Basic Information | |
---|---|
Family ID | F084707 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 112 |
Average Sequence Length | 38 residues |
Representative Sequence | MDVFEEIVIFVVSNGYYFAAIPFVIGIIGAILKAYEVF |
Number of Associated Samples | 72 |
Number of Associated Scaffolds | 112 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 21.43 % |
% of genes near scaffold ends (potentially truncated) | 8.93 % |
% of genes from short scaffolds (< 2000 bps) | 84.82 % |
Associated GOLD sequencing projects | 68 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.46 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (89.286 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine (33.929 % of family members) |
Environment Ontology (ENVO) | Unclassified (95.536 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (88.393 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.48% β-sheet: 0.00% Coil/Unstructured: 51.52% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 112 Family Scaffolds |
---|---|---|
PF00565 | SNase | 32.14 |
PF01618 | MotA_ExbB | 22.32 |
PF01521 | Fe-S_biosyn | 1.79 |
PF13640 | 2OG-FeII_Oxy_3 | 1.79 |
PF07992 | Pyr_redox_2 | 0.89 |
PF07460 | NUMOD3 | 0.89 |
PF06414 | Zeta_toxin | 0.89 |
PF01592 | NifU_N | 0.89 |
PF05992 | SbmA_BacA | 0.89 |
COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
---|---|---|---|
COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 1.79 |
COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 1.79 |
COG0822 | Fe-S cluster assembly scaffold protein IscU, NifU family | Posttranslational modification, protein turnover, chaperones [O] | 0.89 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 89.29 % |
All Organisms | root | All Organisms | 10.71 % |
Visualization |
---|
Powered by ApexCharts |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 33.93% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 22.32% |
Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 15.18% |
Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 7.14% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 4.46% |
Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 3.57% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 3.57% |
Marine Oceanic | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic | 3.57% |
Hydrothermal Vent Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume | 1.79% |
Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.89% |
Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.89% |
Background Seawater | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater | 0.89% |
Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids | 0.89% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.89% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000140 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - February 2009 P26 500m | Environmental | Open in IMG/M |
3300000163 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P16 2000m | Environmental | Open in IMG/M |
3300000219 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - February 2010 P16 1000m | Environmental | Open in IMG/M |
3300000222 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P12 500m | Environmental | Open in IMG/M |
3300000264 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_A_09_P04_500 | Environmental | Open in IMG/M |
