NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F084439

Metagenome / Metatranscriptome Family F084439

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F084439
Family Type Metagenome / Metatranscriptome
Number of Sequences 112
Average Sequence Length 51 residues
Representative Sequence MSITSTLVRRAEIRFHEAADVLRPFVGCFWVVTAERDATIRVVPD
Number of Associated Samples 96
Number of Associated Scaffolds 112

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 73.21 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 91.96 %
Associated GOLD sequencing projects 87
AlphaFold2 3D model prediction Yes
3D model pTM-score0.55

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (71.429 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(10.714 % of family members)
Environment Ontology (ENVO) Unclassified
(33.036 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(48.214 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 43.84%    Coil/Unstructured: 56.16%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.55
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 112 Family Scaffolds
PF01425Amidase 4.46
PF05787DUF839 4.46
PF13709DUF4159 3.57
PF03795YCII 2.68
PF01738DLH 2.68
PF07992Pyr_redox_2 1.79
PF00375SDF 1.79
PF04542Sigma70_r2 1.79
PF00072Response_reg 1.79
PF12779WXXGXW 0.89
PF08282Hydrolase_3 0.89
PF08533Glyco_hydro_42C 0.89
PF08031BBE 0.89
PF06897DUF1269 0.89
PF03358FMN_red 0.89
PF12681Glyoxalase_2 0.89
PF13520AA_permease_2 0.89
PF02687FtsX 0.89
PF12697Abhydrolase_6 0.89
PF13442Cytochrome_CBB3 0.89
PF12867DinB_2 0.89
PF03466LysR_substrate 0.89
PF14041Lipoprotein_21 0.89
PF03807F420_oxidored 0.89
PF01814Hemerythrin 0.89
PF01431Peptidase_M13 0.89
PF02954HTH_8 0.89
PF13360PQQ_2 0.89
PF02371Transposase_20 0.89
PF06078DUF937 0.89
PF06127Mpo1-like 0.89
PF13620CarboxypepD_reg 0.89
PF00486Trans_reg_C 0.89
PF11138DUF2911 0.89
PF069833-dmu-9_3-mt 0.89
PF00310GATase_2 0.89
PF00903Glyoxalase 0.89
PF12695Abhydrolase_5 0.89
PF08546ApbA_C 0.89
PF03551PadR 0.89
PF02627CMD 0.89

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 112 Family Scaffolds
COG3211Secreted phosphatase, PhoX familyGeneral function prediction only [R] 4.46
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 4.46
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 2.68
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 1.79
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 1.79
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 1.79
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 1.79
COG1893Ketopantoate reductaseCoenzyme transport and metabolism [H] 0.89
COG4803Uncharacterized membrane proteinFunction unknown [S] 0.89
COG45392-hydroxy fatty acid dioxygenase MPO1 (alpha-oxidation of fatty acids)Lipid transport and metabolism [I] 0.89
COG3865Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferaseGeneral function prediction only [R] 0.89
COG3769Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamilyCarbohydrate transport and metabolism [G] 0.89
COG3753Uncharacterized conserved protein YidB, DUF937 familyFunction unknown [S] 0.89
COG3590Predicted metalloendopeptidasePosttranslational modification, protein turnover, chaperones [O] 0.89
COG3547TransposaseMobilome: prophages, transposons [X] 0.89
COG2764Zn-dependent glyoxalase, PhnB familyEnergy production and conversion [C] 0.89
COG2217Cation-transporting P-type ATPaseInorganic ion transport and metabolism [P] 0.89
