| Basic Information | |
|---|---|
| Family ID | F084446 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 112 |
| Average Sequence Length | 53 residues |
| Representative Sequence | MKLSLLFIVMDLLTLLAYPIVFVHSKLRQFSKPKENIPGPNLLVAVPVTPGR |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 75.45 % |
| % of genes near scaffold ends (potentially truncated) | 21.43 % |
| % of genes from short scaffolds (< 2000 bps) | 76.79 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (75.893 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment (13.393 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.786 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (27.679 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 42.50% β-sheet: 0.00% Coil/Unstructured: 57.50% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF00571 | CBS | 4.46 |
| PF00773 | RNB | 1.79 |
| PF01594 | AI-2E_transport | 1.79 |
| PF01145 | Band_7 | 1.79 |
| PF00106 | adh_short | 0.89 |
| PF13541 | ChlI | 0.89 |
| PF00196 | GerE | 0.89 |
| PF04972 | BON | 0.89 |
| PF13282 | DUF4070 | 0.89 |
| PF04055 | Radical_SAM | 0.89 |
| PF02310 | B12-binding | 0.89 |
| PF00216 | Bac_DNA_binding | 0.89 |
| PF12801 | Fer4_5 | 0.89 |
| PF00365 | PFK | 0.89 |
| PF11999 | Ice_binding | 0.89 |
| PF01546 | Peptidase_M20 | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG0557 | Exoribonuclease R | Transcription [K] | 1.79 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 1.79 |
| COG4776 | Exoribonuclease II | Transcription [K] | 1.79 |
| COG0205 | 6-phosphofructokinase | Carbohydrate transport and metabolism [G] | 0.89 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 75.89 % |
| Unclassified | root | N/A | 24.11 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886007|SwRhRL2b_contig_162495 | All Organisms → cellular organisms → Bacteria | 2994 | Open in IMG/M |
| 2228664021|ICCgaii200_c0754582 | Not Available | 679 | Open in IMG/M |
| 3300000559|F14TC_105299022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 681 | Open in IMG/M |
| 3300000787|JGI11643J11755_11769300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 1695 | Open in IMG/M |
| 3300000787|JGI11643J11755_11792677 | Not Available | 606 | Open in IMG/M |
| 3300000890|JGI11643J12802_12056114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 1658 | Open in IMG/M |
| 3300000956|JGI10216J12902_112088461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 964 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_108010131 | Not Available | 1151 | Open in IMG/M |
| 3300002027|MIS_10106547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3242 | Open in IMG/M |
| 3300002124|C687J26631_10009563 | All Organisms → cellular organisms → Bacteria | 3482 | Open in IMG/M |
| 3300002124|C687J26631_10191265 | Not Available | 681 | Open in IMG/M |
| 3300003987|Ga0055471_10148957 | Not Available | 713 | Open in IMG/M |
| 3300003993|Ga0055468_10047797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1076 | Open in IMG/M |
| 3300003996|Ga0055467_10293755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 519 | Open in IMG/M |
| 3300004019|Ga0055439_10079889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 941 | Open in IMG/M |
| 3300004019|Ga0055439_10212318 | Not Available | 622 | Open in IMG/M |
| 3300004242|Ga0066601_10174952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 808 | Open in IMG/M |
| 3300004282|Ga0066599_100709399 | Not Available | 693 | Open in IMG/M |
| 3300004282|Ga0066599_101158546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 574 | Open in IMG/M |
| 3300004282|Ga0066599_101285048 | Not Available | 551 | Open in IMG/M |
| 3300004463|Ga0063356_102029112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 871 | Open in IMG/M |