3300001683 | Hydrothermal vent plume microbial communities from Guaymas Basin, Gulf of California - IDBA assembly | Environmental | Open in IMG/M |
3300001781 | Hydrothermal vent plume microbial communities from the Mid Cayman Rise - Deep Sites | Environmental | Open in IMG/M |
3300005604 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV63 | Environmental | Open in IMG/M |
3300005948 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_O2min_ad_571m_LV | Environmental | Open in IMG/M |
3300005953 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_Bottom_ad_3770_LV_A | Environmental | Open in IMG/M |
3300005969 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_Bottom_ad_4513_LV_A | Environmental | Open in IMG/M |
3300006013 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_NADW_ad_2500m_LV_B | Environmental | Open in IMG/M |
3300006166 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 | Environmental | Open in IMG/M |
3300006304 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_1000m | Environmental | Open in IMG/M |
3300006306 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_0500m | Environmental | Open in IMG/M |
3300006308 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0500m | Environmental | Open in IMG/M |
3300006309 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_1_0500m | Environmental | Open in IMG/M |
3300006310 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_3_0500m | Environmental | Open in IMG/M |
3300006311 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_1000m | Environmental | Open in IMG/M |
3300006313 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0770m | Environmental | Open in IMG/M |
3300006324 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_0500m | Environmental | Open in IMG/M |
3300006325 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0500m | Environmental | Open in IMG/M |
3300006335 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_2_0500m | Environmental | Open in IMG/M |
3300006336 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0500m | Environmental | Open in IMG/M |
3300006338 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_1_0770m | Environmental | Open in IMG/M |
3300006339 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_3_0500m | Environmental | Open in IMG/M |
3300006340 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0770m | Environmental | Open in IMG/M |
3300006341 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT236_2_0770m | Environmental | Open in IMG/M |
3300006344 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0500m | Environmental | Open in IMG/M |
3300006346 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0770m | Environmental | Open in IMG/M |
3300006414 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0500m | Environmental | Open in IMG/M |
3300006416 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0770m | Environmental | Open in IMG/M |
3300006753 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG | Environmental | Open in IMG/M |
3300006900 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_Bottom_ad_5009_LV_A | Environmental | Open in IMG/M |
3300006902 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_250_ad_251m_LV_A | Environmental | Open in IMG/M |
