKERQEKLNHIELW |
Ga0228620_10589731 | 3300026483 | Seawater | MKLGDFIERITYYTGIKWIWKKLYPNCKCKERQDQ |
Ga0228641_11103863 | 3300026491 | Seawater | MKLGNLIERITYYTGIKWLWKKLYPDCKCKERQEHLNDIELW |
Ga0228647_11237291 | 3300026505 | Seawater | MKLGNLIERITYYTGIKWLWKKLYPDCKCKERQEQLND |
Ga0208924_1217121 | 3300027204 | Estuarine | RQIKRKTKRMKLGNLIERITYYTGIKWLWKKLYPDCKCKERQENLNDIELW |
Ga0208554_10681443 | 3300027212 | Estuarine | RKTKRMKLGNLIERITYYTGIKWLWKKLYPDCKCKERQENLNDIELW |
Ga0208801_10619263 | 3300027367 | Estuarine | IERITYYTGIKWLWKKLYPDCKCKERQENLNDIELW |
Ga0209482_100084919 | 3300027668 | Marine | MKLGNLIELITRYTGIKWVWKKMSPDCNCDERRESLNDIELW |
Ga0209710_10270643 | 3300027687 | Marine | MKLGNLIERITYYTGIKWIWKKLYPNCKCDERQNNLNGIELW |
Ga0209815_10155418 | 3300027714 | Marine | MKLGNLIERITYYTGIKWLWKKLYPDCKCKERQESLNDIELW |
Ga0209279_102068922 | 3300027771 | Marine | MKLGNLIELITRYTGIKWVWKKVSPDCNCDERQESLNDIELW |
Ga0209712_103369172 | 3300027849 | Marine | MKLGNLIERITYYTGIKWLWKKLYPNCKCDERQNNLNSIELW |
Ga0209013_101638121 | 3300027858 | Marine | MKLGNLIERITYYTGIKWLWKKLYPDCRCKGRQENLNDIELW |
(restricted) Ga0233415_104884951 | 3300027861 | Seawater | RQIKRKTKRMKLGNLIERITYYTGIKWLWKKLYPDCKCKERQEHLNDIELW |
Ga0228634_10996283 | 3300028129 | Seawater | IVAIKNFIKFKRMKLGNLIERITYYTGIKWLWKKLYPDCKCKERQEKLNHIELW |
Ga0228619_10780021 | 3300028130 | Seawater | MKLGDFIERITYYTGIKWIWKKLYPNCKCKERQDQL |
Ga0247583_10599676 | 3300028336 | Seawater | ERITYYTGIKWLWKKLYPDCKCKERQEQLNDIELW |
Ga0307996_10617602 | 3300031589 | Marine | MKLGNLIELITRYTGIKWVWKKVSPDCKCDERQESLNDIELW |
Ga0307992_11040423 | 3300031601 | Marine | MKLGNLIELITRYSGIKWVWKKVSPNCKCDERQDKLNDIELW |
Ga0307987_11644701 | 3300031631 | Marine | TKYTGIKWLIKKIYRDKDCGCDVRKNKLNDIELWN |
Ga0307990_12002902 | 3300031645 | Marine | IELITRYSGIKWVWKKVSPNCKCDERQDKLNDIELW |
⦗Top⦘ |