 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F084601 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 112 |
| Average Sequence Length | 41 residues |
| Representative Sequence | GGLEYRFTPHIGIFGEIGYVFPNLSNNNFIQTNFGLRYAF |
| Number of Associated Samples | 79 |
| Number of Associated Scaffolds | 111 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 0.89 % |
| % of genes from short scaffolds (< 2000 bps) | 1.79 % |
| Associated GOLD sequencing projects | 69 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.27 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (99.107 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (33.036 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.286 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (67.857 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 32.35% Coil/Unstructured: 67.65% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 111 Family Scaffolds |
|---|---|---|
| PF00196 | GerE | 7.21 |
| PF01526 | DDE_Tnp_Tn3 | 3.60 |
| PF00924 | MS_channel | 2.70 |
| PF13720 | Acetyltransf_11 | 1.80 |
| PF01384 | PHO4 | 1.80 |
| PF14373 | Imm_superinfect | 1.80 |
| PF00239 | Resolvase | 1.80 |
| PF08447 | PAS_3 | 1.80 |
| PF05175 | MTS | 0.90 |
| PF07885 | Ion_trans_2 | 0.90 |
| PF14534 | DUF4440 | 0.90 |
| PF13469 | Sulfotransfer_3 | 0.90 |
| PF13370 | Fer4_13 | 0.90 |
| PF07690 | MFS_1 | 0.90 |
| PF01544 | CorA | 0.90 |
| PF00884 | Sulfatase | 0.90 |
| PF02899 | Phage_int_SAM_1 | 0.90 |
| PF04545 | Sigma70_r4 | 0.90 |
| PF00589 | Phage_integrase | 0.90 |
| PF02371 | Transposase_20 | 0.90 |
| PF04226 | Transgly_assoc | 0.90 |
| PF02201 | SWIB | 0.90 |
| PF00275 | EPSP_synthase | 0.90 |
| PF08281 | Sigma70_r4_2 | 0.90 |
| PF13474 | SnoaL_3 | 0.90 |
| PF03797 | Autotransporter | 0.90 |
| PF13410 | GST_C_2 | 0.90 |
| PF13847 | Methyltransf_31 | 0.90 |
| PF00873 | ACR_tran | 0.90 |
| COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
|---|---|---|---|
| COG4644 | Transposase and inactivated derivatives, TnpA family | Mobilome: prophages, transposons [X] | 3.60 |
| COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 2.70 |
| COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 2.70 |
| COG0306 | Phosphate/sulfate permease | Inorganic ion transport and metabolism [P] | 1.80 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 1.80 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 1.80 |
| COG0598 | Mg2+ and Co2+ transporter CorA | Inorganic ion transport and metabolism [P] | 0.90 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.90 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.90 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.90 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.90 |
| COG5531 | DNA-binding SWIB/MDM2 domain | Chromatin structure and dynamics [B] | 0.90 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 99.11 % |