3300007160 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_1000m | Environmental | Open in IMG/M |
3300007291 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_AAIW_ad_750m_LV_A | Environmental | Open in IMG/M |
3300007756 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample CTDBack_2015_DNA CLC_assembly | Environmental | Open in IMG/M |
3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
3300009544 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome | Environmental | Open in IMG/M |
3300009595 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3635_2500 | Environmental | Open in IMG/M |
3300009622 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3321_4155 | Environmental | Open in IMG/M |
3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
3300020263 | Marine microbial communities from Tara Oceans - TARA_B100000809 (ERX555942-ERR599125) | Environmental | Open in IMG/M |
3300020286 | Marine microbial communities from Tara Oceans - TARA_B100000470 (ERX556011-ERR599131) | Environmental | Open in IMG/M |
3300020290 | Marine microbial communities from Tara Oceans - TARA_B100000749 (ERX556131-ERR599154) | Environmental | Open in IMG/M |
3300020389 | Marine microbial communities from Tara Oceans - TARA_B100000809 (ERX556139-ERR599008) | Environmental | Open in IMG/M |
3300020399 | Marine microbial communities from Tara Oceans - TARA_B100000470 (ERX555969-ERR598947) | Environmental | Open in IMG/M |
3300021065 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 500m 12015 | Environmental | Open in IMG/M |
3300021087 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 | Environmental | Open in IMG/M |
3300021359 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021442 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 | Environmental | Open in IMG/M |
3300021791 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Daikoku_FS921 150_kmer | Environmental | Open in IMG/M |
3300025052 | Marine viral communities from the Pacific Ocean - LP-37 (SPAdes) | Environmental | Open in IMG/M |
3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025188 | Marine microbial communities from the Deep Atlantic Ocean - MP2913 (SPAdes) | Environmental | Open in IMG/M |
3300026092 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_O2min_ad_571m_LV (SPAdes) | Environmental | Open in IMG/M |
3300026103 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3321_4155 (SPAdes) | Environmental | Open in IMG/M |
3300027622 | Marine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_3_550m (SPAdes) | Environmental | Open in IMG/M |
3300027810 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes) | Environmental | Open in IMG/M |
3300027827 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - AAIW_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
3300028487 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_2000m | Environmental | Open in IMG/M |
3300031757 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 32315 | Environmental | Open in IMG/M |
3300031766 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515 | Environmental | Open in IMG/M |
3300031801 | Marine microbial communities from Western Arctic Ocean, Canada - CB27_Tmax_986 | Environmental | Open in IMG/M |
3300031886 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 3416 | Environmental | Open in IMG/M |