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 0.89
COG1877Trehalose-6-phosphate phosphataseCarbohydrate transport and metabolism [G] 0.89
COG1874Beta-galactosidase GanACarbohydrate transport and metabolism [G] 0.89
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.89
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.89
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.89
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 0.89
COG0561Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatasesCoenzyme transport and metabolism [H] 0.89
COG0560Phosphoserine phosphataseAmino acid transport and metabolism [E] 0.89
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 0.89


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms71.43 %
UnclassifiedrootN/A28.57 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090014|GPIPI_16832303All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp.1290Open in IMG/M
3300000363|ICChiseqgaiiFebDRAFT_14094791Not Available646Open in IMG/M
3300000550|F24TB_10128042All Organisms → cellular organisms → Bacteria812Open in IMG/M
3300000891|JGI10214J12806_12674807Not Available572Open in IMG/M
3300004463|Ga0063356_102158341All Organisms → cellular organisms → Bacteria847Open in IMG/M
3300004463|Ga0063356_102271549All Organisms → cellular organisms → Bacteria → Acidobacteria827Open in IMG/M
3300004480|Ga0062592_100388790All Organisms → cellular organisms → Bacteria1104Open in IMG/M
3300004480|Ga0062592_102434385All Organisms → cellular organisms → Bacteria → Terrabacteria group525Open in IMG/M
3300005289|Ga0065704_10534133All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300005293|Ga0065715_10333041All Organisms → cellular organisms → Bacteria980Open in IMG/M
3300005294|Ga0065705_10625619All Organisms → cellular organisms → Bacteria692Open in IMG/M
3300005332|Ga0066388_105431413All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium646Open in IMG/M
3300005333|Ga0070677_10383929All Organisms → cellular organisms → Bacteria736Open in IMG/M
3300005338|Ga0068868_101850436All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium571Open in IMG/M
3300005340|Ga0070689_100068015All Organisms → cellular organisms → Bacteria2777Open in IMG/M
3300005343|Ga0070687_100263015All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1078Open in IMG/M
3300005343|Ga0070687_101457786All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium HGW-Deltaproteobacteria-22513Open in IMG/M
3300005354|Ga0070675_101989895Not Available536Open in IMG/M
3300005365|Ga0070688_100535903All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium888Open in IMG/M
3300005367|Ga0070667_100786040All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. TBR-22883Open in IMG/M
3300005444|Ga0070694_101696445All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300005454|Ga0066687_10484131Not Available729Open in IMG/M
3300005456|Ga0070678_100628391All Organisms → cellular organisms → Bacteria961Open in IMG/M
3300005546|Ga0070696_101992062All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Limnoglobus → Limnoglobus roseus504Open in IMG/M
3300005563|Ga0068855_101124282All Organisms → cellular organisms → Bacteria820Open in IMG/M
3300005617|Ga0068859_100294910Not Available1715Open in IMG/M
3300005718|Ga0068866_10900137All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300005842|Ga0068858_101505517Not Available664Open in IMG/M
3300005842|Ga0068858_101762854Not Available612Open in IMG/M