| All Organisms | root | All Organisms | 0.89 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300020580|Ga0210403_10310417 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1292 | Open in IMG/M |
| 3300022557|Ga0212123_10545347 | Not Available | 743 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 33.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 27.68% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.14% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.36% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 5.36% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.36% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.68% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.68% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.79% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.89% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.89% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.89% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022512 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300026889 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 57 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E4A_11473170 | 2170459003 | Grass Soil | VGIGLEYRFTPHIGIFGEGAYVFPNLSNNNFVQTNFGLRFAF |
| JGIcombinedJ51221_102333291 | 3300003505 | Forest Soil | VLGHVGGGLEYRFTPNIAIFGELGYDFPNLANNNFIQTNFGLRYAF* |
| Ga0062385_108738081 | 3300004080 | Bog Forest Soil | GLEYRFTPHIGLFGEAGYDLVNGARNNFIQTNFGLRYAF* |
| Ga0070711_1017689721 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | GGLEYRFTPHIGIFGEVGYDMVNGASNNFLQTNFGLRYAF* |
| Ga0070706_1002276503 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VGGGLEYRFTPHIGIFGEIGYDFPNGSSNNFIQTNFGLRYAF* |
| Ga0070707_1020711661 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | HVGGGLEYRFTPHIGIFGEIGYDFPNLSRNNFIQTNFGLRYAF* |
| Ga0070698_1000904931 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | DRVLGHVGGGLEYRFTPHIGIFGEIGYDFPNLSRNNFIQTNFGLRYAF* |
| Ga0070699_1000782187 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | GFEYRFTPHIGVFAEAGYDFVDHTNGRTGSNNFIQTNFGVRYAF* |
| Ga0070766_102764402 | 3300005921 | Soil | EYRFTPHIGIFGEAGYDLVDGASNNFIQTNFGLRFAF* |
| Ga0070716_1013815641 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | YRFTPHIGIFAEAGYNFIDHTRGKTDNNFIQTNFGLRFAF* |
| Ga0075014_1009328432 | 3300006174 | Watersheds | GLKYCFTPHIGIFGEVGYVFPNLANNNFVQINFALRYAF* |
| Ga0070765_1004278693 | 3300006176 | Soil | GLEYRFTPHIGIFGEVGYDFPNLSNNNFIQTNFGLRFAF* |
| Ga0070765_1018110221 | 3300006176 | Soil | YRFTPHIGLFGEVGFDFPNGASNNFLQTNFGLRYAF* |
| Ga0099827_103454773 | 3300009090 | Vadose Zone Soil | GGGLEYRFTPHIGLFGEVGYDFPNGASNNFVAVNFGLRYAF* |
| Ga0126382_104856983 | 3300010047 | Tropical Forest Soil | GGLEYRFTPNIGIFTEASYVIPNGASNNFVDWNFIGLRYAF* |
| Ga0126382_112717632 | 3300010047 | Tropical Forest Soil | EYRFTPCLGIFTEAAYVIPNGSSNNFVQWNFIGLRYAF* |
| Ga0126372_104626271 | 3300010360 | Tropical Forest Soil | LEYRFTPNIGIFTEASYVIPNGASNNFVDWNFIGLRYAF* |