3300032032 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 32315 | Environmental | Open in IMG/M |
3300032278 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MG | Environmental | Open in IMG/M |
3300032820 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MG | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
LPfeb09P26500mDRAFT_10087333 | 3300000140 | Marine | MDVFEEIVIFVFSYGYIFASIPFVLGIIGAVLKAYEVF* |
LPjun09P162000mDRAFT_10232373 | 3300000163 | Marine | MDVFEEIVIFVFSYGYIFAAIPFVLGIIGAILKAHQVF* |
LPfeb10P161000mDRAFT_10621582 | 3300000219 | Marine | MDVFEEIVIFVFSYGYVFAAIPFVLGIIGAILKANEVF* |
LPjun09P12500mDRAFT_10162124 | 3300000222 | Marine | MGVFETLEEVVIFVVSYGYYFAAIPFIIGIIGAVLKAYEVF* |
LP_A_09_P04_500DRAFT_10178473 | 3300000264 | Marine | MDVFEEIVIFVFSYGYVFASIPFVIGILGAILKAYEVF* |
GBIDBA_100841893 | 3300001683 | Hydrothermal Vent Plume | MDVFEEIVIFVVSNGYYFASIPFVIGIIGAVLKAHEVF* |
Deep_10258011 | 3300001781 | Hydrothermal Vent Plume | MNVFEEVVIFVFSYGYIIAAIPFGLGIIGAVVFN* |
Ga0066852_102480752 | 3300005604 | Marine | MKLKGVYDTIEEIVIFVVSYGYYFASIPFILGILGAIILD* |
Ga0066380_100572012 | 3300005948 | Marine | MDVFEETVIFVVSYGYFFAAIPFAIGILGAILKANEVF* |
Ga0066383_100307721 | 3300005953 | Marine | FEEIVIFVVSNGYYFASIPFIIGIIGAILKANQVF* |
Ga0066383_101970061 | 3300005953 | Marine | MGVFEEVVIFVFTYGYIFAAIPFVLGIIGAILKAHQVF* |
Ga0066369_102349482 | 3300005969 | Marine | MDVFEEIVIFVFSYGYIFAAIPFILGIIGAIVLN* |
Ga0066382_101125663 | 3300006013 | Marine | MDVFEEIVIFVVSNGYYFAAIPFVIGTIAAVLKAYEVF* |
Ga0066836_104141193 | 3300006166 | Marine | MKLKGVYDTIEEIVIFVVSYGYYFAAIPFILGILGAIILD* |
Ga0068504_11240123 | 3300006304 | Marine | MGVFEEIVIFVFTYGYIFAAIPFVLGIIGAIVLN* |
Ga0068469_11770901 | 3300006306 | Marine | MDVFEEIVIFVVSNGYYFASIPFVIGTIAAVLKAYEVF* |
Ga0068469_11793382 | 3300006306 | Marine | MKLMDVFEETVIFVVSYGYFFAAIPFAIGILGAILKAHEVF* |
Ga0068469_11825612 | 3300006306 | Marine | MDVFEEIVIFVFSYGYVFAAIPFVLGIIGAILKAYEVF* |
Ga0068470_11002127 | 3300006308 | Marine | MDVFEEIVIFVVSNGYYFASIPFVVGTIAAILKAYEVF* |
Ga0068470_11311463 | 3300006308 | Marine | MRLMDVFEETVIFVVSYGYFFAAIPFAIGILGAILKANEVF* |
Ga0068470_11698984 | 3300006308 | Marine | MRLMDVFEETVIFIVSYGYFFAAIPFAIGILGAILKAHEVF* |
Ga0068470_14446523 | 3300006308 | Marine | MGVFDTLEEIIIFVVSYGYYFASIPFILGIIGAIVLN* |
Ga0068470_14583513 | 3300006308 | Marine | MKLMDVFEETVIFVVSYGYYFAAIPFVLGIIGAIVLN* |
Ga0068479_11001293 | 3300006309 | Marine | MDVFEETVIFVVSYGYFFAAIPFAIGILGAILKAHEVF* |
Ga0068479_12133842 | 3300006309 | Marine | MDVFEEIVIFVVSNGYYFAAIPFVIGIIGAILKAYEVF* |
Ga0068471_10812053 | 3300006310 | Marine | MDVFEEIVIFIVSNGYYFASIPFVIGTIAAVLKAYEVF* |
Ga0068471_12281255 | 3300006310 | Marine | MDVFEEIVIFVFSYGYIFAAIPFVLGFIGAIVLN* |
Ga0068471_12390448 | 3300006310 | Marine | MGAFDTLEEIIIFVVSYGYYFAAIPFVLGIIGAIVLN* |
Ga0068471_12709289 | 3300006310 | Marine | MAVFDYIEETVIFVVSYGYYFAAIPFILGIIGAILKANEVF* |
Ga0068471_13763173 | 3300006310 | Marine | MKLMDVFEETVIFVVSYGYFFAAIPFTIGILGAILKAYEVF* |
Ga0068471_14899473 | 3300006310 | Marine | MDVFEEIVIFVVSNGYYFASIPFVIGIIGAILKAHEVF* |
Ga0068471_15027605 | 3300006310 | Marine | MDVFEEIVIFVVSYGYYFAAIPFILGIIGAIVLN* |
Ga0068478_11324073 | 3300006311 | Marine | MGVFEEIVIFVVSYGYIFAAIPFVLGIIGAIVLN* |
Ga0068472_104793442 | 3300006313 | Marine | MDVFEEIVIFVFSYGYVFAAIPFVLGIIGAIVLN* |
Ga0068476_12009663 | 3300006324 | Marine | TRLMAVFDYIEEIVIFVVSYGYYFAAIPFVLGIIGAIVLN* |
