| Basic Information | |
|---|---|
| Family ID | F084424 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 112 |
| Average Sequence Length | 43 residues |
| Representative Sequence | VISRQKIVGWILIVVSAAYIAYFLRVRLFTPGPILENKEWVQ |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 88.39 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 91.96 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (55.357 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.214 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.250 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.107 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.00% β-sheet: 0.00% Coil/Unstructured: 60.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF00291 | PALP | 53.57 |
| PF13356 | Arm-DNA-bind_3 | 6.25 |
| PF00697 | PRAI | 1.79 |
| PF13620 | CarboxypepD_reg | 0.89 |
| PF00275 | EPSP_synthase | 0.89 |
| PF03734 | YkuD | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG0135 | Phosphoribosylanthranilate isomerase | Amino acid transport and metabolism [E] | 1.79 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.89 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 67.86 % |
| Unclassified | root | N/A | 32.14 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2067725001|GPWNP_F5MPXY301BVTA5 | Not Available | 503 | Open in IMG/M |
| 2124908045|KansclcFeb2_ConsensusfromContig552888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 828 | Open in IMG/M |
| 3300002073|JGI24745J21846_1004712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1468 | Open in IMG/M |
| 3300002155|JGI24033J26618_1038386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 662 | Open in IMG/M |
| 3300002911|JGI25390J43892_10108444 | Not Available | 627 | Open in IMG/M |
| 3300005181|Ga0066678_11074169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium | 519 | Open in IMG/M |
| 3300005184|Ga0066671_10519824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 765 | Open in IMG/M |
| 3300005332|Ga0066388_100753378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1573 | Open in IMG/M |
| 3300005332|Ga0066388_101612838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1142 | Open in IMG/M |
| 3300005332|Ga0066388_101622394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1140 | Open in IMG/M |
| 3300005332|Ga0066388_104987270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 675 | Open in IMG/M |
| 3300005435|Ga0070714_100118279 | All Organisms → cellular organisms → Bacteria | 2354 | Open in IMG/M |
| 3300005546|Ga0070696_101348628 | Not Available | 607 | Open in IMG/M |
| 3300005713|Ga0066905_101338719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 646 | Open in IMG/M |
| 3300005764|Ga0066903_100483735 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2088 | Open in IMG/M |
| 3300005764|Ga0066903_104742467 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 723 | Open in IMG/M |
| 3300005764|Ga0066903_106968534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 586 | Open in IMG/M |
| 3300005937|Ga0081455_10656295 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 675 | Open in IMG/M |
| 3300006046|Ga0066652_100217416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1654 | Open in IMG/M |
| 3300006049|Ga0075417_10562252 | Not Available | 577 | Open in IMG/M |