| Ga0126379_128887491 | 3300010366 | Tropical Forest Soil | HRFTPHIGLFTEAAYVIPNGASNNFVQFNFIGLRYAF* |
| Ga0126381_1008500031 | 3300010376 | Tropical Forest Soil | EYRFTPHIGIFGETDYSIVNQSRNNFMQVNFGLRYAF* |
| Ga0126381_1035346433 | 3300010376 | Tropical Forest Soil | RFTPNIGIFTEASYVIPNGASNNFVDWNFIGLRYAF* |
| Ga0136449_1003175531 | 3300010379 | Peatlands Soil | GLEYRFTPNIAIFGELGYDFPNLANNNFIQTNFGLRYAF* |
| Ga0150983_166544011 | 3300011120 | Forest Soil | GGGLEYRFTPNIGIFGELGYDFPNLANNNFIQTNFGLRYAF* |
| Ga0150983_166544014 | 3300011120 | Forest Soil | GGLEYRFTPNIGIFGELGYDFPNLANNNFIQTNFGLRYAF* |
| Ga0137363_114309721 | 3300012202 | Vadose Zone Soil | RVLGHIGLGLEYRFTPHIGLMSEVGYVFPNGASNNLLQVNFGLRYAF* |
| Ga0137362_103518412 | 3300012205 | Vadose Zone Soil | YRFTPHIGIFGEIGYDFPNGSSNNFIQTNFGLRYAF* |
| Ga0137361_102355274 | 3300012362 | Vadose Zone Soil | GGGLEYRFTPHIGIFGEIGYDFPNGSSNNFIQTNFGLRYAF* |
| Ga0137361_102667941 | 3300012362 | Vadose Zone Soil | YRFTPHIGIFGEIGYDFPNGSSNNFVQVNFGLRYAF* |
| Ga0137419_100731731 | 3300012925 | Vadose Zone Soil | RFTPHIGVFAEAGYDFVDHTNGRTGSNNFIQTNFGVRYAF* |
| Ga0137407_110836241 | 3300012930 | Vadose Zone Soil | EYRFTPHIGLFGEATYNFIDHIHGKADNNFIQTNFGLRYAF* |
| Ga0164309_115054043 | 3300012984 | Soil | GGLEYRFTPHIGLFGEAGYDLVNGASNNFIQANFGLRYAF* |
| Ga0164307_106016982 | 3300012987 | Soil | LGHFGGGLEYRFTPHIGIFGEVGYVFPNLSNNNFIQTNFGLRYAF* |
| Ga0157378_119867361 | 3300013297 | Miscanthus Rhizosphere | RFTPHIGIFGEVGYVVPNLSNNNFIQTNFGLRYAF* |
| Ga0182036_105124561 | 3300016270 | Soil | RVLGRIGGGLEYRFTPNIGIFTEAAYVIPDGSGNNFVQFNFIGLRYAF |
| Ga0182041_100573135 | 3300016294 | Soil | GRIGGGLEYRFTPNIGIFTEAAYVIPNGASNNFVQFNFIGLRYAF |
| Ga0182041_117538731 | 3300016294 | Soil | GRIGGGLEYRFTPNWAIFTEASYNILNLSNNNFVQWNFVGVRYAF |
| Ga0182033_100557065 | 3300016319 | Soil | GGLEYRFTPNIGIFTEAAYVIPNGASNNFVQFNFIGLRYAF |
| Ga0182032_100874242 | 3300016357 | Soil | VLGRIGGGLEWRFTPHIGIFTEASYNFPNLSNNNFVQWNFIGLRYAF |
| Ga0182032_102790741 | 3300016357 | Soil | DRVLRQVGGGLEYRFTPNIGIFSEVSYNIVNGADNNFVQFNFIGVRYAF |
| Ga0182032_107483681 | 3300016357 | Soil | GGLEYRFTPNIGIFTEAAYVIPDGSGNNFVQFNFIGLRYAF |
| Ga0182034_105803332 | 3300016371 | Soil | RFTPNIGIFTEAAYVIPNGASNNFVQFSFIGLRYAF |
| Ga0182034_108619531 | 3300016371 | Soil | RFTPNIGIFTEAAYVIPDGSGNNFVQFNFIGLRYAF |
| Ga0182034_115467701 | 3300016371 | Soil | GLEYRFTPNIGIFTEAAYVIPDGSGNNFVQFNFIGLRYAF |
| Ga0182040_108270722 | 3300016387 | Soil | VLGRIGGGLEYRFTPNIGIFTEAAYVIPDGSGNNFVQFNFIGLRYAF |
| Ga0182037_106669321 | 3300016404 | Soil | GTDRVLRQVGGGLEYRFTPNIGIFSEVSYNIVNGADNNFVQFNFIGVRYAF |
| Ga0182038_100197154 | 3300016445 | Soil | RVLGRIGGGLEYRFTPNWAIFTEASYNILNLSNNNFVQWNFVGVRYAF |
| Ga0182038_104170843 | 3300016445 | Soil | GLEYRFTPHIGIFTEAAYVIPNGASNNFVQFNFIGLRYAF |
| Ga0182038_104888122 | 3300016445 | Soil | SLRYKFGTDRVLGHFGGGLEYRFMPHIGLFSEAGFDVVEGSSNNFIQVNFGLRYAF |
| Ga0182038_109149951 | 3300016445 | Soil | RVLGRIGGGLEYRFTPNWAIFTEASYNILNLSNNNFVQWNFFGVRYAF |