Ga0068476_12265762 | 3300006324 | Marine | MDVFEEIVIFVVSHGYYFAAIPFAIGILGAILKANEVF* |
Ga0068501_10993563 | 3300006325 | Marine | MDVFEEIVIFVFSYGYIFASIPFFLGTIAAVLKAYEVF* |
Ga0068501_11613463 | 3300006325 | Marine | MAVFDYIEETVIFVVSYGYYFAAIPFVLGIIGAIVLN* |
Ga0068501_12690462 | 3300006325 | Marine | MDVFEEIVIFVFSYGYVFASIPFVLGIIGAILKAHEVF* |
Ga0068480_11159643 | 3300006335 | Marine | MDVFEEIVIFVFSYGYVFAAIPFVIGILGAILKANEVF* |
Ga0068480_13091933 | 3300006335 | Marine | MGVFDTLEEIIIFIVSYGYYFAAIPFILGIIGAIVLN* |
Ga0068502_19250511 | 3300006336 | Marine | MDVFEEIIIFVVSNGYYFAAIPFVIGVIGAILKAYEVF* |
Ga0068482_13479355 | 3300006338 | Marine | MDVFEEVIIFVVSHGYYFAAIPFVLGIIGAVLKAYEVF* |
Ga0068481_12121374 | 3300006339 | Marine | MDVFEEIVIFVVSHGYYFAAIPFVIGTIAAILKAYEVF* |
Ga0068481_12121383 | 3300006339 | Marine | MDVFEEIVIFVVSYGYYFAAIPFVIGTIAAILKAHEVF* |
Ga0068481_12518612 | 3300006339 | Marine | MDVFEEIVIFVFSYGYVFASIPFVLGILGAILKAYEVF* |
Ga0068481_13592043 | 3300006339 | Marine | MAVFDYIEETVIFVVSYGYYFASIPFILGIIGAIVLN* |
Ga0068481_14256203 | 3300006339 | Marine | MDVFEETVMFVVSYGYFFAAIPFVIGTIAAILKAHEGF* |
Ga0068481_14363142 | 3300006339 | Marine | MDVFEEIVIFIVSYGYNFAAIPFVLGIIGAIVLN* |
Ga0068481_14443352 | 3300006339 | Marine | MDVFEETIIFIVSYGYYFAAIPFVLGIIGAIVLN* |
Ga0068503_1020081110 | 3300006340 | Marine | MDVFEEIVIFVVSYGYIFAAIPFVLGIIGAIVLN* |
Ga0068503_104014232 | 3300006340 | Marine | MDVFEEIVIFVFSYGYIFASIPFVLGIIGAILKAYEVF* |
Ga0068503_104984682 | 3300006340 | Marine | MDVFEETVIFIVSYGYFFAAIPFVIGIIGAVLKAYEVF* |
Ga0068503_105792403 | 3300006340 | Marine | MDVFEEIVIFVFSYGYIFAAIPFVLGIIGAILKANEVF* |
Ga0068503_106543051 | 3300006340 | Marine | MDVFEEIVIFVVSYGYYFASIPFVIGIIGAILKAHE |
Ga0068503_106685792 | 3300006340 | Marine | MGVFEEIVIFVFSYGYIFASIPFVLGIIGAVLKAYEVF* |
Ga0068493_105139411 | 3300006341 | Marine | TKLMDVFEEIVIFVFSYGYVFAAIPFVLGIIGAILKANEVF* |
Ga0099695_11225103 | 3300006344 | Marine | MDVFEEIVIFVVSNGYYFASIPFVIGTIAAILKAHEVF* |
Ga0099696_11018702 | 3300006346 | Marine | MDVFEEIVIFVFSYGYIFAAIPFVLGIIGAILKAYEVF* |
Ga0099957_10744724 | 3300006414 | Marine | MDVFEETVIFVVSYGYYFAAIPFVLGIIGAIVLN* |
Ga0099957_11323572 | 3300006414 | Marine | MDVFEEIVIFVVSHGYYFAAIPFVVGTIAAILKAYEVF* |
Ga0100043_105857062 | 3300006416 | Marine | MDVFEEIVIFVFSYGYIFAAIPFVLGIIGAIVLN* |
Ga0100043_107114463 | 3300006416 | Marine | MDVFEEIVIFVVSNGYYFAAIPFVIGIIGAILKANEVF* |
Ga0098039_10408773 | 3300006753 | Marine | MGVFDTFEEIIIFVVSYGYYFAAIPFVLGIIGAIVLN* |
Ga0066376_101699574 | 3300006900 | Marine | MGVFEEVFIFIVSHGWYFASIPFVLGIIGAILKANEVF* |
Ga0066376_105014501 | 3300006900 | Marine | MDVFEEIVIFVFSYGYIFAAIPFVLGIIGAILKAHEVF* |
Ga0066372_106006281 | 3300006902 | Marine | MAVFDYIEETVIFVVSYGYYFAAIPFILGIIGAIVLN* |
Ga0066372_107471233 | 3300006902 | Marine | MAVFDLIEETVIFVVSYGYYFAAIPFVLGIIGAIILN* |
Ga0099959_13062273 | 3300007160 | Marine | MDVFEEIVIFVFSYGYIFAAIPFVLGIIGAILKANQVF* |
Ga0066367_10337413 | 3300007291 | Marine | MDVFEEIVIFVVSNGYYFAAIPFVIGIIGAVLKAYEVF* |
Ga0105664_11410902 | 3300007756 | Background Seawater | MDVFEETVIFVVSYGYFFAAIPFAIGILGAVLKAYEVF* |
Ga0114996_100721667 | 3300009173 | Marine | MGVFEEILIFIVSYGYFFAAIPFVIGIIGAILKANEVF* |
Ga0114994_100700094 | 3300009420 | Marine | MGVFEEIIIFIISYGYYFTAIPFVLGIIGAILKANEVF* |
Ga0114997_100919155 | 3300009425 | Marine | MGVFEEIIIFIVSYGYFFAAIPFVIGIIGAILKANEVF* |