3300005843|Ga0068860_102019234Not Available598Open in IMG/M
3300005844|Ga0068862_101488002All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300005937|Ga0081455_10045649All Organisms → cellular organisms → Bacteria3810Open in IMG/M
3300006195|Ga0075366_10280069All Organisms → cellular organisms → Bacteria1019Open in IMG/M
3300006237|Ga0097621_100147170All Organisms → cellular organisms → Bacteria → Acidobacteria2017Open in IMG/M
3300006358|Ga0068871_101655556Not Available606Open in IMG/M
3300006577|Ga0074050_11285215Not Available643Open in IMG/M
3300006845|Ga0075421_100124544All Organisms → cellular organisms → Bacteria3233Open in IMG/M
3300006852|Ga0075433_11050928All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium709Open in IMG/M
3300006852|Ga0075433_11943797Not Available504Open in IMG/M
3300006871|Ga0075434_102367332Not Available533Open in IMG/M
3300006914|Ga0075436_100428457Not Available961Open in IMG/M
3300006969|Ga0075419_10187482All Organisms → cellular organisms → Bacteria1365Open in IMG/M
3300007004|Ga0079218_13054587All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300009100|Ga0075418_12376980All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300009147|Ga0114129_10104109All Organisms → cellular organisms → Bacteria3922Open in IMG/M
3300009147|Ga0114129_12335185All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300009156|Ga0111538_10859210All Organisms → cellular organisms → Bacteria1149Open in IMG/M
3300009162|Ga0075423_12249601All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300010362|Ga0126377_10869069All Organisms → cellular organisms → Bacteria963Open in IMG/M
3300010362|Ga0126377_11967265All Organisms → cellular organisms → Bacteria → Acidobacteria660Open in IMG/M
3300010366|Ga0126379_11249086All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300010366|Ga0126379_11558659All Organisms → cellular organisms → Bacteria766Open in IMG/M
3300010366|Ga0126379_12616150All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300010366|Ga0126379_12887067All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300010400|Ga0134122_11578339All Organisms → cellular organisms → Bacteria → Acidobacteria679Open in IMG/M
3300010400|Ga0134122_11725527Not Available655Open in IMG/M
3300010403|Ga0134123_11517495All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300011119|Ga0105246_10693879Not Available891Open in IMG/M
3300012895|Ga0157309_10329210All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium525Open in IMG/M
3300012897|Ga0157285_10382262All Organisms → cellular organisms → Bacteria → Proteobacteria502Open in IMG/M
3300012899|Ga0157299_10161094All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium643Open in IMG/M
3300012906|Ga0157295_10185650Not Available652Open in IMG/M
3300012948|Ga0126375_10012027All Organisms → cellular organisms → Bacteria3710Open in IMG/M
3300012958|Ga0164299_10125639All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1379Open in IMG/M
3300012988|Ga0164306_11576399All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300014318|Ga0075351_1131764All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300014326|Ga0157380_10222875All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1688Open in IMG/M
3300014326|Ga0157380_10802482All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium958Open in IMG/M
3300015200|Ga0173480_10554419Not Available698Open in IMG/M