| Ga0179592_103792921 | 3300020199 | Vadose Zone Soil | VGGGFEYRFTPHIGVFAEAGYDFVDHTNGRTGSNNFIQTNFGVRYAF |
| Ga0210403_102238562 | 3300020580 | Soil | RFTPHIGIFGEAGYDLVDGASNNFIQTNFGLRYAF |
| Ga0210403_103104171 | 3300020580 | Soil | VLGHVGGGLEYRFTPNIAIFGELGYDFPNLANNNFIQTNFGLRYAF |
| Ga0210403_104507162 | 3300020580 | Soil | YRFTPHIGIFGEIGYDFPNLSNNNFIQTNFGLRFAF |
| Ga0210399_106177772 | 3300020581 | Soil | GLEYRFTPHIGIFGEAGYDLVDGASNNFIQTNFGLRFAF |
| Ga0210401_114752891 | 3300020583 | Soil | VLEDRFTPHIGIFGEIGYDFPNLSNNNFIQTNFGLRFAF |
| Ga0210408_103776932 | 3300021178 | Soil | MRYVNNLGTDRVLGHVGGGLEYRFTPHIGIFGEIGYDFPNLSRNNFIQTNFGLRYAF |
| Ga0210408_106550252 | 3300021178 | Soil | AGLEYRFTPHIGIFGEVGYDFPNLSNNNFIQTNFGLRFAF |
| Ga0210396_100389761 | 3300021180 | Soil | EDFPGGSQVLGHAGAGLEYRFTPHIGIFGEVGYDFPNLSNNNFIQTNFGLRFAF |
| Ga0210388_107013451 | 3300021181 | Soil | EYRFTPHIGIFGEIGYDFPNLSNNNFIQTNFGLRFAF |
| Ga0210388_107380471 | 3300021181 | Soil | GLEYRFTPHIGIFGEVGYDFPNLSNNNFIQTNFGLRFAF |
| Ga0210388_114064951 | 3300021181 | Soil | LEYRFTPHIGIFGEVGYDFPNLSNNNFIQTNFGLRFAF |
| Ga0210385_101554311 | 3300021402 | Soil | RFTPHIGIFGEVGYDFPNLSNNNFIQTNFGLRFAF |
| Ga0210389_105494173 | 3300021404 | Soil | YRFTPHIGIFGEVGYDFPNLSNNNFIQTNFGLRFAF |
| Ga0210387_100022971 | 3300021405 | Soil | GAGLEYRFTPHIGIFGEVGYDFPNLSNNNFIQTNFGLRFAF |
| Ga0210387_100935531 | 3300021405 | Soil | GLEYRFTPHIGIFGEAGYDLVDGASNNFIQTNFGLRYAF |
| Ga0210383_100598401 | 3300021407 | Soil | DFPGGSQVLGHVGAGLEYRFTPHIGIFGEVGYDFPNLSNNNFIQTNFGLRFAF |
| Ga0210384_103651102 | 3300021432 | Soil | RFTPHIGLFGEVGFDFPNGASNNFLQTNFGLRYAF |
| Ga0210384_108838141 | 3300021432 | Soil | VGGGLEYRFTPNIGIFGELGYDFPNLANNNFIQTNFGLRYAF |
| Ga0210384_115547942 | 3300021432 | Soil | GLEYRFTPHIGLFGEAGYDLVDGASNNFIQTNFGLRFAF |
| Ga0210392_100645651 | 3300021475 | Soil | GGSQVLGHVGAGLEYRFTPHIGIFGEVGYDFPNLSNNNFIQTNFGLRFAF |
| Ga0210402_113707381 | 3300021478 | Soil | LEYRFTPHIGIFGEIGYDFPNLSNNNFIQTNFGLRFAF |
| Ga0210409_104754371 | 3300021559 | Soil | GGLEYRFTPHIGIFGEIGYVFPNLSNNNFIQTNFGLRYAF |
| Ga0242676_10479051 | 3300022512 | Soil | LEYRFTPHIGIFGEIGYDFPNLANNNFIQTNFGLRFAF |
| Ga0212123_105453472 | 3300022557 | Iron-Sulfur Acid Spring | AGLEYRFTPHIGLFSEAGYVFPNGASNNFVQINFGLRYAF |
| Ga0242654_102821871 | 3300022726 | Soil | LLAELSRIFGEIGYDFPNGSSNNFIQTNFGLRYAF |
| Ga0207745_10209992 | 3300026889 | Tropical Forest Soil | LGSDRVLGHVGGGLEYRFTPNIAIFGELGYDFPNLANNNFIQTNFGLRYAF |
| Ga0209040_100379561 | 3300027824 | Bog Forest Soil | LEYRFTPHIGLFSEVGYVFPNGASNNFVQVNFGLRYAF |
| Ga0308309_112091621 | 3300028906 | Soil | YRFTPHIGLFGEVGFDFPNGASNNFLQTNFGLRYAF |
| Ga0170822_107291901 | 3300031122 | Forest Soil | QVLGHVGGGLEYRFTPNIAIFGELGYDFPNLANNNFIQTNFGLRYAF |
| Ga0170822_162574651 | 3300031122 | Forest Soil | QVLGHVGAGLEYRFTPHIGIFGEVGYDFPNLSNNNFIQTNFGLRFAF |
| Ga0170823_135351431 | 3300031128 | Forest Soil | LGHVGGGLEYRFTPHIGIFGEVGYDFPNLANNNFIQTNFGLRYAF |