| 3300004463|Ga0063356_103417581 | Not Available | 684 | Open in IMG/M |
| 3300005289|Ga0065704_10086900 | All Organisms → cellular organisms → Bacteria | 3062 | Open in IMG/M |
| 3300005343|Ga0070687_101135807 | Not Available | 573 | Open in IMG/M |
| 3300005445|Ga0070708_100619427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 1020 | Open in IMG/M |
| 3300005467|Ga0070706_100182104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 1962 | Open in IMG/M |
| 3300005468|Ga0070707_100370603 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 1391 | Open in IMG/M |
| 3300005518|Ga0070699_101353799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 653 | Open in IMG/M |
| 3300005618|Ga0068864_100540015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 1126 | Open in IMG/M |
| 3300005840|Ga0068870_10076360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 1840 | Open in IMG/M |
| 3300005843|Ga0068860_102825820 | Not Available | 503 | Open in IMG/M |
| 3300006049|Ga0075417_10116969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 1221 | Open in IMG/M |
| 3300006194|Ga0075427_10029683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 895 | Open in IMG/M |
| 3300006755|Ga0079222_11768218 | Not Available | 596 | Open in IMG/M |
| 3300006852|Ga0075433_11590857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 564 | Open in IMG/M |
| 3300006865|Ga0073934_10016787 | All Organisms → cellular organisms → Bacteria | 8040 | Open in IMG/M |
| 3300006871|Ga0075434_100527099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1202 | Open in IMG/M |
| 3300006871|Ga0075434_102604646 | Not Available | 506 | Open in IMG/M |
| 3300006880|Ga0075429_100043414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3912 | Open in IMG/M |
| 3300006904|Ga0075424_101841655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 640 | Open in IMG/M |
| 3300006954|Ga0079219_11373032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 629 | Open in IMG/M |
| 3300009009|Ga0105105_10264617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 917 | Open in IMG/M |
| 3300009037|Ga0105093_10023107 | All Organisms → cellular organisms → Bacteria | 2644 | Open in IMG/M |
| 3300009037|Ga0105093_10528206 | Not Available | 660 | Open in IMG/M |
| 3300009081|Ga0105098_10000989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 10147 | Open in IMG/M |
| 3300009082|Ga0105099_10060691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2010 | Open in IMG/M |
| 3300009085|Ga0105103_10519234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 670 | Open in IMG/M |
| 3300009091|Ga0102851_11366999 | Not Available | 785 | Open in IMG/M |
| 3300009100|Ga0075418_11729251 | Not Available | 680 | Open in IMG/M |
| 3300009111|Ga0115026_10314427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 1102 | Open in IMG/M |
| 3300009146|Ga0105091_10006893 | All Organisms → cellular organisms → Bacteria | 4811 | Open in IMG/M |
| 3300009147|Ga0114129_10055800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 5536 | Open in IMG/M |
| 3300009148|Ga0105243_12261345 | Not Available | 581 | Open in IMG/M |
| 3300009156|Ga0111538_12723327 | Not Available | 620 | Open in IMG/M |
| 3300009157|Ga0105092_10025578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3113 | Open in IMG/M |
| 3300009162|Ga0075423_10684628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 1082 | Open in IMG/M |
| 3300009165|Ga0105102_10278080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 860 | Open in IMG/M |
| 3300009167|Ga0113563_10875316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 1024 | Open in IMG/M |