3300015371|Ga0132258_10329291All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3769Open in IMG/M
3300016357|Ga0182032_11115115All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300016371|Ga0182034_11480833Not Available594Open in IMG/M
3300016445|Ga0182038_12153344Not Available506Open in IMG/M
3300018072|Ga0184635_10390693Not Available528Open in IMG/M
3300018481|Ga0190271_10706228All Organisms → cellular organisms → Bacteria → Proteobacteria1131Open in IMG/M
3300021090|Ga0210377_10064094All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales2513Open in IMG/M
3300021363|Ga0193699_10490389All Organisms → cellular organisms → Bacteria → Proteobacteria502Open in IMG/M
3300021559|Ga0210409_10368595All Organisms → cellular organisms → Bacteria1289Open in IMG/M
3300021560|Ga0126371_13335928All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300022756|Ga0222622_11316651All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300025926|Ga0207659_11196449All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300025927|Ga0207687_10150426All Organisms → cellular organisms → Bacteria → Acidobacteria1776Open in IMG/M
3300025961|Ga0207712_10528935All Organisms → cellular organisms → Bacteria1012Open in IMG/M
3300026023|Ga0207677_10500062All Organisms → cellular organisms → Bacteria1051Open in IMG/M
3300026023|Ga0207677_11306234Not Available666Open in IMG/M
3300026075|Ga0207708_10310008All Organisms → cellular organisms → Bacteria1286Open in IMG/M
3300026095|Ga0207676_12532313Not Available510Open in IMG/M
3300026121|Ga0207683_11945736Not Available536Open in IMG/M
3300027821|Ga0209811_10243140Not Available686Open in IMG/M
3300027880|Ga0209481_10768365Not Available501Open in IMG/M
3300027886|Ga0209486_10836380All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300028380|Ga0268265_11355889All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300028380|Ga0268265_12496204Not Available523Open in IMG/M
3300031226|Ga0307497_10172125Not Available917Open in IMG/M
3300031562|Ga0310886_10623681All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300031679|Ga0318561_10317028Not Available854Open in IMG/M
3300031716|Ga0310813_10207731All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_2_20CM_2_71_61609Open in IMG/M
3300031719|Ga0306917_11049302All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300031858|Ga0310892_10409445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria885Open in IMG/M
3300031879|Ga0306919_11533429Not Available501Open in IMG/M
3300031892|Ga0310893_10497303All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300031896|Ga0318551_10547068Not Available666Open in IMG/M
3300031908|Ga0310900_10448224All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium992Open in IMG/M
3300031911|Ga0307412_11389424All Organisms → cellular organisms → Bacteria → Proteobacteria635Open in IMG/M
3300031940|Ga0310901_10459432All Organisms → cellular organisms → Bacteria → Terrabacteria group564Open in IMG/M
3300031941|Ga0310912_10730918All Organisms → cellular organisms → Bacteria → Acidobacteria766Open in IMG/M
3300032003|Ga0310897_10505973All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300032075|Ga0310890_11204620All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300032180|Ga0307471_102350684Not Available673Open in IMG/M
3300032180|Ga0307471_103830723All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium532Open in IMG/M