| 3300006196|Ga0075422_10245564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 751 | Open in IMG/M |
| 3300006605|Ga0074057_10032497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 634 | Open in IMG/M |
| 3300006953|Ga0074063_10119872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 823 | Open in IMG/M |
| 3300006953|Ga0074063_13674119 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 801 | Open in IMG/M |
| 3300006954|Ga0079219_11888551 | Not Available | 563 | Open in IMG/M |
| 3300006969|Ga0075419_10382424 | All Organisms → cellular organisms → Eukaryota | 962 | Open in IMG/M |
| 3300009143|Ga0099792_10770207 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 628 | Open in IMG/M |
| 3300009147|Ga0114129_12383316 | Not Available | 634 | Open in IMG/M |
| 3300009545|Ga0105237_11419237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 701 | Open in IMG/M |
| 3300009792|Ga0126374_10375532 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 984 | Open in IMG/M |
| 3300010048|Ga0126373_11674436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 700 | Open in IMG/M |
| 3300010301|Ga0134070_10020139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2166 | Open in IMG/M |
| 3300010358|Ga0126370_10357932 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 1182 | Open in IMG/M |
| 3300010358|Ga0126370_10948628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 781 | Open in IMG/M |
| 3300010362|Ga0126377_12807516 | Not Available | 561 | Open in IMG/M |
| 3300010376|Ga0126381_100516234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium guangdongense | 1688 | Open in IMG/M |
| 3300010868|Ga0124844_1069511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1293 | Open in IMG/M |
| 3300010868|Ga0124844_1069512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1293 | Open in IMG/M |
| 3300010868|Ga0124844_1071566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1278 | Open in IMG/M |
| 3300012189|Ga0137388_11786942 | Not Available | 547 | Open in IMG/M |
| 3300012198|Ga0137364_10530343 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 886 | Open in IMG/M |
| 3300012201|Ga0137365_10793763 | Not Available | 691 | Open in IMG/M |
| 3300012356|Ga0137371_11440725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 503 | Open in IMG/M |
| 3300012903|Ga0157289_10227075 | Not Available | 624 | Open in IMG/M |
| 3300012907|Ga0157283_10283764 | Not Available | 567 | Open in IMG/M |
| 3300012915|Ga0157302_10045518 | All Organisms → cellular organisms → Bacteria | 1220 | Open in IMG/M |
| 3300012923|Ga0137359_10711581 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 874 | Open in IMG/M |
| 3300012988|Ga0164306_11491594 | Not Available | 579 | Open in IMG/M |
| 3300015200|Ga0173480_10181749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1099 | Open in IMG/M |
| 3300016270|Ga0182036_10625556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 865 | Open in IMG/M |
| 3300016294|Ga0182041_10574772 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 987 | Open in IMG/M |
| 3300016294|Ga0182041_12332258 | Not Available | 501 | Open in IMG/M |
| 3300016341|Ga0182035_10476639 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 1062 | Open in IMG/M |