| Ga0170824_1183801291 | 3300031231 | Forest Soil | LEYRFTPHIGIFGEVGWDFPNLSNNNFIQTNFGLRFAF |
| Ga0170820_165999921 | 3300031446 | Forest Soil | ISRLREDFPGGSQVLGHVGGGLEYRFTPHIGIFGEVGVDFPNLSNNNFIQTNFGLRFAF |
| Ga0170818_1044487273 | 3300031474 | Forest Soil | GGLEYRFTPHIGIFGEVGWDFPNLSNNNFIQTNFGLRFAF |
| Ga0318541_102379971 | 3300031545 | Soil | LGRIGGGLEYRFTPNIGIFTEAAYVIPNGASNNFVQFNFIGLRYAF |
| Ga0310915_100473735 | 3300031573 | Soil | GLEYRFTPNIGIFTEAAYVIPNGASNNFVQFNFIGLRYAF |
| Ga0310686_1005866831 | 3300031708 | Soil | GLEYRFTPNIAIFGELGYDFPNLANNNFIQTNFGLRYAF |
| Ga0306917_100563631 | 3300031719 | Soil | RIGGGLEYRFTPNIGIFTEAAYVIPNGASNNFVQFNFIGLRYAF |
| Ga0306917_106104123 | 3300031719 | Soil | FTPNWAIFTEASYNILNLSNNNFVQWNFVGVRYAF |
| Ga0306918_100143571 | 3300031744 | Soil | GLEYRFTPNWAIFTEASYNILNLSNNNFVQWNFVGVRYAF |
| Ga0306918_100781461 | 3300031744 | Soil | GGGLEYRFTPNIGIFTEAAYVIPNGASNNFVQFNFIGLRYAF |
| Ga0306918_102726253 | 3300031744 | Soil | LGRIGAGLEYRFTPNIGIFTEASYNFPNLSGNNFVQWNFIGLRYVF |
| Ga0318546_103630022 | 3300031771 | Soil | VGGGLEYRFTPNIGIFSEVSYNIVNGADNNFVQFNFIGVRYAF |
| Ga0318547_103163412 | 3300031781 | Soil | FTPNIGIFTEAAYVIPNGASNNFVQFNFIGLRYAF |
| Ga0310917_100361471 | 3300031833 | Soil | YRFTPNIGIFTEAAYVIPNGASNNFVQFNFIGLRYAF |
| Ga0310917_100915061 | 3300031833 | Soil | IGGGLEYRFTPNIGIFTEAAYVIPNGASNNFVQFNFIGLRYAF |
| Ga0306925_100624861 | 3300031890 | Soil | YRFTPNIGIFSEVSYNIVNGADNNFVQFNFIGVRYAF |
| Ga0306923_100764936 | 3300031910 | Soil | LEYRFTPNIGIFTEAAYVIPNGASNNFVQFNFIGLRYAF |
| Ga0306923_110193141 | 3300031910 | Soil | GGLEYRFTPNWAIFTEASYNILNLSNNNFVQWNFVGVRYAF |
| Ga0306923_113361753 | 3300031910 | Soil | GGLEYRFTPHIGIFTEAAYVIPNGASNNFVQFNFIGLRYAF |
| Ga0306923_116340611 | 3300031910 | Soil | RIGGGLEYRFTPNWAIFTEASYNILNLSNNNFVQWNFFGVRYAF |
| Ga0306921_119190791 | 3300031912 | Soil | LEYRFTPNWAIFTEASYNILNLSNNNFVQWNFFGVRYAF |
| Ga0310912_109551961 | 3300031941 | Soil | DRVLGRIGGGLEYRFTPHIGIFTEAAYVIPNGASNNFVQFNFIGLRYAF |
| Ga0310916_102921021 | 3300031942 | Soil | EYRFTPNWAIFTEASYNILNLSNNNFVEWNFIGVRYAF |
| Ga0310916_110184082 | 3300031942 | Soil | LSYRFTPHIGLFGEATYNLVDGPKNNFMQVNWGVRYSLLTN |
| Ga0306926_100046681 | 3300031954 | Soil | RFTPNWAIFTEASYNILNLSNNNFVQWNFVGVRYAF |
| Ga0306926_122046371 | 3300031954 | Soil | IGGGLEYRFTPHIGIFTEAAYVIPNGASNNFVQFNFIGLRYAF |
| Ga0306922_100311235 | 3300032001 | Soil | DRVLGRIGGGLEYRFTPNWAIFTEASYNILNLSNNNFVQWNFVGVRYAF |
| Ga0310911_102646501 | 3300032035 | Soil | NISTDRLLGRIGGGLEYRFTPNIAIFTEASYNFPNLSGNNFVQWNFIGVRYAF |
| Ga0310911_108820821 | 3300032035 | Soil | GGGLEYRFTPHIGIFGEIGYVFPNLANNNFIQTNFGLRYAF |
| Ga0306920_1039780502 | 3300032261 | Soil | GGGLEYRFTPNIGIFTEASYVIPNGASNNFVQWNFIGVRYAF |
| Ga0310914_114345421 | 3300033289 | Soil | FTPNIGIFTEAAYVIPDGSGNNFVQFNFIGLRYAF |
| Ga0310914_115939611 | 3300033289 | Soil | GGGLEYRFTPNIGIFSEVSYNIVNGADNNFVQFNFIGVRYAF |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |