Basic Information | |
---|---|
Family ID | F084669 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 112 |
Average Sequence Length | 43 residues |
Representative Sequence | GRLNPKVTVWGKDGTPEDVVEHYVARLLKGLVNDRHIVVAD |
Number of Associated Samples | 101 |
Number of Associated Scaffolds | 112 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 4.46 % |
% of genes near scaffold ends (potentially truncated) | 93.75 % |
% of genes from short scaffolds (< 2000 bps) | 92.86 % |
Associated GOLD sequencing projects | 98 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.52 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (54.464 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.179 % of family members) |
Environment Ontology (ENVO) | Unclassified (22.321 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.321 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.29% β-sheet: 11.59% Coil/Unstructured: 68.12% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 112 Family Scaffolds |
---|---|---|
PF06319 | MmcB-like | 66.96 |
PF01008 | IF-2B | 9.82 |
PF01370 | Epimerase | 7.14 |
PF13546 | DDE_5 | 1.79 |
PF03401 | TctC | 0.89 |
PF12697 | Abhydrolase_6 | 0.89 |
PF01063 | Aminotran_4 | 0.89 |
PF03462 | PCRF | 0.89 |
PF02954 | HTH_8 | 0.89 |
PF04828 | GFA | 0.89 |
PF07859 | Abhydrolase_3 | 0.89 |
PF02092 | tRNA_synt_2f | 0.89 |
COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
---|---|---|---|
COG5321 | Uncharacterized conserved protein | Function unknown [S] | 66.96 |
COG0182 | 5-methylthioribose/5-deoxyribulose 1-phosphate isomerase (methionine salvage pathway), a paralog of eIF-2B alpha subunit | Amino acid transport and metabolism [E] | 9.82 |
COG1184 | Translation initiation factor 2B subunit, eIF-2B alpha/beta/delta family | Translation, ribosomal structure and biogenesis [J] | 9.82 |
COG0115 | Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase | Amino acid transport and metabolism [E] | 1.79 |
COG0216 | Protein chain release factor RF1 | Translation, ribosomal structure and biogenesis [J] | 0.89 |
COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.89 |
COG0751 | Glycyl-tRNA synthetase, beta subunit | Translation, ribosomal structure and biogenesis [J] | 0.89 |
COG1186 | Protein chain release factor PrfB | Translation, ribosomal structure and biogenesis [J] | 0.89 |
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.89 |
COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.89 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 54.46 % |
All Organisms | root | All Organisms | 45.54 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300004153|Ga0063455_101013750 | Not Available | 603 | Open in IMG/M |
3300004157|Ga0062590_102826978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 519 | Open in IMG/M |
3300004480|Ga0062592_101303471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 686 | Open in IMG/M |
3300004480|Ga0062592_102547138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia | 515 | Open in IMG/M |
3300005167|Ga0066672_10701643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 648 | Open in IMG/M |
3300005180|Ga0066685_10353682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1020 | Open in IMG/M |