| 3300009167|Ga0113563_13063552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 566 | Open in IMG/M |
| 3300009168|Ga0105104_10002799 | All Organisms → cellular organisms → Bacteria | 12588 | Open in IMG/M |
| 3300009169|Ga0105097_10271823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 935 | Open in IMG/M |
| 3300009696|Ga0116177_10415615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 707 | Open in IMG/M |
| 3300010038|Ga0126315_10185735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 1246 | Open in IMG/M |
| 3300010040|Ga0126308_11154813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 547 | Open in IMG/M |
| 3300010399|Ga0134127_10350914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1441 | Open in IMG/M |
| 3300011433|Ga0137443_1208504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RIFOXYD12_FULL_57_15 | 583 | Open in IMG/M |
| 3300011444|Ga0137463_1359004 | Not Available | 522 | Open in IMG/M |
| 3300012350|Ga0137372_10266205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 1342 | Open in IMG/M |
| 3300012675|Ga0137337_1014520 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
| 3300014326|Ga0157380_10664368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 1042 | Open in IMG/M |
| 3300014326|Ga0157380_11215572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 798 | Open in IMG/M |
| 3300014502|Ga0182021_10779244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 1148 | Open in IMG/M |
| 3300014875|Ga0180083_1099793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 636 | Open in IMG/M |
| 3300014884|Ga0180104_1186756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 619 | Open in IMG/M |
| 3300018053|Ga0184626_10137442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 1039 | Open in IMG/M |
| 3300018059|Ga0184615_10414047 | Not Available | 737 | Open in IMG/M |
| 3300018059|Ga0184615_10445732 | Not Available | 704 | Open in IMG/M |
| 3300018059|Ga0184615_10510936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RIFOXYD12_FULL_57_15 | 645 | Open in IMG/M |
| 3300018074|Ga0184640_10460422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 564 | Open in IMG/M |
| 3300020048|Ga0207193_1076719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae | 3217 | Open in IMG/M |
| 3300021090|Ga0210377_10043979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3121 | Open in IMG/M |
| 3300022185|Ga0079039_1273215 | Not Available | 507 | Open in IMG/M |
| 3300025310|Ga0209172_10057344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2384 | Open in IMG/M |
| 3300025313|Ga0209431_10155037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1813 | Open in IMG/M |
| 3300025324|Ga0209640_10471167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1027 | Open in IMG/M |
| 3300025580|Ga0210138_1081010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 774 | Open in IMG/M |
| 3300025910|Ga0207684_10275798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 1450 | Open in IMG/M |
| 3300025922|Ga0207646_10668176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 930 | Open in IMG/M |
| 3300025953|Ga0210068_1080417 | Not Available | 512 | Open in IMG/M |
| 3300027675|Ga0209077_1013872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2133 | Open in IMG/M |
| 3300027726|Ga0209285_10080833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 981 | Open in IMG/M |
| 3300027739|Ga0209575_10233328 | Not Available | 646 | Open in IMG/M |
| 3300027743|Ga0209593_10023989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2446 | Open in IMG/M |
| 3300027743|Ga0209593_10025932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 2341 | Open in IMG/M |
| 3300027873|Ga0209814_10066195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 1515 | Open in IMG/M |