Ga0115006_122322802 | 3300009544 | Marine | VFEETVIFIVSYGYFFAAIPFAIGILGAILKAHEVF* |
Ga0105214_1025293 | 3300009595 | Marine Oceanic | MDVFEEIVIFVVSNGYYFASIPFIIGIIGAILKAHQVF* |
Ga0105173_10075412 | 3300009622 | Marine Oceanic | MNIFEEVVIFIFSYGYIFAAIPFGLGIIGAIVLN* |
Ga0105173_10205772 | 3300009622 | Marine Oceanic | MDIFEEVVIFVFSYGYIIAAIPFGLGIIGAVVFN* |
Ga0115000_100936103 | 3300009705 | Marine | MGVFEEIIIFIISYGYFFAAIPFVIGIIGAILKANEVF* |
Ga0181395_11921562 | 3300017779 | Seawater | MNLMDVFEETVIFIVSYGYYFAAIPFVIGTIAAILKAHEVF |
Ga0211679_10366302 | 3300020263 | Marine | MDVFEETVIFVVSYGYFFAAIPFAIGILGAILKAHEVF |
Ga0211624_10551622 | 3300020286 | Marine | MDVFEEIVIFVVSNGYYFAAIPFVIGIIGAVLKAYEVF |
Ga0211698_10738962 | 3300020290 | Marine | MDVFEEIVIFVVSNGYYFAAIPFVIGIIAAVLKAYEVF |
Ga0211680_101325332 | 3300020389 | Marine | MDVFEETVIFVVSYGYFFAAIPFAIGILGAILKANEVF |
Ga0211623_101319732 | 3300020399 | Marine | MRLMDVFEETVIFIVSYGYFFAAIPFAIGILGAILKAHEVF |
Ga0206686_11619032 | 3300021065 | Seawater | MDVFEEIVIFVFSYGYVFASIPFVIGILGAILKAYEVF |
Ga0206683_102221393 | 3300021087 | Seawater | MDVFEEIVIFVVSHGYYFAAIPFVLGTIAAILKAYEVF |
Ga0206689_104888201 | 3300021359 | Seawater | VFEEIVIFVFSYGYVFASIPFVIGILGAILKAYEVF |
Ga0206685_100014963 | 3300021442 | Seawater | MAVFDYIEETVIFVVSYGYYFASIPFVIGIIGAILKAHEVF |
Ga0206685_103257043 | 3300021442 | Seawater | MDVFEEIVIFVFSYGYVFAAIPFVLGIIGAILKANEVF |
Ga0226832_103856172 | 3300021791 | Hydrothermal Vent Fluids | MKLKGVYDTIEEIVIFVVSYGYYFASIPFILGILGAIILD |
Ga0207906_10283492 | 3300025052 | Marine | MDVFEEIVIFVFSYGYIFASIPFVLGIIGAVLKAYEVF |
Ga0208919_12457962 | 3300025128 | Marine | MKLKGVYDTIEEIVIFVVSYGYYFAAIPFILGILGAIILD |
Ga0207913_10274292 | 3300025188 | Deep Ocean | MDVFEEIVIFVVSNGYYFASIPFIIGIIGAILKANQVF |
Ga0207965_10518733 | 3300026092 | Marine | MKLMDVFEETVIFVVSYGYFFAAIPFAIGILGAILKANEVF |
Ga0208451_10463612 | 3300026103 | Marine Oceanic | MGVFEEVFIFIVSHGWYFASIPFVLGIIGAILKANEVF |
Ga0209753_10280343 | 3300027622 | Marine | MAVFDYIEETVIFVVSYGYYFASIPFILGIIGAIVLN |
Ga0209302_104667861 | 3300027810 | Marine | FEEIIIFIVSYGYFFAAIPFVIGIIGAILKANEVF |
Ga0209035_100986271 | 3300027827 | Marine | MDVFEEIVIFVVSNGYYFAAIPFVIGTIAAVLKAYEVF |
Ga0209035_105613381 | 3300027827 | Marine | MDVFEEIVIFVVSNGYYFAAIPFVIGIIGAVLKAYEV |
Ga0257109_11002363 | 3300028487 | Marine | LMDVFEEIVIFVFSYGYIFAAIPFVLGIIGAILKAHQVF |
Ga0257109_12221321 | 3300028487 | Marine | VFEEIVIFVFSYGYIFAAIPFVLGIIGAILKANQVF |
Ga0315328_104386913 | 3300031757 | Seawater | MDVFEEIVIFVVSYGYYFAAIPFVIGTIAAILKAHEVF |
Ga0315322_107666372 | 3300031766 | Seawater | MKLMDVFEETIIFVVSYGYYFAAIPFVIGTIAAILKAHEVF |
Ga0310121_1001239410 | 3300031801 | Marine | MRLMDVFEETVIFVVSYGYFFAAIPFAIGILGAILKAHEVF |
Ga0310121_102179422 | 3300031801 | Marine | MDVFEEIVIFVVSNGYYFASIPFVIGTIAAILKAHEVF |
Ga0315318_101890534 | 3300031886 | Seawater | MDVFEEIVIFVVSNGYYFASIPFVIGIIGAILKAHEVF |
Ga0315327_109937712 | 3300032032 | Seawater | MDVFEEIVIFVVSNGYYFASIPFVIGTIAAVLKAYEVF |
Ga0310345_110529443 | 3300032278 | Seawater | MDVFEEIVIFIVSNGYYFASIPFVIGTIAAVLKAYEVF |
Ga0310345_116199412 | 3300032278 | Seawater | MDVFEETVIFIVSYGYFFAAIPFVIGTIAAVLKAYEVF |
Ga0310342_1015664821 | 3300032820 | Seawater | MDVFEEIVIFVVSHGYYFAAIPFVIGTIAAILKAHEVF |
Ga0310342_1034852632 | 3300032820 | Seawater | MDVFEETVIFIVSYGYFFAAIPFAIGILGAILKAHEVF |
⦗Top⦘ |