3300005332|Ga0066388_104056763 | Not Available | 747 | Open in IMG/M |
3300005332|Ga0066388_106881084 | Not Available | 572 | Open in IMG/M |
3300005332|Ga0066388_108028613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. 1NLS2 | 528 | Open in IMG/M |
3300005341|Ga0070691_10408223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 767 | Open in IMG/M |
3300005437|Ga0070710_10640351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 744 | Open in IMG/M |
3300005507|Ga0074259_10064035 | Not Available | 518 | Open in IMG/M |
3300005545|Ga0070695_100616786 | Not Available | 853 | Open in IMG/M |
3300005545|Ga0070695_101606116 | Not Available | 543 | Open in IMG/M |
3300005548|Ga0070665_100652215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1066 | Open in IMG/M |
3300005555|Ga0066692_10274914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1066 | Open in IMG/M |
3300005713|Ga0066905_101285885 | Not Available | 657 | Open in IMG/M |
3300005842|Ga0068858_101949316 | Not Available | 581 | Open in IMG/M |
3300006172|Ga0075018_10587183 | Not Available | 591 | Open in IMG/M |
3300006175|Ga0070712_101553216 | Not Available | 579 | Open in IMG/M |
3300006578|Ga0074059_12140314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 646 | Open in IMG/M |
3300006844|Ga0075428_102169257 | Not Available | 573 | Open in IMG/M |
3300006914|Ga0075436_101415995 | Not Available | 527 | Open in IMG/M |
3300007004|Ga0079218_11936350 | Not Available | 669 | Open in IMG/M |
3300009089|Ga0099828_10227871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1666 | Open in IMG/M |
3300009089|Ga0099828_10476301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1126 | Open in IMG/M |
3300009156|Ga0111538_10191068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2599 | Open in IMG/M |
3300009553|Ga0105249_10014009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 7088 | Open in IMG/M |
3300010037|Ga0126304_10745510 | Not Available | 663 | Open in IMG/M |
3300010043|Ga0126380_10758511 | Not Available | 788 | Open in IMG/M |
3300010045|Ga0126311_10972151 | Not Available | 693 | Open in IMG/M |
3300010046|Ga0126384_11218364 | Not Available | 695 | Open in IMG/M |
3300010047|Ga0126382_11845721 | Not Available | 570 | Open in IMG/M |
3300010166|Ga0126306_11500932 | Not Available | 559 | Open in IMG/M |
3300010358|Ga0126370_12075133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 557 | Open in IMG/M |
3300010359|Ga0126376_11419684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 720 | Open in IMG/M |
3300010360|Ga0126372_11387249 | Not Available | 735 | Open in IMG/M |
3300010360|Ga0126372_12919975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 530 | Open in IMG/M |
3300010362|Ga0126377_11805379 | Not Available | 687 | Open in IMG/M |
3300010366|Ga0126379_12198833 | Not Available | 653 | Open in IMG/M |
3300010366|Ga0126379_13762517 | Not Available | 508 | Open in IMG/M |
3300010376|Ga0126381_100870191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1296 | Open in IMG/M |
3300010396|Ga0134126_12099016 | Not Available | 617 | Open in IMG/M |
3300010398|Ga0126383_10409257 | Not Available | 1395 | Open in IMG/M |