| 3300016371|Ga0182034_11773060 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 544 | Open in IMG/M |
| 3300016422|Ga0182039_10758784 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 859 | Open in IMG/M |
| 3300016445|Ga0182038_10895309 | Not Available | 782 | Open in IMG/M |
| 3300018429|Ga0190272_13261333 | Not Available | 506 | Open in IMG/M |
| 3300018476|Ga0190274_13189362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium etli → Rhizobium etli CNPAF512 | 552 | Open in IMG/M |
| 3300021081|Ga0210379_10283415 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 723 | Open in IMG/M |
| 3300021178|Ga0210408_10242393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1435 | Open in IMG/M |
| 3300021444|Ga0213878_10573548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium etli → Rhizobium etli CNPAF512 | 500 | Open in IMG/M |
| 3300025223|Ga0207672_1009374 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300025898|Ga0207692_10887802 | Not Available | 586 | Open in IMG/M |
| 3300025907|Ga0207645_10616655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 737 | Open in IMG/M |
| 3300025960|Ga0207651_11543896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 598 | Open in IMG/M |
| 3300026325|Ga0209152_10402504 | Not Available | 537 | Open in IMG/M |
| 3300026548|Ga0209161_10390286 | Not Available | 613 | Open in IMG/M |
| 3300027010|Ga0207839_1042385 | Not Available | 515 | Open in IMG/M |
| 3300027050|Ga0209325_1046824 | Not Available | 524 | Open in IMG/M |
| 3300027874|Ga0209465_10009798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4245 | Open in IMG/M |
| 3300027909|Ga0209382_10163967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2567 | Open in IMG/M |
| 3300028708|Ga0307295_10135355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 679 | Open in IMG/M |
| 3300028711|Ga0307293_10065659 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 1137 | Open in IMG/M |
| 3300028744|Ga0307318_10201659 | Not Available | 688 | Open in IMG/M |
| 3300028754|Ga0307297_10231528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 653 | Open in IMG/M |
| 3300028768|Ga0307280_10240069 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 649 | Open in IMG/M |
| 3300028875|Ga0307289_10036333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1951 | Open in IMG/M |
| 3300030336|Ga0247826_11466067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 553 | Open in IMG/M |
| 3300031198|Ga0307500_10034302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1164 | Open in IMG/M |
| 3300031231|Ga0170824_115691220 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 706 | Open in IMG/M |
| 3300031543|Ga0318516_10181277 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 1213 | Open in IMG/M |
| 3300031543|Ga0318516_10533142 | Not Available | 672 | Open in IMG/M |
| 3300031545|Ga0318541_10712052 | Not Available | 560 | Open in IMG/M |
| 3300031546|Ga0318538_10620715 | Not Available | 586 | Open in IMG/M |
| 3300031549|Ga0318571_10363808 | Not Available | 557 | Open in IMG/M |
| 3300031561|Ga0318528_10234037 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 984 | Open in IMG/M |
| 3300031680|Ga0318574_10333383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 883 | Open in IMG/M |
| 3300031681|Ga0318572_10444143 | Not Available | 772 | Open in IMG/M |