3300032180|Ga0307471_104032591Not Available519Open in IMG/M
3300033412|Ga0310810_10088789All Organisms → cellular organisms → Bacteria3708Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil10.71%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere10.71%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil7.14%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere7.14%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil6.25%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.46%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.57%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere3.57%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.57%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.68%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.68%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.68%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.79%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.79%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.79%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.79%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.79%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.79%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.79%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.89%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.89%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.89%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.89%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.89%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.89%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.89%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.89%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.89%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.89%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.89%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.89%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090014Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006195Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006577Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012895Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2EnvironmentalOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300014318Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rdEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300021090Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redoEnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031911Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1Host-AssociatedOpen in IMG/M
3300031940Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPIPI_014282202088090014SoilMSISSTVVDRAEIRFHAAAPALQPYVGCFWVISAQCGATVRIVPDGTTSIA
ICChiseqgaiiFebDRAFT_1409479113300000363SoilMSISSTLVDRAEIRFHEAAESLRSHVGCFWVVIAERDAMIRVVPDGSTAIS
F24TB_1012804213300000550SoilMSISSTRVQCAEIRFHEAADALRPFVGCFWVVTTTRRATIRVVPDGTTAISIQLQKSQAPEWFLRG
JGI10214J12806_1267480723300000891SoilMSVTSTLVHRAETRFVEAAAPLRPYVGCFWVITADRGARIQIVPDASTSVSIELRNGRPSAWFLRG
Ga0063356_10215834123300004463Arabidopsis Thaliana RhizosphereMSITGTLVHRAEIRFREAADVLRPHVGCFWVITAEQDATIRVVPDASTAISIQLQNGRPSEWFLRG
Ga0063356_10227154913300004463Arabidopsis Thaliana RhizosphereMSITSTVVYRAETRFIEAVDALRPYVGCFWVITAKRGAMIRVVPDT
Ga0062592_10038879013300004480SoilMSITSTVVDGADSEFIQAADVLRPFVGCFWVITAQRGATIRVVPDGTTSISIELR
Ga0062592_10243438513300004480SoilMSISSTLVDRAEIRFHEAPAALRAFVGCFWVVTAEAGAMIRVVPDGSAAISIQLDDIEVAGWVLR
Ga0065704_1053413313300005289Switchgrass RhizosphereMSISSTLFDRAEIRFQPAADVLHPFVGCFWIITAEPGSTIRVVPDSSTAIAIQFQ
Ga0065715_1033304123300005293Miscanthus RhizosphereMSISSTVVHRAEIRFQEAAEGLQSFVGCFWVITAERSATIRMVPDGS
Ga0065705_1062561923300005294Switchgrass RhizosphereMSISSTLFDRAEIRFQPAADVLHPYVGCFWIITAEPDSTIRVVPDSSTAIAIQFQNDRKSEWL
Ga0066388_10543141313300005332Tropical Forest SoilMSISSTVVHRAEIRFHEATEVLRPFVGCFWVVTAEQDATIRAVPDG
Ga0070677_1038392913300005333Miscanthus RhizosphereMSISSTLVDRAEIEFHEAAEPLRPFVGCFWVMTAQRDATIRVVPDGSTAISIQLQKGHTAEWSL
Ga0068868_10185043613300005338Miscanthus RhizosphereMSITSTVVDRAESRFIEAADVLRPFVGCFWIITAERGATIRVVPDASTAISVQLQDDWSPGWVLR
Ga0070689_10006801513300005340Switchgrass RhizosphereVSITSTLVHRAEIRFHEAADVLRPYVGCFWVITAERDATLRI
Ga0070687_10026301513300005343Switchgrass RhizosphereVSITSTLVHRAEIRFHEAADVLRPYVGCFWVITAERDATLRIVPDGSTSISIELQGR
Ga0070687_10145778613300005343Switchgrass RhizosphereMSISSTLVERAEIRFHEAAEALRDHVGCFWVVTAEQDGLLRVV
Ga0070675_10198989513300005354Miscanthus RhizosphereMSISSTLVDRAEIEFHEAAEPLRPFVGCFWVVTAQPDASIRVVPDGSTSISIQLQQGHSAEW
Ga0070688_10053590313300005365Switchgrass RhizosphereMSITSTVVDRAESRFIEAADVLRPFVGCFWIITAEQGATIRVVPDGST
Ga0070667_10078604023300005367Switchgrass RhizosphereVSITSTVVHRAEIQFHEAAEALRPYVGCFWVATAERDATIRVVPDGSTAISIELQKGRP
Ga0070694_10169644523300005444Corn, Switchgrass And Miscanthus RhizosphereMSISSTVVHRAEIRFQEAAEGLQSFVGCFWVITAERSATIRMVPDGSTAISIQLQNG
Ga0066687_1048413133300005454SoilMSILSTHVQRAEIRFHEAAEPLRAAVGCFWVVTAERGAVLRMVPDGSTAISIGFQS
Ga0070678_10062839113300005456Miscanthus RhizosphereMSISSTLVDRAQIQFHEAAEALRPFVGCFWVITAEQGATIRVVPDGS
Ga0070696_10199206223300005546Corn, Switchgrass And Miscanthus RhizosphereMSVTGTVVDSAETRFVEAAAVLQPYVGCFWVITAQRGATIRVVPDGS
Ga0068855_10112428213300005563Corn RhizosphereMSISSTVVDRAEIKFHEATDVLRPFVGCFWVVTAEQDAT
Ga0068859_10029491013300005617Switchgrass RhizosphereMSITSTVVHRAESRFIEAADVLRPFVGCFWIITAEQGATIRVVPDGSTAI
Ga0068866_1090013713300005718Miscanthus RhizosphereMSISSTLVHRAEIEFHEAAEPLRPFVGCFWVMTAQRDATIRVVPDGST
Ga0068858_10150551713300005842Switchgrass RhizosphereVSITSTLVDRAELRFHEAADVLRPYVGCFWVITAERDATIRIVPDASTAISIELQGRPS
Ga0068858_10176285423300005842Switchgrass RhizosphereVSITSTLVHRAEIRFHEAADVLRPYVGCFWVITAEG
Ga0068860_10201923413300005843Switchgrass RhizosphereMSVGSTLVRGAEIRFQKAAEQLRPFVGCFWVITADRG
Ga0068862_10148800213300005844Switchgrass RhizosphereMSITSTLVHRAEIQFHQAADVLRPYVGCFWVITADPDATIRIVPDASTSISVELQGRPAE
Ga0081455_1004564953300005937Tabebuia Heterophylla RhizosphereMTTITSTVVHQAEIRFREADVALRPYVGCFWVISAEQDATIRIVPDGGTSISTDLPNGRSSG
Ga0075366_1028006933300006195Populus EndosphereMSISSTLVQRAQIRFHEPADALRPFVGCFWVLTAERGAA
Ga0097621_10014717023300006237Miscanthus RhizosphereMSITSTLVERAEIQFREADAALRPFVGCFWTITAQPNA
Ga0068871_10165555623300006358Miscanthus RhizosphereMSITSTLVERAEIQFREADAALRPFVGCFWTITAQP
Ga0074050_1128521513300006577SoilVSITSTVVQGAETRFIEAADVLRPFVGCFWIITADRGATIRVV
Ga0075421_10012454453300006845Populus RhizosphereMSISSTLVERAQIGFHEAAEPLRAFVGCFWVITAERDAVLRVVPDGSTTISILLQQDQ
Ga0075433_1105092813300006852Populus RhizosphereMSITSTIVHRAEIRFHEAADVLRPFVGCFWVVTADRGATI
Ga0075433_1194379723300006852Populus RhizosphereMSITSTVVQRAEIQFLEAPEALRRFVGCFWVVTADRDATIR
Ga0075434_10236733223300006871Populus RhizosphereMSITSTVVQRAEIQFLEAPEALRRFVGCFWAVTADRDATIRIVPDATTSIS
Ga0075436_10042845713300006914Populus RhizosphereMSISSTLVHGAEIRFQEAADALRPYVGCFWVIRAERDAIIRVVPDGT
Ga0075419_1018748213300006969Populus RhizosphereMSVTSTVVDRVETRFVEAAAPLRPYVGCFWVITAERGARIQIVPDASTSISIELRRDRSSGWFL
Ga0079218_1305458723300007004Agricultural SoilMSISSTLVDRAEIEFHEAAGPLRPFVGCFWVMTAQRDATIRVV
Ga0075418_1237698023300009100Populus RhizosphereMSISSTLVHRAEIRFVEAAVPLRPFVGCFWVVTAKQDSTIRVVPDG
Ga0114129_1010410983300009147Populus RhizosphereMSVTSTVVDRVETRFVEAAAPLRPYVGCFWVITAERGARIQIVPDAS
Ga0114129_1233518523300009147Populus RhizosphereMSISSTLVHRAEIAFHEAAEPLRPFVGCFWVVTAQSDATIRVVPD
Ga0111538_1085921033300009156Populus RhizosphereMSITSTVIDGADTRFIEAADVLRPYVGCFWVITANRGATIRVVPDASTSISLE
Ga0075423_1224960113300009162Populus RhizosphereMSITGTVVDSAETRFVEAAAVLQPYVGCFWVITAQRGATIRVVPDGSTAIFVERRENRS
Ga0126377_1086906913300010362Tropical Forest SoilMSISSTAVDRAEIRFHEATEVLRPFVGCFWVVTAEHGATIR
Ga0126377_1196726523300010362Tropical Forest SoilMSITSTVVSRAETRFIEAVDALRPYVGCFWVITAQR
Ga0126379_1124908623300010366Tropical Forest SoilMSISTTLVDRAEIRFQEAANALRPYVGCFWVLTAECGATIRVVPDGTAAISI
Ga0126379_1155865923300010366Tropical Forest SoilMTTIASTVVNHAEIRFREAAVALRPYVGCFWVITAERDAMIRMVPDGTTSISAELEDRRTQD
Ga0126379_1261615023300010366Tropical Forest SoilMSISSTLIDRAEIRFEEAATELRPYVGCFWVVTAERGATIHVVPDGTTAISVQLQ
Ga0126379_1288706713300010366Tropical Forest SoilMSITSTLVRRAEIRFHEAADVLRPFVGCFWVVTAERDATIRVVPD
Ga0134122_1157833913300010400Terrestrial SoilMSSISTTLLERAEIRFQEAADALRRYVGCFWVVTAESDATIRVVP
Ga0134122_1172552723300010400Terrestrial SoilMSITSTIVHHAEIRFHEATEALRPFVGCFWVVTAERDAMLRVVPDGSTSISIQLQDRGAS
Ga0134123_1151749513300010403Terrestrial SoilMSISSTVVHRADIRFHEAADALRPFVGCFWVMTAQRDATIRLVADGSTTISIQLQS
Ga0105246_1069387913300011119Miscanthus RhizosphereMSISSTLVDRAEIEFHEAAEPLRPFVGCFWVMSAQRDATIRVVPDGSTAISIQLQKGHTAEWL
Ga0157309_1032921013300012895SoilMSITSTVVDRAESRFIEAADVLRPFVGCFWIITAERGATIRVVPDASTAISVQ
Ga0157285_1038226213300012897SoilMSISSTLVDRAEIEFHEAAEPLRPFVGCFWVMTAQREATIRVVPDGSTAISIQ
Ga0157299_1016109413300012899SoilMSISSTLVDRADIRFHEAAGALQPFVGCFWVVTAERGATIRVVPD
Ga0157295_1018565013300012906SoilMSISSTLVDRAEIEFHEAAEPLRPFVGCFWVMTAQRDAKIRV
Ga0126375_1001202753300012948Tropical Forest SoilMTTITSTVVHQAEIKFREADVALRPYVGCFWVISAERDATIRIVPDGSTSISTELRNGRSSGW
Ga0164299_1012563923300012958SoilMSISSTLVQGADIRFQEAAHVLRPHVGCFWVITAAKGAVIRAVPDGSTAISIQLQNDGRTEWSLR
Ga0164306_1157639913300012988SoilMSISSTAVHRAEIKFHEATEVLRPFVGCFWVVTAEQGATIRAVPDGS
Ga0075351_113176423300014318Natural And Restored WetlandsVSVTSTVVDRAETRFIKADEALQPYVGCFWVITVERGATIRVVPDGTTSIS
Ga0157380_1022287533300014326Switchgrass RhizosphereMSISSTFVDRAEIRFHEAAGALQPFVGCFWVVTAERGATIRVVPDGSTAISIQ
Ga0157380_1080248213300014326Switchgrass RhizosphereMSITSTVVDRAESRFIEAADVLRPFVGCFWIITAERGATIR
Ga0173480_1055441913300015200SoilMSIISTVVHRAEIRFHEAAEALRPYVGCFWVVTADQDATIHVVPDGSTAISIELRQGWRS
Ga0132258_1032929113300015371Arabidopsis RhizosphereMSITSTVVHRAESRFIEAADVLRSFVGCFWIITAERGATMRVVPDGSTAISVQLQDDGRSGWSL
Ga0182032_1111511513300016357SoilMSITSTVVRQAEIQFREAAAGLQPYVGCFWTISAERDATIRIVPDLSTSISTELTNG
Ga0182034_1148083313300016371SoilMSVTSTSVHRAQTRFIQATDELRPYVGCFWIVTAEQGATLRIVPDGTTSISIELRQHSSS
Ga0182038_1215334423300016445SoilMSISSTLVDRAQIEFREAAEALRPFVGCFWVITAERGGTIRVVPDGSTAIFI
Ga0184635_1039069323300018072Groundwater SedimentMSITSTLVHRAEIQFHQAADVLRPYVGCFWVITAERDATIRIVPDASTAISV
Ga0190271_1070622813300018481SoilMSISSTVVDRADIRFHVATAALQPYVGCFWVITAQCGSTVRVVPDGTTSI
Ga0210377_1006409413300021090Groundwater SedimentMSISSTVVDRADIRFHAAAPALLPYVGCFWVITAECGATVRV
Ga0193699_1049038913300021363SoilMSVGSTLVRGAEIRFQEAAEKLRPFVGCFWVITANG
Ga0210409_1036859533300021559SoilMSISSTLVHGAEIRFQEAADALRPYVGCFWVITAERDAIIRVVPDGSTAISIQLQKTRPAGWS
Ga0126371_1333592813300021560Tropical Forest SoilMTISSTHIDRADIQFQQAADALKPFTGCFWTVTAERGATIRIVPDGTAAVG
Ga0222622_1131665113300022756Groundwater SedimentMSITSTLVHRAEIRFHQAAEVLRPYVGCFWVITAERDATIRI
Ga0207659_1119644913300025926Miscanthus RhizosphereMSISSTLVDRAEIEFHEAAEPLRPFVGCFWVMTAQRDATIRVVPDGSTAISIQLQKGHTA
Ga0207687_1015042613300025927Miscanthus RhizosphereMSISSTLVDRAQIQFHEAAEALRPFVGCFWVITAEQGATIRVVPDGSTAISLQLQEGLPS
Ga0207712_1052893533300025961Switchgrass RhizosphereMSISSTLVDRAQIQFHEAAEALRPFVGCFWVITAEQGATIRVVPDGST
Ga0207677_1050006213300026023Miscanthus RhizosphereMSISSTVVHRAEIRFQEAAEGLQSFVGCFWVITAERSATIRMVPDGSTAISIQL
Ga0207677_1130623413300026023Miscanthus RhizosphereMSITSTVVDRAESRFIEAADVLRPFVGCFWIITAERGATIRVVPDASTAISVQLQDDWSPGWVLRSP
Ga0207708_1031000813300026075Corn, Switchgrass And Miscanthus RhizosphereMSITGTVVDSAETRFVEAAAVLQPYVGCFWVITAQRG
Ga0207676_1253231313300026095Switchgrass RhizosphereMSITSTVVDRAESRFIEAADVLRPFVGCFWIITAERG
Ga0207683_1194573613300026121Miscanthus RhizosphereMSISSTLVDRAQIQFHEAAEALRPFVGCFWVITAEQGATIR
Ga0209811_1024314023300027821Surface SoilVSITSTVVHRAEIRFHEAADVLRPYVGCFWVITAERDATIRIVPDGSTAISV
Ga0209481_1076836523300027880Populus RhizosphereMSISSTLVHRADIQFHEAVEALRPFVGCFWVVTAQRGATIR
Ga0209486_1083638013300027886Agricultural SoilMSISSTLVDRAEIEFHEAHDALRPFVGCFWVITAQPDATIRVVPDGSTAISI
Ga0268265_1135588913300028380Switchgrass RhizosphereMSISSTLVHRAEIAFHEADEPLRPFVGCFWVVTAQPDASIRVVPDGSTSISIQLQQGHS
Ga0268265_1249620413300028380Switchgrass RhizosphereMSITSTLVHRAEIQFHQAADVLRPYVGCFWVITADPDATIRIVPDASTSISVELQGQPAEWL
Ga0307497_1017212523300031226SoilMSISSTLVDRAEIEFHEAAEPLRPFVGCFWVMTAQRDATIRVVPDGSTAISIQLE
Ga0310886_1062368113300031562SoilMSITSTVIDGADTRFIEAADVLRPYVGCFWVITANRGATIRVVPDASTSISLEVRTGWSS
Ga0318561_1031702813300031679SoilMSVTSTSVHRAQTRFIQATDELRPYVGCFWIVTAEQGATLRIVPDGTTSISIELRQHSSSDWVLRGPLLKPAVRRFP
Ga0310813_1020773123300031716SoilMSISSTLVDRAEIRFHEAPAALRAFVGCFWVVTAEAGAMIRVVPDGSAAISIQLDDIEVARW
Ga0306917_1104930213300031719SoilMTISSTRMDRAPIRFQEAPDALRPYVGCFWIVTPKAGARIRVVPDGTTAIFAEL
Ga0310892_1040944533300031858SoilMSITSTLIDGADIRFREAADVLRPYVGCFWVITAQRGATIRVVPDGSTAISIR
Ga0306919_1153342913300031879SoilMSVTSTSVHRAQTRFIQATDELRPYVGCFWIVTAEQGATLRIVPDGTTSISIELRQHSSSDWVL
Ga0310893_1049730313300031892SoilMSISSTLIDRAEIRFQPSADVLHPFVGCFWVITAEPDSTIRVI
Ga0318551_1054706813300031896SoilMSVTSTSVHRAQTRFIQATDELRPYVGCFWIVTAEQGATLRIVPDGTTSISIELRQHSSSDWV
Ga0310900_1044822413300031908SoilMEEVSDMSVTSTVVHRAETRFVEAAAPLRPYVGCFWVITADRGARVQIVPDASTSVSIELRNGRPSAWFLR
Ga0307412_1138942423300031911RhizosphereMSISSTVLDRADIRFHAAIPVLQPYVGCFWVITAERGATMRTVPDGTTSIAF
Ga0310901_1045943223300031940SoilLSISSTLVDRAEIRFHEAPAALRAFVGCFWVVTAEAGAMIRVVPD
Ga0310912_1073091813300031941SoilMSISSTLVDRAQIEFREAAEALRPFVGCFWVITAE
Ga0310897_1050597323300032003SoilMSISSTLVDRAEIEFHEAAEPLRPFVGCFWVMTAQRDATIRVVPDGSTA
Ga0310890_1120462013300032075SoilMSISSTLVDRAEIEFHEAAEPLRPFVGCFWVMTAKRDATI
Ga0307471_10235068413300032180Hardwood Forest SoilMSISSTLVHGADIRFQEAADALRPYVGCFWVITADRDAIIRVVPDGTTAISIQ
Ga0307471_10383072323300032180Hardwood Forest SoilMSISSTLVQGADIRFVEAASALRSHVGCFWIITAERGAFMRIV
Ga0307471_10403259123300032180Hardwood Forest SoilMSISSTFVRGAEIRFHEAADALRPFVGCFWVVTAERDATIRVVPDGSTAISIQLQG
Ga0310810_1008878943300033412SoilMTITSTVVERAETRFIEAAEALRPFVGCFWVISAAQGALIR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.