3300010863|Ga0124850_1000108 | All Organisms → cellular organisms → Bacteria | 11637 | Open in IMG/M |
3300010868|Ga0124844_1136931 | Not Available | 931 | Open in IMG/M |
3300011106|Ga0151489_1508616 | Not Available | 642 | Open in IMG/M |
3300012205|Ga0137362_11034238 | Not Available | 699 | Open in IMG/M |
3300012356|Ga0137371_10017236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 5548 | Open in IMG/M |
3300012683|Ga0137398_10771922 | Not Available | 671 | Open in IMG/M |
3300012917|Ga0137395_10702901 | Not Available | 731 | Open in IMG/M |
3300012951|Ga0164300_10874827 | Not Available | 565 | Open in IMG/M |
3300012961|Ga0164302_10501253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 857 | Open in IMG/M |
3300012989|Ga0164305_10227081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → Lysobacter dokdonensis | 1332 | Open in IMG/M |
3300013306|Ga0163162_10356090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium mongolense | 1596 | Open in IMG/M |
3300015077|Ga0173483_10309428 | Not Available | 777 | Open in IMG/M |
3300015374|Ga0132255_101029503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1236 | Open in IMG/M |
3300015374|Ga0132255_103976718 | Not Available | 627 | Open in IMG/M |
3300016294|Ga0182041_10223169 | Not Available | 1516 | Open in IMG/M |
3300016294|Ga0182041_11845507 | Not Available | 561 | Open in IMG/M |
3300018077|Ga0184633_10331086 | Not Available | 772 | Open in IMG/M |
3300018083|Ga0184628_10246863 | Not Available | 937 | Open in IMG/M |
3300018433|Ga0066667_12007985 | Not Available | 532 | Open in IMG/M |
3300018465|Ga0190269_11173562 | Not Available | 600 | Open in IMG/M |
3300018466|Ga0190268_11880676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 544 | Open in IMG/M |
3300019263|Ga0184647_1474274 | Not Available | 1628 | Open in IMG/M |
3300019867|Ga0193704_1078608 | Not Available | 608 | Open in IMG/M |
3300020581|Ga0210399_10917356 | Not Available | 710 | Open in IMG/M |
3300021372|Ga0213877_10254074 | Not Available | 585 | Open in IMG/M |
3300021384|Ga0213876_10239902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 964 | Open in IMG/M |
3300021560|Ga0126371_13859515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 505 | Open in IMG/M |
3300025898|Ga0207692_10494832 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
3300025920|Ga0207649_11120200 | Not Available | 621 | Open in IMG/M |
3300025929|Ga0207664_11187150 | Not Available | 681 | Open in IMG/M |
3300025935|Ga0207709_11855884 | Not Available | 502 | Open in IMG/M |
3300025938|Ga0207704_10318344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1199 | Open in IMG/M |
3300026078|Ga0207702_11861485 | Not Available | 593 | Open in IMG/M |
3300026326|Ga0209801_1243938 | Not Available | 688 | Open in IMG/M |
3300026328|Ga0209802_1241636 | Not Available | 631 | Open in IMG/M |
3300026557|Ga0179587_10687906 | Not Available | 674 | Open in IMG/M |
3300027181|Ga0208997_1027724 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
3300027388|Ga0208995_1061362 | Not Available | 660 | Open in IMG/M |
3300027565|Ga0209219_1177518 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300027633|Ga0208988_1125584 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300027703|Ga0207862_1172417 | Not Available | 645 | Open in IMG/M |