| 3300031682|Ga0318560_10416765 | Not Available | 727 | Open in IMG/M |
| 3300031724|Ga0318500_10537232 | Not Available | 589 | Open in IMG/M |
| 3300031765|Ga0318554_10391942 | Not Available | 788 | Open in IMG/M |
| 3300031770|Ga0318521_10358864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 865 | Open in IMG/M |
| 3300031778|Ga0318498_10020529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2792 | Open in IMG/M |
| 3300031793|Ga0318548_10283256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 814 | Open in IMG/M |
| 3300031797|Ga0318550_10349373 | Not Available | 716 | Open in IMG/M |
| 3300031821|Ga0318567_10860280 | Not Available | 513 | Open in IMG/M |
| 3300031821|Ga0318567_10889079 | Not Available | 504 | Open in IMG/M |
| 3300031833|Ga0310917_10039978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2827 | Open in IMG/M |
| 3300031833|Ga0310917_10837046 | Not Available | 620 | Open in IMG/M |
| 3300031896|Ga0318551_10258254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 974 | Open in IMG/M |
| 3300031910|Ga0306923_11126605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 843 | Open in IMG/M |
| 3300031946|Ga0310910_10006148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 7223 | Open in IMG/M |
| 3300032001|Ga0306922_10108299 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2946 | Open in IMG/M |
| 3300032051|Ga0318532_10085329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1107 | Open in IMG/M |
| 3300032059|Ga0318533_10247856 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1285 | Open in IMG/M |
| 3300032063|Ga0318504_10142321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1100 | Open in IMG/M |
| 3300032076|Ga0306924_11644701 | Not Available | 675 | Open in IMG/M |
| 3300032090|Ga0318518_10499052 | Not Available | 623 | Open in IMG/M |
| 3300032180|Ga0307471_103448352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium | 560 | Open in IMG/M |
| 3300033811|Ga0364924_144344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium | 559 | Open in IMG/M |
| 3300034690|Ga0364923_0060864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 907 | Open in IMG/M |
| 3300034820|Ga0373959_0205594 | Not Available | 522 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 11.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.25% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.36% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.36% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.68% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.68% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.79% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.79% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.89% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.89% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.89% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2067725001 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Host-Associated | Open in IMG/M |
| 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Host-Associated | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027010 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 64 (SPAdes) | Environmental | Open in IMG/M |