| 3300028380|Ga0268265_10010897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 6140 | Open in IMG/M |
| 3300028864|Ga0302215_10326239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RIFOXYD12_FULL_57_15 | 557 | Open in IMG/M |
| 3300030047|Ga0302286_10015351 | All Organisms → cellular organisms → Bacteria | 4556 | Open in IMG/M |
| 3300031228|Ga0299914_10057918 | All Organisms → cellular organisms → Bacteria | 3325 | Open in IMG/M |
| 3300031228|Ga0299914_10270340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1501 | Open in IMG/M |
| 3300031728|Ga0316578_10359482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 866 | Open in IMG/M |
| 3300031824|Ga0307413_10802461 | Not Available | 791 | Open in IMG/M |
| 3300031903|Ga0307407_11655583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 509 | Open in IMG/M |
| 3300031949|Ga0214473_10113512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3164 | Open in IMG/M |
| 3300031949|Ga0214473_10242345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 2075 | Open in IMG/M |
| 3300033418|Ga0316625_100848217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 792 | Open in IMG/M |
| 3300033485|Ga0316626_11448322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RIFOXYD12_FULL_57_15 | 618 | Open in IMG/M |
| 3300033486|Ga0316624_10525981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 1016 | Open in IMG/M |
| 3300034128|Ga0370490_0046262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1432 | Open in IMG/M |
| 3300034818|Ga0373950_0091101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 647 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 13.39% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.71% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 6.25% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 5.36% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.36% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 4.46% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.46% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 3.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 3.57% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 3.57% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.68% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.68% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 1.79% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.79% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.79% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.79% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.79% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.79% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.89% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.89% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.89% |
| Sinkhole Freshwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Sinkhole Freshwater | 0.89% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.89% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.89% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.89% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.89% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.89% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300002027 | Sinkhole freshwater microbial communities from Lake Huron, USA - Flux 1.5k-5k | Environmental | Open in IMG/M |
| 3300002124 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_3 | Environmental | Open in IMG/M |
| 3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
| 3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
| 3300003996 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 | Environmental | Open in IMG/M |