3300027903|Ga0209488_10491419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 901 | Open in IMG/M |
3300028380|Ga0268265_10026480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 4127 | Open in IMG/M |
3300028716|Ga0307311_10137886 | Not Available | 698 | Open in IMG/M |
3300028880|Ga0307300_10247640 | Not Available | 590 | Open in IMG/M |
3300028906|Ga0308309_10171255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1765 | Open in IMG/M |
3300031170|Ga0307498_10032772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1293 | Open in IMG/M |
3300031226|Ga0307497_10010254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2641 | Open in IMG/M |
3300031226|Ga0307497_10219374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 834 | Open in IMG/M |
3300031543|Ga0318516_10369281 | Not Available | 827 | Open in IMG/M |
3300031545|Ga0318541_10208370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1082 | Open in IMG/M |
3300031546|Ga0318538_10060409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1879 | Open in IMG/M |
3300031561|Ga0318528_10261570 | Not Available | 928 | Open in IMG/M |
3300031572|Ga0318515_10144591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1265 | Open in IMG/M |
3300031640|Ga0318555_10025484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2831 | Open in IMG/M |
3300031680|Ga0318574_10187597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1185 | Open in IMG/M |
3300031680|Ga0318574_10208554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1123 | Open in IMG/M |
3300031723|Ga0318493_10747856 | Not Available | 549 | Open in IMG/M |
3300031736|Ga0318501_10715161 | Not Available | 553 | Open in IMG/M |
3300031805|Ga0318497_10123267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1404 | Open in IMG/M |
3300031858|Ga0310892_10410667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 884 | Open in IMG/M |
3300031880|Ga0318544_10030577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1868 | Open in IMG/M |
3300031893|Ga0318536_10243347 | Not Available | 914 | Open in IMG/M |
3300031897|Ga0318520_10792314 | Not Available | 594 | Open in IMG/M |
3300031912|Ga0306921_10614928 | Not Available | 1255 | Open in IMG/M |
3300031946|Ga0310910_10595180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 877 | Open in IMG/M |
3300031954|Ga0306926_10243068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2232 | Open in IMG/M |
3300032090|Ga0318518_10065706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1757 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.18% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.71% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.14% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.25% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.36% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.46% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.57% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.57% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.68% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.68% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.68% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.68% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.79% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.79% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.79% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.89% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.89% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.89% |
Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.89% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.89% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.89% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.89% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.89% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.89% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.89% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.89% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.89% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.89% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.89% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.89% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005507 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 | Host-Associated | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
3300011106 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300019263 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019867 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1 | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021372 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01 | Environmental | Open in IMG/M |
3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027181 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027388 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0063455_1010137501 | 3300004153 | Soil | LSAKVTVWGRDGTPEDVVQHYIGQLLKGLVTDRQIIVAN* |
Ga0062590_1028269781 | 3300004157 | Soil | LVSWVGRAGRLNPKVTVWGRDGTPEDVVEHYVARLLKGLVNDRHIVVAD* |
Ga0062592_1013034711 | 3300004480 | Soil | LVSWVGRAGRLNPKVTVWGRDGTPEDVVEHYVARLLKGLVNDRHIIVAD* |
Ga0062592_1025471381 | 3300004480 | Soil | WTGRSGRLDPKVTVWGKDGTPEDVVQNYIAQLLKGLVPDRKISVAD* |
Ga0066672_107016431 | 3300005167 | Soil | VSWSGRSGRLSPKVTVWGRDGTPEDVVGHYVAQLLKGLVNEGRIFVAAD* |
Ga0066685_103536823 | 3300005180 | Soil | YLVSWSGRSGRLSPKVTVWGRDGAPEDVVGHYVAQLLKGLVNERRIFVAAD* |
Ga0066388_1040567632 | 3300005332 | Tropical Forest Soil | RLSAKVTVWGKDGTPEDIVQTYIAQLLKGLVPGGKIIVAAD* |
Ga0066388_1068810842 | 3300005332 | Tropical Forest Soil | RLRAKVIVWGKDGTPADVVQNYTTQLLKGLVPDRRISVAAE* |
Ga0066388_1080286131 | 3300005332 | Tropical Forest Soil | LSPKVTVWGRDGTPAHVIRLYIARLLKGLVPARQISIADDTQRT* |
Ga0070691_104082232 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | VSWVGRAGRLNPKVTVWGRDGTPEDVVEHYVARLLKGLVNDRHIVVAD* |
Ga0070710_106403512 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | DYLVSWTGRPGRLSAKVTVWGKDGTPTHVVQGYIARLLKGLVSARQIVIAAD* |
Ga0074259_100640351 | 3300005507 | Arabidopsis Rhizosphere | WSGRSGRLRPKVTVWGNNGTPEDVVEHYVAQLLKGLVSNQHISVAAD* |
Ga0070695_1006167862 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | FVSFKNRAGRNSAKVTVWGREDTPHEVVQHYIAQLLHGLVPDRQIIVAD* |
