| Basic Information | |
|---|---|
| Family ID | F084665 |
| Family Type | Metagenome |
| Number of Sequences | 112 |
| Average Sequence Length | 41 residues |
| Representative Sequence | NARKTWDDEHRRIEYGSAPAMIRLSTVNGPVSVQESREKL |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.68 % |
| % of genes near scaffold ends (potentially truncated) | 96.43 % |
| % of genes from short scaffolds (< 2000 bps) | 86.61 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.21 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.107 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (37.500 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.500 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.214 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 2.94% Coil/Unstructured: 97.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.21 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF01636 | APH | 76.79 |
| PF02410 | RsfS | 0.89 |
| PF05368 | NmrA | 0.89 |
| PF01751 | Toprim | 0.89 |
| PF00361 | Proton_antipo_M | 0.89 |
| PF13520 | AA_permease_2 | 0.89 |
| PF11695 | DUF3291 | 0.89 |
| PF01243 | Putative_PNPOx | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG0799 | Ribosomal silencing factor RsfS, regulates association of 30S and 50S subunits | Translation, ribosomal structure and biogenesis [J] | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.11 % |
| Unclassified | root | N/A | 0.89 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001167|JGI12673J13574_1010524 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300001661|JGI12053J15887_10378122 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300002917|JGI25616J43925_10233764 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10275886 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300004633|Ga0066395_10500329 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300005554|Ga0066661_10503862 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300005560|Ga0066670_10669409 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300005561|Ga0066699_10375918 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300005586|Ga0066691_10000766 | All Organisms → cellular organisms → Bacteria | 11468 | Open in IMG/M |
| 3300005591|Ga0070761_10087859 | All Organisms → cellular organisms → Bacteria | 1779 | Open in IMG/M |
| 3300005602|Ga0070762_10272905 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
| 3300005764|Ga0066903_101015498 | All Organisms → cellular organisms → Bacteria | 1518 | Open in IMG/M |
| 3300005921|Ga0070766_10883260 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300006028|Ga0070717_10791164 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300006032|Ga0066696_10398860 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300006172|Ga0075018_10777657 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300006176|Ga0070765_100196042 | All Organisms → cellular organisms → Bacteria | 1831 | Open in IMG/M |
| 3300006903|Ga0075426_10387198 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300006914|Ga0075436_100114029 | All Organisms → cellular organisms → Bacteria | 1887 | Open in IMG/M |
| 3300007265|Ga0099794_10123539 | All Organisms → cellular organisms → Bacteria | 1304 | Open in IMG/M |
| 3300009012|Ga0066710_100086336 | All Organisms → cellular organisms → Bacteria | 4123 | Open in IMG/M |
| 3300009038|Ga0099829_10366616 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
| 3300009038|Ga0099829_10797548 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300009038|Ga0099829_10898328 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300009088|Ga0099830_10595126 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300009089|Ga0099828_10166764 | All Organisms → cellular organisms → Bacteria | 1954 | Open in IMG/M |
| 3300009137|Ga0066709_103682358 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300010159|Ga0099796_10241109 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300010303|Ga0134082_10000228 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 18575 | Open in IMG/M |
| 3300010320|Ga0134109_10095674 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300010343|Ga0074044_10201412 | All Organisms → cellular organisms → Bacteria | 1322 | Open in IMG/M |
| 3300010359|Ga0126376_11650283 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300010361|Ga0126378_10688232 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
| 3300010379|Ga0136449_100048869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 9558 | Open in IMG/M |
| 3300011269|Ga0137392_10689293 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300011270|Ga0137391_10738838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 815 | Open in IMG/M |
| 3300011271|Ga0137393_11138834 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300011271|Ga0137393_11287562 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300012096|Ga0137389_10877564 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 770 | Open in IMG/M |
| 3300012189|Ga0137388_10977852 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300012202|Ga0137363_11287709 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300012203|Ga0137399_11725514 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300012206|Ga0137380_10397930 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
| 3300012207|Ga0137381_10134317 | All Organisms → cellular organisms → Bacteria | 2120 | Open in IMG/M |
| 3300012209|Ga0137379_10406115 | All Organisms → cellular organisms → Bacteria | 1271 | Open in IMG/M |
| 3300012349|Ga0137387_11279326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300012359|Ga0137385_11195616 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300012361|Ga0137360_10058671 | All Organisms → cellular organisms → Bacteria | 2805 | Open in IMG/M |
| 3300012362|Ga0137361_10231438 | All Organisms → cellular organisms → Bacteria | 1679 | Open in IMG/M |
| 3300012362|Ga0137361_11012182 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300012917|Ga0137395_10079218 | All Organisms → cellular organisms → Bacteria | 2140 | Open in IMG/M |
| 3300012922|Ga0137394_11174886 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300012925|Ga0137419_11368168 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300012925|Ga0137419_11523480 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300012927|Ga0137416_10336471 | All Organisms → cellular organisms → Bacteria | 1262 | Open in IMG/M |
| 3300012929|Ga0137404_11112643 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300012930|Ga0137407_11298874 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300012930|Ga0137407_12257019 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300012977|Ga0134087_10433636 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300015051|Ga0137414_1181537 | Not Available | 6501 | Open in IMG/M |
| 3300015242|Ga0137412_10504761 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300015242|Ga0137412_10778094 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300016404|Ga0182037_10432594 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300017966|Ga0187776_10545485 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300018064|Ga0187773_10315242 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300018086|Ga0187769_10393556 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1042 | Open in IMG/M |
| 3300018482|Ga0066669_10035725 | All Organisms → cellular organisms → Bacteria | 2992 | Open in IMG/M |
| 3300019890|Ga0193728_1345525 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300020170|Ga0179594_10314904 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300020199|Ga0179592_10060570 | All Organisms → cellular organisms → Bacteria | 1728 | Open in IMG/M |
| 3300020579|Ga0210407_10237277 | All Organisms → cellular organisms → Bacteria | 1420 | Open in IMG/M |
| 3300020579|Ga0210407_10741238 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 760 | Open in IMG/M |
| 3300020579|Ga0210407_10891083 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300020579|Ga0210407_10907181 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300020579|Ga0210407_11038321 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300020580|Ga0210403_11513171 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300020583|Ga0210401_11543919 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300021170|Ga0210400_10172286 | All Organisms → cellular organisms → Bacteria | 1751 | Open in IMG/M |
| 3300021405|Ga0210387_10173517 | All Organisms → cellular organisms → Bacteria | 1858 | Open in IMG/M |
| 3300021405|Ga0210387_11739480 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300021406|Ga0210386_11103771 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300021474|Ga0210390_11603034 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300021476|Ga0187846_10183656 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300021479|Ga0210410_11332170 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300021559|Ga0210409_10721246 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300025915|Ga0207693_10290018 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
| 3300026310|Ga0209239_1237024 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300026310|Ga0209239_1267681 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300026313|Ga0209761_1023122 | All Organisms → cellular organisms → Bacteria | 3846 | Open in IMG/M |
| 3300026314|Ga0209268_1123175 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300026323|Ga0209472_1023638 | All Organisms → cellular organisms → Bacteria | 2896 | Open in IMG/M |
| 3300026333|Ga0209158_1078399 | All Organisms → cellular organisms → Bacteria | 1291 | Open in IMG/M |
| 3300026334|Ga0209377_1114011 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300026538|Ga0209056_10408239 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium RIFCSPLOWO2_12_FULL_68_9 | 826 | Open in IMG/M |
| 3300026542|Ga0209805_1160506 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300026542|Ga0209805_1390846 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300026557|Ga0179587_10070729 | All Organisms → cellular organisms → Bacteria | 2053 | Open in IMG/M |
| 3300027655|Ga0209388_1016556 | All Organisms → cellular organisms → Bacteria | 2036 | Open in IMG/M |
| 3300027671|Ga0209588_1123424 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300027862|Ga0209701_10147974 | All Organisms → cellular organisms → Bacteria | 1435 | Open in IMG/M |
| 3300027862|Ga0209701_10281107 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
| 3300028536|Ga0137415_11282079 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300028906|Ga0308309_10044853 | All Organisms → cellular organisms → Bacteria | 3145 | Open in IMG/M |
| 3300031128|Ga0170823_11281647 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300031715|Ga0307476_10465184 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 936 | Open in IMG/M |
| 3300031720|Ga0307469_12079153 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300031754|Ga0307475_10489407 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300031962|Ga0307479_10044364 | All Organisms → cellular organisms → Bacteria | 4269 | Open in IMG/M |
| 3300031962|Ga0307479_11864790 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300032828|Ga0335080_10904953 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300032898|Ga0335072_11755075 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300033134|Ga0335073_10357894 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1725 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 37.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.71% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.25% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.46% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.46% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.68% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.68% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.68% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.68% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.79% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.79% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.79% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.79% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.89% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.89% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001167 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12673J13574_10105242 | 3300001167 | Forest Soil | CKASICDNARKTWDDNHRRIEYGNAPAMIRLSTVNGPVSVRESREKL* |
| JGI12053J15887_103781222 | 3300001661 | Forest Soil | TWDDNNRRIEYGTAPAMIRLSTVNGPVSVRDEREKL* |
| JGI25616J43925_102337641 | 3300002917 | Grasslands Soil | SCEASICDNARKTWDDEHRRIEYGSAPAMIRLSTVNGPVSVQESREKL* |
| JGIcombinedJ51221_102758862 | 3300003505 | Forest Soil | ENARKTWDDNNRRIEYGSMPAMIRLSTVNGPVSVRDSKETL* |
| Ga0066395_105003292 | 3300004633 | Tropical Forest Soil | HASICGSARKTWDDEHRRIEFGSSPAVVHLSTVNGPVSVEDGRD* |
| Ga0066661_105038621 | 3300005554 | Soil | CDNARKTWDDEHRRIEYGSGPATIRLSTVNGPVSVQESREKL* |
| Ga0066670_106694091 | 3300005560 | Soil | ICDNAHKTWDDEHRRIEYGNGPATIRLSTVNGPVSVQESREKL* |
| Ga0066699_103759181 | 3300005561 | Soil | KASICENARKTWDDEHRRIEYGNAPALIRLSTVNGPVTVRDSRENL* |
| Ga0066691_100007661 | 3300005586 | Soil | CDNARKTWDDNNRRIEYGVGPAMIRLSTVNGPVSVRDQREKL* |
| Ga0070761_100878591 | 3300005591 | Soil | KTWDDSNRRIEFGGSPAMIRLSTVNGPVSVQTAQEEM* |
| Ga0070762_102729051 | 3300005602 | Soil | KTWDDNNRRIEYGGSPAMIRLSTVNGPVSIQSSREEM* |
| Ga0066903_1010154982 | 3300005764 | Tropical Forest Soil | KTWDDEHRRIEFGSSPAVVHLSTVNGPVSVEDGRD* |
| Ga0070766_108832602 | 3300005921 | Soil | MSCHASICDNARKTWDDNNRRIEYGSSPAMIRLSTVNGPVSVQSSRDEM* |
| Ga0070717_107911642 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | DARKTWDDDHRRIEYGTGSPVIRLSTENGPISVAD* |
| Ga0066696_103988602 | 3300006032 | Soil | TWDDEHRRIEYGSSPAVVHLSTVNGPVSVEEGRD* |
| Ga0075018_107776571 | 3300006172 | Watersheds | CDNARKTWDDNNRRIEYGSTPAMIRLSTVNGPVSVRNEREKL* |
| Ga0070765_1001960421 | 3300006176 | Soil | ARKTWDDNNRRIEYGGSPAMIRLSTVNGPVSIQSSREEM* |
| Ga0075426_103871982 | 3300006903 | Populus Rhizosphere | SICGSARKTWDDEHRRIEFGSSPAVVHLSTVNGPVSVEDGRD* |
| Ga0075436_1001140291 | 3300006914 | Populus Rhizosphere | ASICDNARKTWDDEHRRIEYGSGPATIRLSTVNGPVSVQESREKL* |
| Ga0099794_101235392 | 3300007265 | Vadose Zone Soil | CVDARKTWDDDHRRIEYGSGSPVIRLSTENGPISVAD* |
| Ga0066710_1000863361 | 3300009012 | Grasslands Soil | RKTWDDDHHRIEYGSGPAMIRLSTVNGPVSVRESREKL |
| Ga0099829_103666161 | 3300009038 | Vadose Zone Soil | ICSDARKTWDDEHRRIEYGSGSPVIRLSTENGPISVAD* |
| Ga0099829_107975482 | 3300009038 | Vadose Zone Soil | TWDDNNRRIEYGAGPAMIRLSTVNGPVSVRDQREKL* |
| Ga0099829_108983281 | 3300009038 | Vadose Zone Soil | EHRRIEYGSMPAMIRLSTVNGPISVRESSRDKETL* |
| Ga0099830_105951261 | 3300009088 | Vadose Zone Soil | SCKASICDNARKTWDDEHRRIEYGSAPAMIRLSTVNGPVSVQESREKL* |
| Ga0099828_101667642 | 3300009089 | Vadose Zone Soil | CDNARKTWDDEHRRIEYGSAPAMIRLSTVNGPVSVQESREKL* |
| Ga0066709_1036823581 | 3300009137 | Grasslands Soil | RKTWDDEHRRIEYGSSPAVVHLSTVNGPVSVEDGRD* |
| Ga0099796_102411092 | 3300010159 | Vadose Zone Soil | SICSDARKTWDDEHRRIEYGSGSPVIRLSTENGPISVAD* |
| Ga0134082_1000022821 | 3300010303 | Grasslands Soil | WDDDHRRIEYGNGPATIRLSTVNGPVSVQESREKL* |
| Ga0134109_100956742 | 3300010320 | Grasslands Soil | DNARKTWDDEHRRIEYGNAPAMIRLSTVNGPVTVRDSRENL* |
| Ga0074044_102014121 | 3300010343 | Bog Forest Soil | KTWDDNNRRIEFGSSPAMIKLSTVNGPVSVQSSRED* |
| Ga0126376_116502832 | 3300010359 | Tropical Forest Soil | ASICSEARKTWDDQHRRIEYGSGSPVIRLSTENGPISVAD* |
| Ga0126378_106882321 | 3300010361 | Tropical Forest Soil | SARKTWDDEHRRIEYGSSPAVVHLSTVNGPVSVEEARD* |
| Ga0136449_1000488696 | 3300010379 | Peatlands Soil | AAICDNARKTWDDQHRRIEYGAAPAVIHLSTVNGPVSVKQLRETL* |
| Ga0137392_106892932 | 3300011269 | Vadose Zone Soil | CDSARKTWDNEHRRIEYGSAPAMIRLSTVNGPVSVRESREKL* |
| Ga0137391_107388381 | 3300011270 | Vadose Zone Soil | TWDDEHRRIEYGNAPAMIRLSTVNGPVSVQEAREKL* |
| Ga0137393_111388341 | 3300011271 | Vadose Zone Soil | ARKTWDDNNRRIEYGSTPAMIRLSTVNGPVSVRDEREKL* |
| Ga0137393_112875621 | 3300011271 | Vadose Zone Soil | EASICENARKTWDDEHRRIEYGSAPAMIRLSTVNGPVSVQESREKL* |
| Ga0137389_108775642 | 3300012096 | Vadose Zone Soil | CDNARKTWDDEHRRIEYGNAPAMIRLSTVNGPVSVEESRGKL* |
| Ga0137388_109778521 | 3300012189 | Vadose Zone Soil | KTWDDEHRRIEYGNAPALIRLSTVNGPVSVEESRGKL* |
| Ga0137363_112877091 | 3300012202 | Vadose Zone Soil | DARKTWDDDHRRIEYGSGSPVIRLSTENGPISVAD* |
| Ga0137399_117255141 | 3300012203 | Vadose Zone Soil | RKTWDDEHRRIEYGSGPATIRLSTVNGPVSVKESREKL* |
| Ga0137380_103979302 | 3300012206 | Vadose Zone Soil | WDDEHRRIEYGSMPAMIRLSTVNGPISVREPSRDKETL* |
| Ga0137381_101343171 | 3300012207 | Vadose Zone Soil | APLSCKASICDNARKTWDDEHRRIEYGNAPATIRLSTVNGLVSVQESREKL* |
| Ga0137379_104061151 | 3300012209 | Vadose Zone Soil | SICDGARKTWDDEHRRIEYGSSPAVVHLSTVNGPVSVEEGRD* |
| Ga0137387_112793262 | 3300012349 | Vadose Zone Soil | MSCQASICDNARKTWDDEHRRIEYGSMPAMIRLSTVNGPISVRESSRDKETL* |
| Ga0137385_111956162 | 3300012359 | Vadose Zone Soil | HASICGSARKTWDDEHRRIEYGSSPAVVHLSTVNGPVSVEEARN* |
| Ga0137360_100586712 | 3300012361 | Vadose Zone Soil | CQASICDNARKTWDDNNRRIEYGAGPAMIRLSTVNGPVSVRDQREKL* |
| Ga0137361_102314382 | 3300012362 | Vadose Zone Soil | ASICDNARKTWDDNHRRIEYGNAPAMIRLSTVNGPVSVRESREKL* |
| Ga0137361_110121821 | 3300012362 | Vadose Zone Soil | SCHASICGDARKTWDDEHRRIEYGSGSPLIRLSTENGPVSVNTL* |
| Ga0137395_100792181 | 3300012917 | Vadose Zone Soil | ARKTWDDERRRIEYGKAPAMIRLSTVNGPVSVQESREKL* |
| Ga0137394_111748861 | 3300012922 | Vadose Zone Soil | ASICNNARKTWDDNNRRIEYGTTPAMIRLSTVNGPVSVRDEREKL* |
| Ga0137419_113681681 | 3300012925 | Vadose Zone Soil | DNARKTWDDEHRRIEYGNAPAMIRLSTVNGPVSVRESREKL* |
| Ga0137419_115234801 | 3300012925 | Vadose Zone Soil | HASICADARKTWDDDHRRIEYGSGSPVIRLSTENGPISVAD* |
| Ga0137416_103364711 | 3300012927 | Vadose Zone Soil | DARKTWDDEHRRIEYGSGSPVIRLSTENGPISVAD* |
| Ga0137404_111126432 | 3300012929 | Vadose Zone Soil | ASICSDARKTWDDEHRRIEYGSGSPVIRLSTENGPISVAD* |
| Ga0137407_112988742 | 3300012930 | Vadose Zone Soil | DNARKTWDDNNRRIEYGAAPAMIRLSTVNGPVSVRDSREKL* |
| Ga0137407_122570192 | 3300012930 | Vadose Zone Soil | CSDARKTWDDEHRRIEYGSGSPVIRLSTENGPISVAD* |
| Ga0134087_104336362 | 3300012977 | Grasslands Soil | WDDEHRRIEYGNAPAMIRLSTVNGPVTVRDSRENL* |
| Ga0137414_11815372 | 3300015051 | Vadose Zone Soil | LQASIADNARKTWDDGIGASIWDAPAMIRLSTVEWPVSVQESREKL* |
| Ga0137412_105047611 | 3300015242 | Vadose Zone Soil | PMSCHASICGDARKTWDDDHRRIEYGNGTPLIRLSTENGPISVNTL* |
| Ga0137412_107780941 | 3300015242 | Vadose Zone Soil | MSCHASICGDARKTWDDEHRRIEYGSGSPLIRLSTENGPVSVNTL* |
| Ga0182037_104325942 | 3300016404 | Soil | RKTWDDEHRRIEYGSSPVVHLSTVNGPVSVEEARD |
| Ga0187776_105454851 | 3300017966 | Tropical Peatland | SVCDNARKTWDEDHRRIEYGAMPAVLHLSTVNGPISVRDSRDRGGDK |
| Ga0187773_103152421 | 3300018064 | Tropical Peatland | TWDEDHRRIEYGATPAVLHLSTVNGPISVRDSRDRGGDK |
| Ga0187769_103935561 | 3300018086 | Tropical Peatland | SAQKTWDDEHRRIEYGPAPAVIHLSTVNGPVSVEQLRETL |
| Ga0066669_100357252 | 3300018482 | Grasslands Soil | DNARKTWDDEHRRIEYGSGPAMIRLSTVNGPVSVQESREKL |
| Ga0193728_13455251 | 3300019890 | Soil | ASVCDNARKTWDDDHRRIEFGQAPAVIHLSTVNGPIEVKQSTDRL |
| Ga0179594_103149042 | 3300020170 | Vadose Zone Soil | ASICGDARKTWDDEHRRIEYGSGSPLIRLSTENGPVSVNTL |
| Ga0179592_100605702 | 3300020199 | Vadose Zone Soil | RKTWDDEHRRIEYGNAPAMIRLSTVNGPVSVEESREKL |
| Ga0210407_102372772 | 3300020579 | Soil | SICDNARKTWDDDHRRIEYGSGPATIRLSTVNGPVSVQESREKL |
| Ga0210407_107412381 | 3300020579 | Soil | HASICADARKTWDDDHRRIEYGSGSPVIRLSTENGPISVAD |
| Ga0210407_108910832 | 3300020579 | Soil | CAASICGEARKTWDDDHKRIEFGSGAPVIHLSSYNGPVSVR |
| Ga0210407_109071812 | 3300020579 | Soil | CDSARKTWDDENRRIEYGNMPATIRLSTVNGPVSVRESRETL |
| Ga0210407_110383211 | 3300020579 | Soil | SICSDARKTWDDDHRRIEYGSGSPVIRLSTENGPISVAD |
| Ga0210403_115131712 | 3300020580 | Soil | TWDDEHRRIEYGNAPAIIRLSTVNGPVSVRESREKL |
| Ga0210401_115439191 | 3300020583 | Soil | ARKTWDDNNRRIEYGSSPAMIKLSTVNGPVSIQSSRGEM |
| Ga0210400_101722861 | 3300021170 | Soil | CNDARKTWDEDRRRIEFGNAPAVIHLSTVNGPIAVKQI |
| Ga0210387_101735171 | 3300021405 | Soil | NARKTWDDHNRRIEFGGSPAMIRLSTVNGPVSVQSSRDEM |
| Ga0210387_117394802 | 3300021405 | Soil | AQKTWDDNNRRIELGGSPAMIRLSTVNGPVSVQSAHEEM |
| Ga0210386_111037712 | 3300021406 | Soil | SDARKTWDDEHRRIEYGSGSPVIRLSTENGPISVAD |
| Ga0210390_116030341 | 3300021474 | Soil | ICDNARKTWDDNNRRIEYGSSPAMIKLSTVNGPVSIQSSRGEM |
| Ga0187846_101836561 | 3300021476 | Biofilm | ESARKTWDDEHRRIEYGSSPAVLHLSTVNGPISVQDSRQER |
| Ga0210410_113321701 | 3300021479 | Soil | MNCKASICDNARKTWDDNHRRIEFGSSPAMIRLSTVNGPVSIQSSREEM |
| Ga0210409_107212462 | 3300021559 | Soil | CDNARKTWDDEHRRIEYGSAPAMIHLSTVNGPVSVQESRERL |
| Ga0207693_102900182 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MSCHASICDEARKTWDDDHRRIEYGSGTPVIHLSTENGPVTVSSL |
| Ga0209239_12370242 | 3300026310 | Grasslands Soil | RKTWDDNRRRIEYGNPPAMIRLSTVNGPVSVRESREKLS |
| Ga0209239_12676812 | 3300026310 | Grasslands Soil | TWDDDHHRIEYGSGPAMIRLSTVNGPVSVRESREKL |
| Ga0209761_10231221 | 3300026313 | Grasslands Soil | ASICDNARRTWDDEHRRIEYGSAPATIRLSTVNGPVSVQESREKL |
| Ga0209268_11231751 | 3300026314 | Soil | ARKTWDDNHRRIEYGNPPAMIRLSTVNGPVSVRESREKLS |
| Ga0209472_10236382 | 3300026323 | Soil | NARKTWDDNRRRIEYGNPPAMIRLSTVNGPVSVRESREKL |
| Ga0209158_10783991 | 3300026333 | Soil | CKASICDNARKTWDDEHRRIEYGSGPATIRLSTVNGPVSVQESREKL |
| Ga0209377_11140112 | 3300026334 | Soil | RRTWDDEHRRIEYGSAPATIRLSTVNGPVSVQESREKL |
| Ga0209056_104082392 | 3300026538 | Soil | QARRTWDDEDNRRIELGSGSMVVHLSTVNGPVSVRENED |
| Ga0209805_11605061 | 3300026542 | Soil | ASICENARKTWDDEHRRIEYGNAPALIRLSTVNGPVTVRDSRENL |
| Ga0209805_13908462 | 3300026542 | Soil | ASICDNARKTWDDEHRRIEYGTGPATIRLSTVNGPVSVQESREKL |
| Ga0179587_100707292 | 3300026557 | Vadose Zone Soil | DNARKTWDDEHRRIEYGNAPAMIRLSTVNGPVSVEESREKL |
| Ga0209388_10165561 | 3300027655 | Vadose Zone Soil | DNARKTWDDNNRRIEYGAGPAMIRLSTVNGPVSVRDQREKL |
| Ga0209588_11234241 | 3300027671 | Vadose Zone Soil | RKTWDDEHRRIEYGNAPAMIRLSTVNGPVSVRESKEKL |
| Ga0209701_101479741 | 3300027862 | Vadose Zone Soil | NARKTWDDEHRRIEYGSAPAMIRLSTVNGPVSVQESREKL |
| Ga0209701_102811072 | 3300027862 | Vadose Zone Soil | ASICDNARKTWDHEHRRIEYGNAPAMIRLSTVNGPVSVQESREKL |
| Ga0137415_112820792 | 3300028536 | Vadose Zone Soil | WDDDHRRIEYGNAPAMIRLSTVNGPVTVRDSRENL |
| Ga0308309_100448531 | 3300028906 | Soil | DNARKTWDDNNRRIEYGGSPAMIRLSTVNGPVSIQSSREEM |
| Ga0170823_112816471 | 3300031128 | Forest Soil | ATVCDEARKTWDDEHRRIEYGSGTPVIRLSTENGPVSVNAP |
| Ga0307476_104651841 | 3300031715 | Hardwood Forest Soil | SCHASICSDARKTWDDEHRRIEYGSGSPVIRLSTENGPISVAD |
| Ga0307469_120791532 | 3300031720 | Hardwood Forest Soil | RKTWDDNNRRIEYGSTPAMIRLSTVNGPVSVRDEREKL |
| Ga0307475_104894071 | 3300031754 | Hardwood Forest Soil | CDNARKTWDDEHRRIEYGNAPAMIRLSTVNGPVSVEESREKL |
| Ga0307479_100443641 | 3300031962 | Hardwood Forest Soil | RRTLDDEHQRIEYGAAPAVIHLSTVNGPVSVKQLRETL |
| Ga0307479_118647901 | 3300031962 | Hardwood Forest Soil | SDARKTWDDDHKRIEYGSGSPVIRLSTENGPVSVAD |
| Ga0335080_109049531 | 3300032828 | Soil | ARKTWDDNNRRIEFGNSPAVIHLSTVNGPVSVRSPKDEE |
| Ga0335072_117550752 | 3300032898 | Soil | KTWDDNNRRIEFGASPALIRLSTVNGPVSVRSAREDM |
| Ga0335073_103578942 | 3300033134 | Soil | MSCRASICENARKTWDDNNRRIEFGASPALIRLSTVNGPVSVRSAREDM |
| ⦗Top⦘ |