| 3300004019 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 | Environmental | Open in IMG/M |
| 3300004242 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Medium cellulose week 11 | Environmental | Open in IMG/M |
| 3300004282 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006194 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009696 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC10_MetaG | Engineered | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011431 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT157_2 | Environmental | Open in IMG/M |
| 3300011433 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT300_2 | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012675 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT333_2 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014496 | Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014875 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_1_16_10D | Environmental | Open in IMG/M |
| 3300014884 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1Da | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
| 3300022185 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025310 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025580 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025953 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027675 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027726 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027739 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Medium cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028864 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N3_1 | Environmental | Open in IMG/M |
| 3300030047 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3 | Environmental | Open in IMG/M |
| 3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
| 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Host-Associated | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300034128 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_16 | Environmental | Open in IMG/M |
| 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| SwRhRL2b_0607.00004980 | 2162886007 | Switchgrass Rhizosphere | MDLLTLLAYPLVFVHGKLQQYSKSKESIPLANLLVTIPVTSDKQPIGKL |
| ICCgaii200_07545823 | 2228664021 | Soil | MGEEMIMKLKLIFILMELITLLAYPIVFVQSNLRSFSRSKERIPVANLLIILPVRQSK |
| F14TC_1052990221 | 3300000559 | Soil | KLYILFMIMDLFTLLAYPFVLMHGKLGQFSKSKESVPVPNILVPVPVIPGR* |
| JGI11643J11755_117693004 | 3300000787 | Soil | MKLNLLFFVMDLLILLAYPIIFVHGKLRSFTESRESVLVPNLLVAVPVTLGK* |
| JGI11643J11755_117926772 | 3300000787 | Soil | MGEEMIMKLKLIFILMELITLLAYPIVFVQSNLRSFSRSKERIPVANLLIXXPVRQSK* |
| JGI11643J12802_120561143 | 3300000890 | Soil | MIMKLKLIFILMELITLLAYPIVFVQSNLRSFSRSKERIPVANLLIIVPVRQSK* |
| JGI10216J12902_1120884612 | 3300000956 | Soil | MESEERMKLNLIFIVMELLTLLAYPIVFVHSKLQPFLESKESIPVPNLSMIVPVTSGK* |
| JGIcombinedJ13530_1080101312 | 3300001213 | Wetland | VKLNFLFIVMDLLTLLAYLIVFVRGKLRQFSTSKESIPSVILLTPGPVKSGRLSIE* |
| MIS_101065475 | 3300002027 | Sinkhole Freshwater | MKLSLLFIVMDLLTILAYPIVFVHGKLRHFSKSKEDTTLELVPVPVTANN* |
| C687J26631_100095635 | 3300002124 | Soil | MKLTLLFIVMDLLTLLAYPIVFVHGKLYQLFRSKESVPLASQLVSVSVRPGR* |
| C687J26631_101912652 | 3300002124 | Soil | MKLNLIFMVMELLTLLAYPIVFVHGKLRPFSKSKVRDPVPNLLVIVPVAPGK* |
| Ga0055471_101489572 | 3300003987 | Natural And Restored Wetlands | MRLSLLFIVMDLLTLLAYPIVFAHGKLRQFSNSKESIPLANLLVIVPAPPGT* |
| Ga0055468_100477971 | 3300003993 | Natural And Restored Wetlands | MRLSLLFIVMDLLTLLAYPIVFAHGKLRQFSNSKESIPLANLLVIVPVPPGT* |
| Ga0055467_102937552 | 3300003996 | Natural And Restored Wetlands | SIGRRGEKTMRLSLLFIVMDLLTLLAYPIVFAHGKLRQFSNSKESIPLANLLVIVPVPPGT* |
| Ga0055439_100798892 | 3300004019 | Natural And Restored Wetlands | MKLNILFIAMNVLTVLAYPIVFVYGKLRKFSKPKESIALTNLMVTVPVVLDG* |
| Ga0055439_102123181 | 3300004019 | Natural And Restored Wetlands | MKLNILFIVMNVLRALAYPIVFVYGKLRKLSKPKESIALANLMVAVPIAPDR* |
| Ga0066601_101749522 | 3300004242 | Freshwater | MKLKLLFIAMDLLTILAYPIVFVHGKLRHFSKSKEDTTQKLVSVPVTAGG* |
| Ga0066599_1007093992 | 3300004282 | Freshwater | KLKLLFIVMDLLTILAYPIVFVHGKLRQFIKSKESIALTNLLVTGSITPGR* |
| Ga0066599_1011585461 | 3300004282 | Freshwater | MKLNLIFIVMDLLTILAYPIVFLHGKFRQFSKPKENIALALVAASVTPGRRLI* |
| Ga0066599_1012850481 | 3300004282 | Freshwater | MKLKLLFIVMDLLTILAYPIVFLHGKLRRFAKPKEGVALALIPVPATAGG* |
| Ga0063356_1020291122 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKLSLLFLVMELLTLLAYPIVFVHGRLRRFSKSKERIPVSNLSIIVPVTPD* |
| Ga0063356_1034175813 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MIMKLKLIFILMELITLLAYPIVFVQSNLRSFSRSKERIPVANLLI |
| Ga0065704_100869006 | 3300005289 | Switchgrass Rhizosphere | MKLSLLFIVMELLTVLVYPIVFVHGKLHQFSNSKGSIFVPNLLVPVPVRPGR* |
| Ga0070687_1011358071 | 3300005343 | Switchgrass Rhizosphere | LFIIMDSLTLLAYPIVFAHGKLRQFSESKESISLANLLVGGSVTAGR* |
| Ga0070708_1006194271 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LSLLFIVMDLLTLLAYPIVFVHGKLRQFSKSKESIPGLNLLVAVPVTLGR* |
| Ga0070706_1001821044 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | LGEDKTMKLSLHFIVMDLLTLLAYPIVFVHSKLRQFSKPKENIPGPNLLVAVPVTPGR* |
| Ga0070707_1003706032 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | TLLAYPIVFAHGKLRQFSESKESISLANLLVGGSVTAGR* |
| Ga0070699_1013537992 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | GEEKTMKLSLLFIVMDLLTLLAYPIVFVHSKLRQFSKPKENIPGPNLLVAVPVTLGR* |
| Ga0068864_1005400153 | 3300005618 | Switchgrass Rhizosphere | FIVMELLTVLVYPIVFVHGKLHQFSNSKGSIFVPNLLVPVPVRPGR* |
| Ga0068870_100763602 | 3300005840 | Miscanthus Rhizosphere | MKLTLLFIMMDLLTLLAYPIVFVHGKLRQLSNSREGIPLANLLLTVPVTPDR* |
| Ga0068860_1028258202 | 3300005843 | Switchgrass Rhizosphere | MDLLALPAYPIVFVHAKLRQFSKSKENITLANLLVGGSVTAGR* |
| Ga0075417_101169691 | 3300006049 | Populus Rhizosphere | MKLSLLFIVMDLLTLLAYPIVFVHSKLRQFSKPKENIPGPNLLVAVPVTPGR* |
| Ga0075427_100296832 | 3300006194 | Populus Rhizosphere | LGEDKTMKLSLLFIVMDLLTLLAYPIVFVHSKQRQFSKPKENIPGPNLLVAVPVTPGR* |
| Ga0079222_117682182 | 3300006755 | Agricultural Soil | MGEELTMKLNLIFILMQLFTLLAYPIVFVQSNLRSFSSSRESIPVPDLLMIVPVTPGK* |
| Ga0075433_115908571 | 3300006852 | Populus Rhizosphere | LFIVMDLLTLLAYPIVFVHSKLRQFSKPKENIPGPNLLVAVPVTPGR* |
| Ga0073934_1001678711 | 3300006865 | Hot Spring Sediment | MKAGIGRRGEKTLRLSLLFIVMDLLTLLAYPIVFAHGKLRQFSNSKESIPLANVFVTVPVPPGT* |
| Ga0075434_1005270994 | 3300006871 | Populus Rhizosphere | LGEEKTIKLSLLFIIMDLLTLLAYPIVFVHGKLHQFSKSKESIPVPNLLVTVPVIPYR* |
| Ga0075434_1026046461 | 3300006871 | Populus Rhizosphere | LGEDKTMKLSLLFIVMDLLTLLAYPIVFVHSKLRQFSKQKENIPGPNLLVAVPVTPGR* |
| Ga0075429_1000434145 | 3300006880 | Populus Rhizosphere | MKLNLIFIVMELLTLLAYPIVFVHGRLRRFSKSKERIPVSNLSMIVPVTTD* |
| Ga0075424_1018416551 | 3300006904 | Populus Rhizosphere | LGEDKTMKLSLLFIVMDLLTLLAYPIVFVHSKLRQFSKPKENIPGPNLLVAVPVTPGR* |
| Ga0079219_113730321 | 3300006954 | Agricultural Soil | MGEELTMKLNLIFILMQLITLLAYPIVFVQSKLRPFSRSRESIPVPDLSMIVSVTPGK* |
| Ga0105105_102646171 | 3300009009 | Freshwater Sediment | KLLFIVMDLLTILAYPIVFLHGKLRRFAKPKEGVALELIPVPATAGG* |
| Ga0105093_100231073 | 3300009037 | Freshwater Sediment | IVMDLLTILAYPIVFMYGKLRWFSKSKESIPLTHLLVPVAIAPDG* |
| Ga0105093_105282062 | 3300009037 | Freshwater Sediment | MKMKLSLLFIVMDFLTILAYPIVFLHGKLRQFSKPKEGVTLALVPVPVTPVK* |
| Ga0105098_1000098915 | 3300009081 | Freshwater Sediment | MKLSLLFIVMDLLTSLAYAILFVHGKLCQFSNSKGSIALTNLPVTVPVTAAR* |
| Ga0105099_100606913 | 3300009082 | Freshwater Sediment | MKLSLLFIVMDLVTILAYPIVFLHSKLRQFSKPKEGVTLASVPVPVAPGRQPN* |
| Ga0105103_105192342 | 3300009085 | Freshwater Sediment | FIVMDLLTILAYPIVFLHGKLRQFSKPKEGVTLALVPVPVTRVKKPN* |
| Ga0102851_113669992 | 3300009091 | Freshwater Wetlands | MKLYLLFIIMDLLTLLAYPIVFVHGQLRQFSKSKERIALANLLGISVTPGR* |
| Ga0075418_117292512 | 3300009100 | Populus Rhizosphere | MKLSLLFIVMDLLTLLAYQIVFVHSKERQFSKPKKNIPGPNLLVAVPVTPGR* |
| Ga0115026_103144272 | 3300009111 | Wetland | MKLYLLFIVMDLLTLLVYPIVYVHSTLRQFSKSRESIALANLWVTGSVTPGRSPTEI* |
| Ga0105091_100068935 | 3300009146 | Freshwater Sediment | MRLSLLFIVMDLVTLLAYPIVFVHGKLRQFSKRKAVINLANSLVTGSVIPDS* |
| Ga0114129_1005580010 | 3300009147 | Populus Rhizosphere | LGEEKTIKLSLLFIIMDLLTILAYPIVFVHGKLSQFSKSKESIPVPNLLVTVPVTVGR* |
| Ga0105243_122613452 | 3300009148 | Miscanthus Rhizosphere | LGEEKTMKLSLLFIVMDLLTLLAYPIVFVHGKLRQFSKSKESIPGPNLLVAVPVTLGR* |
| Ga0111538_127233272 | 3300009156 | Populus Rhizosphere | MKLSLLFIVMDLLTLLAYPIVFVHGKLRQFSKSKESIPVLNLFVAIPVIPGK* |
| Ga0105092_100255786 | 3300009157 | Freshwater Sediment | MRLNLFFIVMYLLTLLAYPIVFVHGKLRRFSNPKVSMPLANLLATVPVTPVRR* |
| Ga0075423_106846282 | 3300009162 | Populus Rhizosphere | LGEEKTMKLSLLFIVMDLLTLLAYPIVFVHGKLRQFSKSKESIPVLNLFVAIPVIPGK* |
| Ga0105102_102780801 | 3300009165 | Freshwater Sediment | MKLSLLFIVMDLLTILAYPIVFLHGKLSRFSKSKEGITLALVPVPVTPGRQPN* |
| Ga0113563_108753163 | 3300009167 | Freshwater Wetlands | MKMKLGLLFIIMDLLTILAYPVVFLHGKLRQFAKPKEGVTLAVVPVIPVK* |
| Ga0113563_130635521 | 3300009167 | Freshwater Wetlands | LFIVMDLLTLLAYPIVFVHGKLRQFSDLKESLPLASRFVTVPVAPVR* |
| Ga0105104_100027995 | 3300009168 | Freshwater Sediment | MDLVTLLAYPIVFVHGKLRQFSKRKAVINLANSLVTGSVIPDS* |
| Ga0105097_102718232 | 3300009169 | Freshwater Sediment | MKLSLLFIVMDLVTILAYPIVFLHSKLRQFSKPKEGVTLASVPVPVTPGRQPN* |
| Ga0116177_104156151 | 3300009696 | Anaerobic Digestor Sludge | MKLNLIFIVMDLLTLLVYPVVFVHGKLRQFSKSKEDDLPPSLLSASSVLPG* |
| Ga0126315_101857352 | 3300010038 | Serpentine Soil | MKLNLFFIVMDLLTLLAYPIVFVHGKLRRFYKIKESIPVPKLFVVVPVTPGR* |
| Ga0126308_111548131 | 3300010040 | Serpentine Soil | EKTIKLNLLFITMELLTLLAYPIVFVHGKLYPFAKSGETVPVPNLFVVLSTAPEK* |
| Ga0134127_103509142 | 3300010399 | Terrestrial Soil | MKLNLIFIAMELLTLLADPIVFLHSKLRPFSKSKGMIPVPNRLVILPVTPPK* |
| Ga0137438_10036358 | 3300011431 | Soil | MKLNLFFIAMYVLTILAYPIVFVYGKLRQYSNIKDSTVPVNN* |
| Ga0137443_12085042 | 3300011433 | Soil | MISKQREAMRHKMKLGLLFIVMDLLTLLAYPIVFVHGKIRQFSKSKESNTLSSSLLVTGPVTPSR* |
| Ga0137463_13590041 | 3300011444 | Soil | MGEEKTMKLGLLFIVMDLLTLLAYPIVFVYGKLLQFSRSKESTPASNLLATVPVLTGR* |
| Ga0137372_102662053 | 3300012350 | Vadose Zone Soil | LGEEKTLKLNLLFIVMDLLTLLAYPIVFVQSRLRQFSKSKESIQLANLLGTGLITAGR* |
| Ga0137337_10145203 | 3300012675 | Soil | IVMDLLTLLAYPIVFVHGKIRQFSKSKENIALSNLLVNSSVTPGR* |
| Ga0157380_106643682 | 3300014326 | Switchgrass Rhizosphere | MGEEMIMKLNLTILMELITLLAYPIVFVQSNLRSFSRSKERIPVANLLIILPVRQGD* |
| Ga0157380_112155721 | 3300014326 | Switchgrass Rhizosphere | MGEEMIMKLKLIFVLMELITLLAYPIVFVQSKLRPFSRSKHWIPAANL |
| Ga0182011_106707711 | 3300014496 | Fen | MDLLTLLAYPILFVHGKLREFSTSKENIIPANILITGSAAVSG* |
| Ga0182021_107792441 | 3300014502 | Fen | MKLNLIFIAMDLLTILAYPIVFVHSKIRQFLKSKEKSPLDNLLVTTGR* |
| Ga0180083_10997933 | 3300014875 | Soil | MKLNFLFIIMDLLTLLAYPIIFVHGKLRQFSKSKVSITLDNLLVTTGS* |
| Ga0180104_11867561 | 3300014884 | Soil | MKLNSLFIAMDLLTLLAYTIVFVQGKLRQFSKPKDGVPLVNLLVTVPVASGR* |
| Ga0184626_101374422 | 3300018053 | Groundwater Sediment | LFIIMDLLILLVYPIIFAYGGLRQFSKSKERFTRTKLLVTGAVTPGR |
| Ga0184615_104140472 | 3300018059 | Groundwater Sediment | MKLKLLFIVMDLLTLLAYPIVFVHGKLLQFSNSKGSIPLANLLVPVPVTPGR |
| Ga0184615_104457322 | 3300018059 | Groundwater Sediment | MKLNLIFIVMELLTLLAYPIVFVHGKLRKFSKLKESTPLTKLLVAVPITPDR |
| Ga0184615_105109362 | 3300018059 | Groundwater Sediment | MKLKLLFIVMDLLTILAYPIVFMHGKQRQFSKSKEYITSDNLLVTTGR |
| Ga0184640_104604221 | 3300018074 | Groundwater Sediment | MKLKLIFIVMDLLTVLAYPIFFVHGKLRQLPKSKERTALANILAAGS |
| Ga0207193_10767193 | 3300020048 | Freshwater Lake Sediment | MKLNILFIVMDLLTILAYPIVFLHGKLRQLAKSKEGVTLALVPVPATPGRQPN |
| Ga0210377_100439797 | 3300021090 | Groundwater Sediment | MKLKLLFIVMDLLTILAYPIVFVYGKLRQFSKLKESVTPDNLPVRAGR |
| Ga0079039_12732151 | 3300022185 | Freshwater Wetlands | DPGEMIMKLYLLFIVMDLLTLLAYPIVFVHGQLRQFSKSKERIALANLLGISVTPGR |
| Ga0209172_100573446 | 3300025310 | Hot Spring Sediment | MKAGIGRRGEKTLRLSLLFIVMDLLTLLAYPIVFAHGKLRQFSNSKESIPLANVFVTVPVPPGT |
| Ga0209431_101550372 | 3300025313 | Soil | MKLTLLFIVMDLLTLLAYPIVFVHGKLYQLFRSKESVPLASQLVSVSVRPGR |
| Ga0209640_104711671 | 3300025324 | Soil | MKLNLIFMVMELLTLLAYPIVFVHGKLRQFSKSKVRDPVPNLLV |
| Ga0210138_10810101 | 3300025580 | Natural And Restored Wetlands | MKLNILFIAMNVLTVLAYPIVFVYGKLRKFSKPKESIALTNLMVTVPVVLDG |
| Ga0207684_102757983 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | LGEDKTMKLSLHFIVMDLLTLLAYPIVFVHSKLRQFSKPKENIPGPNLLVAVPVTPGR |
| Ga0207646_106681763 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LGEEKTMKLSLLFIVMDLLTLLAYPIVFVHGKLRQFSKSKESIPGPNLLVAVPVTLGR |
| Ga0210068_10804172 | 3300025953 | Natural And Restored Wetlands | MAEEKTMKLNLIFIVMELLTLLAYPIVFVQSKLRPFSKSKERIPLPNVLIIVPVTPGK |
| Ga0209077_10138723 | 3300027675 | Freshwater Sediment | LREAKTMRLSLLFIVMDLVTLLAYPIVFVHGKLRQFSKRKAVINLANSLVTGSVIPDS |
| Ga0209285_100808332 | 3300027726 | Freshwater Sediment | MKLSLLFIVMDLVTILAYPIVFLHSKLRQFSKPKEGVTLASVPVPVTPGRQPN |
| Ga0209575_102333282 | 3300027739 | Freshwater | MKLKLLFIAMDLLTILAYPIVFVHGKLRHFSKSKEDTTQKLVSVPVTAGG |
| Ga0209593_100239895 | 3300027743 | Freshwater Sediment | MRLSLLFIVMDLVTLLAYPIVFVHGKLRQFSKRKAVINLANSLVTGSVIPDS |
| Ga0209593_100259322 | 3300027743 | Freshwater Sediment | MRLNLFFIVMYLLTLLAYPIVFVHGKLRRFSNPKVSMPLANLLATVPVTPVRR |
| Ga0209814_100661953 | 3300027873 | Populus Rhizosphere | LGEDKTMKLSLLFIVMDLLTLLAYPIVFVHSKLRQFSKPKENIPGPNLLVAVPVTPGR |
| Ga0268265_100108978 | 3300028380 | Switchgrass Rhizosphere | MKLSLLFIVMELLTVLVYPIVFVHGKLHQFSNSKGSIFVPNLLVPVPVRPGR |
| Ga0302215_103262391 | 3300028864 | Fen | MKLKLNLFFIVMDLLTILAYPIIYVHGKLRQFSKLKESIAPNKLLVTAG |
| Ga0302286_100153516 | 3300030047 | Fen | MKLKLNLFFIVMDLLTILAYPIIYVHGKLRQFSKLKESIAPNKLLVTAGR |
| Ga0299914_100579185 | 3300031228 | Soil | MRLSLLFIVMDLLTVLAYPIVYVHGKLRPFAKSKESIPLANRLVPRSVTQAR |
| Ga0299914_102703405 | 3300031228 | Soil | MRLSLLFIVMDLLTLLAYPIVFLHGKLRPFAKSKESIPLANRLVIVPAPPGT |
| Ga0316578_103594822 | 3300031728 | Rhizosphere | MKLKLLFIVMDLLTILAYPFIFLYGKLRQFSKFRESTALAKLLVTDPVIAGR |
| Ga0307413_108024611 | 3300031824 | Rhizosphere | MREMTMKLNLIFLVMELLTLLAYPIVFVHGQLLQFSNSKAGILLANLWSSDPVAPDR |
| Ga0307407_116555832 | 3300031903 | Rhizosphere | EMTMKLNLIFLVMELLTLLAYPIVFVHGQLLQFSNSKAGILLANLWSSDPVAPDR |
| Ga0214473_101135124 | 3300031949 | Soil | MKVSVGRREEKTMKLHLLFIVMDLLTVLAYPIVFAHGKLRQFSKSKESLLLANLLVTVPVTPGR |
| Ga0214473_102423452 | 3300031949 | Soil | MKLNLIFIVMDLLTILAYPIVFMHGKLRWFSKSKESVPLTNLLVPVAITSDG |
| Ga0316625_1008482172 | 3300033418 | Soil | MKLNMLFIVMDLLTVLAYPIVFVHGKLRHYLKPKESIHPPNSWVVAPIVLER |
| Ga0316626_114483222 | 3300033485 | Soil | MKLYLLFIIMDLLTLLAYPIVYVHGTLRQFSKSRESIALANLWVTGAVTPGRSPIEIL |
| Ga0316624_105259812 | 3300033486 | Soil | MKLSLLFIVMDLLTLLAYPIVFVHGKLRQFSNSRENLPLAKLFVAIPATPVR |
| Ga0370490_0046262_660_839 | 3300034128 | Untreated Peat Soil | MREEEKTMKLHLIFIVMDLLTLLAYPIVFMHGKLLQFSNSKGSIPVANLLVPVPITTER |
| Ga0373950_0091101_23_181 | 3300034818 | Rhizosphere Soil | MKLSLLFIVMDLLTLLAYPIVFVYGKLRQFSKSKESIPVPNLFVAVPITPGK |
| ⦗Top⦘ |