Ga0070695_1016061161 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | GRLNPKVTVWGRDGTPEDVVEHYVARLLKGLVNDRHIVVAD* |
Ga0070665_1006522151 | 3300005548 | Switchgrass Rhizosphere | VGRAGRLNPKVTVWGRDGTPEDVVEHYVARLLKGLVNDRHIVVAD* |
Ga0066692_102749143 | 3300005555 | Soil | VTVWGKDGTPQDVVQRYVSGLLSGLVSDGQIVVAVE* |
Ga0066905_1012858852 | 3300005713 | Tropical Forest Soil | KVTVWGNNGTPEDVVEHYVAQLLKGLVSNQHISVAAD* |
Ga0068858_1019493161 | 3300005842 | Switchgrass Rhizosphere | GRLNPKVTVWGKDGTPEDVVEHYVARLLKGLVSDRHIIVAD* |
Ga0075018_105871831 | 3300006172 | Watersheds | LSAKVTVWGKDGTPEDIVQTYIVQLLKGLVPGGKITVAAD* |
Ga0070712_1015532161 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | WVGRAGRLNPKVTVWGRDGTPEDVVEHYVARLLKGLVNDRHIVVAE* |
Ga0074059_121403141 | 3300006578 | Soil | VSWSGRSGRLSPRVTVWGRDGTPEDVVGHYVAQLLKGLVNEGRIFVAAD* |
Ga0075428_1021692571 | 3300006844 | Populus Rhizosphere | KVTVWGKDGTPEDVVQHYIARLLKGLVPDRRIIVAD* |
Ga0075436_1014159951 | 3300006914 | Populus Rhizosphere | VSWSGRSGKLKAKVTVWGKDGTPQDIVQHYISRLLRGLVTDGQIYVAAD* |
Ga0079218_119363502 | 3300007004 | Agricultural Soil | AGRYSAKVTVWGKSDTPADIVRHYIARLLKGLVPDQQINVAAD* |
Ga0099828_102278713 | 3300009089 | Vadose Zone Soil | RLSAKVTVWGNDGTPEDVVQNYITQLLKGLVSDGKITVAAD* |
Ga0099828_104763011 | 3300009089 | Vadose Zone Soil | LSDYLLSWSGRAGRLRAKVTVWGKDGTPEDVVEHYISRLLKGLVNDGQIVVAD* |
Ga0111538_101910684 | 3300009156 | Populus Rhizosphere | GRLNPKVTVWGRDGTPEDVVEHYVARLLKGLVNDRHIVVAE* |
Ga0105249_100140099 | 3300009553 | Switchgrass Rhizosphere | WVGRAGRLNPKVTVWGRDGTPEDVVEHYVARLLKGLVNDRHIVVAD* |
Ga0126304_107455101 | 3300010037 | Serpentine Soil | SDYLVSWTGRRGLLSAKVTVWGRDGTPEDVVQHYIGQLLKGLVTDRQIIVAN* |
Ga0126380_107585112 | 3300010043 | Tropical Forest Soil | PKVTVWGNNGTPEDVVEHYVARLLKGLVSNQHISVAAD* |
Ga0126311_109721512 | 3300010045 | Serpentine Soil | YLVSWTGRRGLLSAKVTVWGRDGTPEDVVQHYIGQLLKGLVTDRQIIVAN* |
Ga0126384_112183641 | 3300010046 | Tropical Forest Soil | RSGRLSPKVTVWGKDGTPEDVVGHYVAQLLKGLVNEGRIFVAAD* |
Ga0126382_118457212 | 3300010047 | Tropical Forest Soil | TVWGKDGTPEDVVGHYVAQLLRGLVSERRIFVAAD* |
Ga0126306_115009321 | 3300010166 | Serpentine Soil | GRRGLLSAKVTVWGRDGTPEDVVQHYIRQLLKGLVTDRQIIVAN* |
Ga0126370_120751331 | 3300010358 | Tropical Forest Soil | LVSWSGRSGRLSPKVTVWGKNGTPADVVGHYVAQLLKGLVNERRIFVAAD* |
Ga0126376_114196841 | 3300010359 | Tropical Forest Soil | TVWGKDGAPADVVGHYVAQLLKGLVNERRIFVAAD* |
Ga0126372_113872492 | 3300010360 | Tropical Forest Soil | VWGRDGTPEDVVGHYVAQLLKGLVNERRIFVAAD* |
Ga0126372_129199751 | 3300010360 | Tropical Forest Soil | KVTVWGKDGTPDDVVQSYVTRLLRGLVGDGQIFVAAE* |
Ga0126377_118053791 | 3300010362 | Tropical Forest Soil | TVWGKDGTPDDVVQSYVTRLLRGLVGDGQIFVAAE* |
Ga0126379_121988332 | 3300010366 | Tropical Forest Soil | MTVWGRDGTPEDVVGHYVAQLLKGLVNERQIFVAAD* |
Ga0126379_137625171 | 3300010366 | Tropical Forest Soil | GRLSPKVTVWGKDGAPADVVGHYVAQLLKGLVNERRIFVAAD* |
Ga0126381_1008701911 | 3300010376 | Tropical Forest Soil | RFGLLSDYLVSWSGRAGRLRAKVTVWGKDGTPEDVVQGYVSHLLKGLVSDGQFFVAAE* |
Ga0134126_120990161 | 3300010396 | Terrestrial Soil | PKVTVWGRDGTPEDVVEHYVARLLKGLVSDRHIIVAD* |
Ga0126383_104092573 | 3300010398 | Tropical Forest Soil | DYLVSWSGRSGRLSPKVTVWGKNGTPADVVGHYVAQLLKGLVNERRIFVAAD* |
Ga0124850_100010813 | 3300010863 | Tropical Forest Soil | LSHDLVSWSGRSGRLSPKVTVLGRDGTPEDVVGHYVAQLLKGLVNEGRIFVAAD* |
Ga0124844_11369313 | 3300010868 | Tropical Forest Soil | DYLVSWSGRSGRLRPKVTVWGNNGTPEDVVEHYVAQLLKGLVSNQHISVAAD* |
Ga0151489_15086161 | 3300011106 | Soil | WSGRSGRLSPKVTVWGRGGTPEDVVGHYVAQLLKGLVSEGRIFVAAD* |
Ga0137362_110342382 | 3300012205 | Vadose Zone Soil | AGRLSAKVTVWAKDGTPEDVAQHYVARLLKGLVKGRQIFVAAD* |
Ga0137371_100172366 | 3300012356 | Vadose Zone Soil | GRSGRLSPKVTVWGRDGAPEDVVGHYVAQLLKGLVNERRIFVAAD* |
Ga0137398_107719221 | 3300012683 | Vadose Zone Soil | KVTVWGKDGTPEHVVQSYIARLLKGLVNDRQIFVAAD* |
Ga0137395_107029012 | 3300012917 | Vadose Zone Soil | MGRAGRLSAKVTVWAKDGTPEDVAQHYVARLLKGLVKGRQIFVAED* |
Ga0164300_108748272 | 3300012951 | Soil | AGRFNPKVTVWGKDGTPEDVVEHYVTRLLKGLVSDRHIIVAD* |
Ga0164302_105012532 | 3300012961 | Soil | VTVWGKDGTPEDVVGHYVAQLLKGLVSEGRIFVAAD* |
Ga0164305_102270811 | 3300012989 | Soil | RLSAKVTVWGKDGTPTHVVQGYIARLLKGLVSARQIVIAAD* |
Ga0163162_103560901 | 3300013306 | Switchgrass Rhizosphere | GLLSAKVTVWGRDGTPEDVVQHYIGQLLKGLVTDRQIIVAN* |
Ga0173483_103094281 | 3300015077 | Soil | WVGRAGRLNPKVTVWGRDGTPEDVVEHYVARLLKGLVSDRHIIVAD* |
Ga0132255_1010295033 | 3300015374 | Arabidopsis Rhizosphere | TVWGRDGTPEDVVEHYVARLLKGLVNDRHIVVAE* |
Ga0132255_1039767181 | 3300015374 | Arabidopsis Rhizosphere | RAGRLNPKVTVWGKDGTPEDVVEHYVARLLKGLVNDRHIVVAD* |
Ga0182041_102231693 | 3300016294 | Soil | RSGRLSPKVTVWGKNGTPADVVGHYVAQLLKGLVNERRIFVAAD |
Ga0182041_118455072 | 3300016294 | Soil | DYLVSWSGRSGRLSPKVTVWGKDGAPADVVGHYVAQLLKGLVNERRIFVAAD |
Ga0184633_103310861 | 3300018077 | Groundwater Sediment | GRLNPKVTVWGRDGTPEDVVEHYVARLLKGLVNDRHIVVAD |
Ga0184628_102468631 | 3300018083 | Groundwater Sediment | VSWVGRAGRLNPKVTVWGRDGTPEDVVEHYVARLLKGLVNDRHIVVAD |
Ga0066667_120079852 | 3300018433 | Grasslands Soil | VWGRDGTPAHVIRRYIARLLKGLVSARQISIAADDIQRA |
Ga0190269_111735621 | 3300018465 | Soil | GRAGRLNPKVTVWGKDGTPEDVVEHYVARLLKGLVNDRHIVVAD |
Ga0190268_118806761 | 3300018466 | Soil | KYGLVTDYFVSWSGRAGRLRAKVTVWPKDGTSDDVAQHYIARLLKGLVPGGQISVAN |
Ga0184647_14742741 | 3300019263 | Groundwater Sediment | PKVTVWGRDGTPEDVVEHYVARLLKGLVNDRHIVVAD |
Ga0193704_10786081 | 3300019867 | Soil | RAGRLNPKVTVWGKDGTPEDVVEHYVARLLKGLVNDRHIVVAD |
Ga0210399_109173562 | 3300020581 | Soil | YLVSWSGRSGRLSPKVTVWGRDGTPEDVVGHYVAQLLKGLVNERRIFVAAD |
Ga0213877_102540742 | 3300021372 | Bulk Soil | VTVWGRDGTPEDVVGHYVAQLLKGLVNERRIFVAAD |
Ga0213876_102399023 | 3300021384 | Plant Roots | RLRPKVTVWGNNRTPERVVEDYVARLLKGLVSDRHISVAE |
Ga0126371_138595152 | 3300021560 | Tropical Forest Soil | GRLRAKVTVWGNDGTPADVVQNYIARLLKGLVSDRQIVVAD |
Ga0207692_104948322 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | LVSWTGRPGRLSAKVTVWGKDGTPTHVVQGYIARLLKGLVSARQIVIAAD |
Ga0207649_111202001 | 3300025920 | Corn Rhizosphere | KVTVWGRDGTPEDVVEHYVARLLKGLVNDRHIVVAE |
Ga0207664_111871502 | 3300025929 | Agricultural Soil | VTVWGKDGTPEDVVEDYVARLLRGLVSDRRISVAAD |
Ga0207709_118558842 | 3300025935 | Miscanthus Rhizosphere | RLNPKVTVWGRDGTPEDVVEHYVARLLKGLVNDRHIVVAD |
Ga0207704_103183441 | 3300025938 | Miscanthus Rhizosphere | GRLNPKVTVWGKDGTPEDVVEHYVARLLKGLVNDRHIVVAD |
Ga0207702_118614852 | 3300026078 | Corn Rhizosphere | VTVWGRDGTPEDVVEHYVARLLKGLVNDRHIVVAE |
Ga0209801_12439381 | 3300026326 | Soil | RSGRLSLKVTVWGRDGAPEDVVGHYVAQLLKGLVNERRIFVAAD |
Ga0209802_12416362 | 3300026328 | Soil | TVWGRDGTPEDVVGHYVAQLLKGLVNEGRIFVAAD |
Ga0179587_106879061 | 3300026557 | Vadose Zone Soil | RLSPKVTVWGKDGTPEDVVESYITRLLKGLVNGGQIFVEAE |
Ga0208997_10277241 | 3300027181 | Forest Soil | PGRLSAKVTVWGKDGTPTHVVQGYIARLLKGLVSARQIIIAAD |
Ga0208995_10613621 | 3300027388 | Forest Soil | WSGRAGRLSAKVTVWGKDGTPEDVVQSYIARLLKGLVNDRQIFVAAD |
Ga0209219_11775182 | 3300027565 | Forest Soil | TVWGKDGTPTHVVQGYIARLLKGLVSARQIIIAAD |
Ga0208988_11255841 | 3300027633 | Forest Soil | RPGRLSAKVTVWGKDGTPTHVVQGYIARLLKGLVSARQIIIAAD |
Ga0207862_11724172 | 3300027703 | Tropical Forest Soil | WTGRAGRLSAKVTVWGNNGTPEEVVQHYVARLLRGLVKGRHIFVAAD |
Ga0209488_104914193 | 3300027903 | Vadose Zone Soil | SAKVTVWGKDGTPEDVVQSYIARLLKGLVNDRQIFVAAD |
Ga0268265_100264806 | 3300028380 | Switchgrass Rhizosphere | LNPKVTVWGRDGTPEDVVEHYVARLLKGLVNDRHIVVAD |
Ga0307311_101378861 | 3300028716 | Soil | PKVTVWGKDGTPEDVVEHYVARLLKGLVNDRHIVVAN |
Ga0307300_102476402 | 3300028880 | Soil | SWVGRAGRLNPKVTVWGKDGTPEDVVEHYVARLLKGLVSDRHIVVAD |
Ga0308309_101712553 | 3300028906 | Soil | AKVTVWGKDGTPTHVVQGYIARLLKGLVSARQIVIAAD |
Ga0307498_100327723 | 3300031170 | Soil | VSWVGRAGRLNPKVTVWGKDGTPEDVVEHYVARLLKGLVNDRHIVVAD |
Ga0307497_100102544 | 3300031226 | Soil | SGRSGRLSPKVTVWGKDGTPGDVVESYISRLLRGLVKDHQISVAAE |
Ga0307497_102193741 | 3300031226 | Soil | GLLSDYLVSWSGRAGRLSAKVTVWGKDGTPEAVVQSYIARLLKGLVNDRQIFVAAD |
Ga0318516_103692812 | 3300031543 | Soil | LVRLSPKVTVWGKDGTPEDVVGHYVAQLLRGLVNERRIFVAAD |
Ga0318541_102083701 | 3300031545 | Soil | GLFGQLVRLSPKVTVWGKDGTPEDVVGHYVAQLLRGLVNERRIFVAAD |
Ga0318538_100604093 | 3300031546 | Soil | VSWSGRSGRLSPKVTVWGKDGTPEDVVGHYVAQLLRGLVNERRIFVAAD |
Ga0318528_102615701 | 3300031561 | Soil | SPKVTVWGRDGTPEDVVGHYVAQLLKGLVNERRIFVAAD |
Ga0318515_101445911 | 3300031572 | Soil | VIVWGKDGTPEDVVGHYVAQLLRGLVNERRIFVAAD |
Ga0318555_100254844 | 3300031640 | Soil | VTVWGKDGTPEDVVGHYVAQLLRGLVNERRIFVAAD |
Ga0318574_101875971 | 3300031680 | Soil | TVWGKDGTPEDVVGHYVAQLLRGLVNERRIFVAAD |
Ga0318574_102085541 | 3300031680 | Soil | SSKVTVWGKNGTPADVVGHYVAQLLKGLVNERRIFVAAD |
Ga0318493_107478561 | 3300031723 | Soil | LVSWSGRSGRLSPKVTVWGRDGTPEDVVGHYVAQLLKGLVNERRIFVAAD |
Ga0318501_107151612 | 3300031736 | Soil | SWSGRSGRLSPKVTVWGKDGAPADVVGHYVAQLLKGLVNERRIFVAAD |
Ga0318497_101232673 | 3300031805 | Soil | SGRLSPKVTVWGKNGTPADVVGHYVAQLLKGLVNERRIFVAAD |
Ga0310892_104106671 | 3300031858 | Soil | RLNPKVTVWGKDGTPEDVVEHYVARLLKGLVNDRHIVVAD |
Ga0318544_100305773 | 3300031880 | Soil | KVTVWGKDGTPEDVVGHYVAQLLRGLVNERRIFVAAD |
Ga0318536_102433471 | 3300031893 | Soil | SGRSGRLSPKVTVWGRDGTPEDVVGHYVAQLLKGLVNERRIFVAAD |
Ga0318520_107923142 | 3300031897 | Soil | SWSGRSGRLSPKVTVWGRDGTPEDVVGHYVAQLLKGLVNERRIFVAAD |
Ga0306921_106149282 | 3300031912 | Soil | LLSDYLVSWTGRSGRLRAKVTVWGKDGTPGHVVERYIAQLLKGLVPPRRISIVTDDIRRA |
Ga0310910_105951801 | 3300031946 | Soil | RAGRLRANVTVWGRDGTPEEVVRHYIARLLKGLVPDRQISVAID |
Ga0306926_102430683 | 3300031954 | Soil | SDYLVSWTGRAGRLSAKVTVWGNNGTPREVVQHYVARLLRGLVKGRRIFVAAD |
Ga0318518_100657063 | 3300032090 | Soil | SGRLSPKVTVWGKGGTPADVVGHYVAQLLKGLVNERRIFVAAD |
⦗Top⦘ |