| 3300027050 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033811 | Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17 | Environmental | Open in IMG/M |
| 3300034690 | Sediment microbial communities from East River floodplain, Colorado, United States - 60_j17 | Environmental | Open in IMG/M |
| 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPWNP_00473620 | 2067725001 | Soil | VVISRQKVIGWILIVVSVAYLAYFLRVRLFTPGPILEKKE |
| KansclcFeb2_14648360 | 2124908045 | Soil | VISRQKIVGWILIVVSVAYIAYFLRVRLFTPGPILEN |
| JGI24745J21846_10047121 | 3300002073 | Corn, Switchgrass And Miscanthus Rhizosphere | VISRQKIVGWVLVIVSVGYIAYFLRVRLFAPGPMIE |
| JGI24033J26618_10383862 | 3300002155 | Corn, Switchgrass And Miscanthus Rhizosphere | VISRQKIVGWVLVIVSVGYIAYFLRVRLFAPGPMIEK |
| JGI25390J43892_101084442 | 3300002911 | Grasslands Soil | VIGRQKIVGWILIVVSVAYIAYFLRVRLFTPGPILEKKEWVQFIGSIVILMLGT |
| Ga0066678_110741691 | 3300005181 | Soil | LIGRQKVVGWVLIIVSTTYIVYFLRARLFMPGPIIEKKEWLQL |
| Ga0066671_105198241 | 3300005184 | Soil | VISRQKVVGWSLILVSAGYIGYFLRVRLFEPGPTVASKEWVQLIGS |
| Ga0066388_1007533781 | 3300005332 | Tropical Forest Soil | MLSRQKIVGWILIAVSAAYIAYFLRVRLFIPGPILENKEWV |
| Ga0066388_1016128381 | 3300005332 | Tropical Forest Soil | VISRQKLVGWILIIVSAAFIAYFLRVRLFSPGPILEKKEWVQFIGSIVI |
| Ga0066388_1016223942 | 3300005332 | Tropical Forest Soil | VISRQKLVGWILIIVSAAYIAYFLRVRLFSPGPILEKKEWV |
| Ga0066388_1049872701 | 3300005332 | Tropical Forest Soil | MVISRQQVIGWILIVVSVAYIVYFLRVRLFDAGPIIERKEWVQFIGSFVT |
| Ga0070714_1001182791 | 3300005435 | Agricultural Soil | VISRQKIVGWILIVASVAYITYFLRVRLFTPGPILENKEWVQ |
| Ga0070696_1013486281 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VISRQKIVGWILIVASVAYITYFLRVRLFTPGPILENKEWVQLIGSIV |
| Ga0066905_1013387191 | 3300005713 | Tropical Forest Soil | MPVISRQKIVGWILIVVSVAYIAYFLRVRLFTPGPILENK |
| Ga0066903_1004837354 | 3300005764 | Tropical Forest Soil | MRTVISRQKIVGWILIVVSVAYIAYFLRVRLFTPGPILENKE |
| Ga0066903_1047424672 | 3300005764 | Tropical Forest Soil | VSPPVNTRNVISRQKIVGWILIVVSVAYIAYFLRVRLFTPGPILENKE |
| Ga0066903_1069685341 | 3300005764 | Tropical Forest Soil | VISRQKLVGWILIIVSAAFIAYFLRVRLFSPGPILEKKE |
| Ga0081455_106562951 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VISRQKVVGWILIIVSVAFIVYFLRVRLFSPGPALEKKEWVNFI |
| Ga0066652_1002174163 | 3300006046 | Soil | VISRQKIVGWILIVVSAAYIVYFLRVRLFTPGPILEKKEWVQFIGSIV |
| Ga0075417_105622521 | 3300006049 | Populus Rhizosphere | VISRQKIVGWILIVVSVAYIAYFLRVRLFTPGPILEKKEWVQLISSIVILMLGTI |
| Ga0075422_102455642 | 3300006196 | Populus Rhizosphere | VISRQKIVGWVLVIVSIGYIAYFLRVRLFAPGPMI |
| Ga0074057_100324971 | 3300006605 | Soil | VISRQKIVGWVLVIVSVGYIAYFLRVRLFAPGPMI |
| Ga0074063_101198721 | 3300006953 | Soil | VISRQKIVGWILIAVSAAYIAYFLRVRLFAPGPILENKEWAQFVGS |
| Ga0074063_136741192 | 3300006953 | Soil | LTRQKLIGWILIAMAVAYIAYFLRVRLFEPGPVVEKKE |
| Ga0079219_118885512 | 3300006954 | Agricultural Soil | VISRQKAVGWTLIVVSSAFIVYFLRERLLSPGPALEKKEWV |
| Ga0075419_103824241 | 3300006969 | Populus Rhizosphere | VISRQKLVGWILIVVSAAYIAYFLRVRLFSPGPIL |
| Ga0099792_107702071 | 3300009143 | Vadose Zone Soil | MISRQKVVGWILIIVSIAFIAWFLRVRLLDVGPVVEKKEWVQF |
| Ga0114129_123833162 | 3300009147 | Populus Rhizosphere | VISRQKIVGWILIVVSAAYIAYFLRVRLFTPGPILEKKEWVQLIGSIVILMLGT |
| Ga0105237_114192371 | 3300009545 | Corn Rhizosphere | VVISRQKIVGWALVIVSVAYIAYFLRVRLFAPGPVI |
| Ga0126374_103755321 | 3300009792 | Tropical Forest Soil | VISRQKIVGWILIVVSAAYIAYFLRVRLFTPGPILEKKEWVQLIGSIVIL |
| Ga0126373_116744361 | 3300010048 | Tropical Forest Soil | VISRQKIVGWILIVVSVAYIAYFLRVRLFTPGPILEDKE |
| Ga0134070_100201391 | 3300010301 | Grasslands Soil | MRLSRQKLVGWILIVVSVAYIAYFLRVRLFTPGPILERKEWVQFIGSF |
| Ga0126370_103579321 | 3300010358 | Tropical Forest Soil | VISRQKIVGWILIVASAAYIAYFLRERLFTPGPILEKKEWVQFIGSIV |
| Ga0126370_109486281 | 3300010358 | Tropical Forest Soil | VISRQKIVGWILIVVSIAYIAYFLRVRLFTPGPILENKEWVQFIGSIV |
| Ga0126377_128075161 | 3300010362 | Tropical Forest Soil | VISRQKLVGWILIIVSAAYIAYFLRVRLFSPGPILEKKEWVQFIGSIVILMLGTI |
| Ga0126381_1005162341 | 3300010376 | Tropical Forest Soil | MPVISRQKLVGWILIVVSAAYIAYFLRVRLFTPGPM |
| Ga0124844_10695112 | 3300010868 | Tropical Forest Soil | MQKIVGWILIAVSAAYIAYFLRVRLFTPGPILENKEW |
| Ga0124844_10695122 | 3300010868 | Tropical Forest Soil | VISRQKIVGWILIAVSAAYIAYFLRVRLFTPGPILENKEW |
| Ga0124844_10715662 | 3300010868 | Tropical Forest Soil | VISRQKIVGWILIAVSAAYIAYFLRVRLFSPGPILENKEW |
| Ga0137388_117869421 | 3300012189 | Vadose Zone Soil | LVGWILIVVSVAYLAYFLRVRLLEPGPVLEKKEWVQVIGSIVVFMLGTIN |
| Ga0137364_105303432 | 3300012198 | Vadose Zone Soil | VISRQKIVGWILIVASVAYITYFLRVRLFTPGPILENKEWVQLIGSIVVL |
| Ga0137365_107937632 | 3300012201 | Vadose Zone Soil | VISRQKIVGWILIVVSVAFIAYFLRVRLFTPGPILEKKEWVQFIGSIVI |
| Ga0137371_114407251 | 3300012356 | Vadose Zone Soil | LAVISRQKIVGWILIVVSVAYIAYFLRVRLFASGPV |
| Ga0157289_102270752 | 3300012903 | Soil | VVISRQKIVGWALVIVSVAYIAYFLRVRLFAPGPVIEK |
| Ga0157283_102837641 | 3300012907 | Soil | VISRQKAVGWTLIVVSSAFIVYFLRERLFSPGPVLEKKEWVQ |
| Ga0157302_100455182 | 3300012915 | Soil | VISRQKAVGWTLIVVSSAFIVYFLRERLFSPGPALEKKEWVQFIGSIVIFMLGTA |
| Ga0137359_107115811 | 3300012923 | Vadose Zone Soil | MRTVISRQKIVGWILIAVSAAYIAYFLRVRLFTPGP |
| Ga0164306_114915942 | 3300012988 | Soil | VISRQKIVGWILIVASVAYITYFLRVRLFTPGPILEN |
| Ga0173480_101817491 | 3300015200 | Soil | VISRQKIVGWVLVIVSIAYIAYFLRVRLFAPGPMI |
| Ga0182036_106255562 | 3300016270 | Soil | VISRQKIVGWILIAVSAAYIAYFLRVRLFSPGPILENKEWVQFVGSIVTLMLGTI |
| Ga0182041_105747722 | 3300016294 | Soil | MRTVISRQKIVGWILIVASVAYIAYFLRVRLFTPGPILENKEW |
| Ga0182041_123322582 | 3300016294 | Soil | VISRQKIVGWILIVASVAYIAYFLRVRLFTPGPILENKEWVQFIGSIVILMLG |
| Ga0182035_104766392 | 3300016341 | Soil | VISRQKLIGWILIAVSAAYIAYFLRVRLLEVGPTV |
| Ga0182034_117730601 | 3300016371 | Soil | MRTVISRQKIVGWILIVASVAYIAYFLRVRLFTPGPILENKEWVQFIGSIV |
| Ga0182039_107587842 | 3300016422 | Soil | LSRQKSVGWILIAVSAAYIAYFLRVRLFEPGPAVASKEWVQVI |
| Ga0182038_108953091 | 3300016445 | Soil | VISRQKLVGWILIVVSAAYIAYFLRVRLFTPGPILEKKEWVQFIGSIVILML |
| Ga0190272_132613332 | 3300018429 | Soil | VISRQKIVGWILVIVSTLFIAYFLKARVLTAGPPLEKAEWLRFIGSVVT |
| Ga0190274_131893622 | 3300018476 | Soil | VISRQKVVGWILIVISTAFILYFLRTRLMVPGPII |
| Ga0210379_102834151 | 3300021081 | Groundwater Sediment | VISRQKVVGWILIIVSTAFILYFLRVRLFGSGPALEKKEWVHFIGSIVILMVGTINVR |
| Ga0210408_102423932 | 3300021178 | Soil | VISRQKIVGWILIAVSAAYIAYFLRVRLFTPGPILENKEWVQFV |
| Ga0213878_105735482 | 3300021444 | Bulk Soil | LTPSALIGRQRAVGWALIVVSAAFIAYFLRVRLLEPGTVIARKEWAEL |
| Ga0207672_10093741 | 3300025223 | Corn, Switchgrass And Miscanthus Rhizosphere | VISRQKIVGWVLVIVSVGYIAYFLRVRLFAPGPMIEKKE |
| Ga0207692_108878022 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VISRQKIVGWILIAASAAYIAYFLRVRLFTPGPILENKEWA |
| Ga0207645_106166551 | 3300025907 | Miscanthus Rhizosphere | VVISRQKIVGWALVIVSVAYIAYFLRVRLFAPGPVIEKK |
| Ga0207651_115438962 | 3300025960 | Switchgrass Rhizosphere | VISRQKIVGWVLVIVSVGYIAYFLRVRLFAPGPMIEKK |
| Ga0209152_104025042 | 3300026325 | Soil | MRLSRQKLVGWILIVVSVAYIAYFLRVRLFTPGPILERKEWVQFIGSFVILMLGT |
| Ga0209161_103902862 | 3300026548 | Soil | MRLSRQKLVGWILIVVSVAYIAYFLRVRLFTPGPILERKEWV |
| Ga0207839_10423851 | 3300027010 | Tropical Forest Soil | MSRQKLVGWILIAVSVAYIAWFLRVRLFEPGPAVEKKEWVQFIGSIV |
| Ga0209325_10468242 | 3300027050 | Forest Soil | VISRQKIVGWILIVASVAYITYFLRVRLFTPGPILENKEWVQLIGSI |
| Ga0209465_100097981 | 3300027874 | Tropical Forest Soil | VISRQKVVGWILIVVSAAYIAYFLRVRLLDVGPVLEKKEWVQFIG |
| Ga0209382_101639674 | 3300027909 | Populus Rhizosphere | VISRQKLVGWILIIVSAAYIAYFLRVRLFSPGPILEKKEWVQFIGSIVILMLGT |
| Ga0307295_101353551 | 3300028708 | Soil | MISRQKVVGWILIIVSIAFIAWFVRVRLLDVGPVVEKKEWVQFIGSV |
| Ga0307293_100656591 | 3300028711 | Soil | VISRQKIVGWVLVIVSVAYIAYFLRVRLFAPGPIIEK |
| Ga0307318_102016591 | 3300028744 | Soil | VISRQKIVGWVLVIVSVAYIAYFLRVRLFAPGPIIEKKE |
| Ga0307297_102315281 | 3300028754 | Soil | VISRQKIVGWVLVIVSVAYIAYFLRVRLFAPGPMIEKK |
| Ga0307280_102400692 | 3300028768 | Soil | VISRQKIVGWVLVIVSVAYIAYFLRVRLFAPGPMIE |
| Ga0307289_100363333 | 3300028875 | Soil | MISRQKVVGWILIIVSIAFIAWFVRVRLFDVGPVV |
| Ga0247826_114660671 | 3300030336 | Soil | VISRQKIVGWVLVIVSIGYIAYFLRVRLFAPGPMIEKK |
| Ga0307500_100343022 | 3300031198 | Soil | MISRQKVVGWILIIVSIAFIAWFVRVRLLDVGPVVEKKEWVQF |
| Ga0170824_1156912202 | 3300031231 | Forest Soil | VINRQKVVGWLLIAVSAAYILYFLRLRLFTEGPPVVN |
| Ga0318516_101812771 | 3300031543 | Soil | MSRQKLVGWILIAASVAYIAWFLRVRAFEPGPALEKKEWVHLIGSIVIF |
| Ga0318516_105331422 | 3300031543 | Soil | VISRQKIVGWILIVASVAYIAYFLRVRLFTPGPILEN |
| Ga0318541_107120522 | 3300031545 | Soil | VISRQKIVGWILIVASVAYIAYFLRVRLFTPGPIL |
| Ga0318538_106207151 | 3300031546 | Soil | VISRQKIVGWILIVASVAYIAYFLRVRLFTPGPILENKEWVQFIGSIVVLMLG |
| Ga0318571_103638081 | 3300031549 | Soil | VISRQKIVGWILIAVSAAYIAYFLRVRLFTPGPILENKE |
| Ga0318528_102340372 | 3300031561 | Soil | VISRQKIVGWILIVASVAYIAYFLRVRLFTPGPILENKEWVQFIGSIV |
| Ga0318574_103333831 | 3300031680 | Soil | VISRQKIVGWILIVASVAYIAYFLRVRLFTPGPILENKEWVQ |
| Ga0318572_104441432 | 3300031681 | Soil | VISRQKLVGWILIVVSAAYIAYFLRVRLFTPGPILEKKEWVQF |
| Ga0318560_104167652 | 3300031682 | Soil | VISRQKIVGWILIVVSAAYIAYFLRVRLFEPGPVVAGKEWAQVIGSLLVLM |
| Ga0318500_105372321 | 3300031724 | Soil | VISRQKIVGWILIAVSAAYIAYFLRVRLFSPGPILENKEWVQFVGSIVT |
| Ga0318554_103919421 | 3300031765 | Soil | VISRQKIVGWILIVASVAYIAYFLRVRLFTPGPILENK |
| Ga0318521_103588642 | 3300031770 | Soil | VISRQKIVGWILIAVSAAYIAYFLRVRLFSPGPILENKEWVQFVGSIVTLMLG |
| Ga0318498_100205295 | 3300031778 | Soil | VISRQKIVGWILIVASVAYIAYFLRVRLFTPGPILENKEW |
| Ga0318548_102832561 | 3300031793 | Soil | VISRQKIVGWILIAVSAAYIAYFLRVRLFTPGPILEKKEWAQFIGS |
| Ga0318550_103493731 | 3300031797 | Soil | VISRQKIVGWILIAVSAAYIAYFLRLRLFTPGPILENKEWVQFIGSIVILMLG |
| Ga0318567_108602802 | 3300031821 | Soil | VISRQKIVGWILITVSAGYIAYFLRVRLFTPGPILENKEWVQFIGSIVILMLGTI |
| Ga0318567_108890792 | 3300031821 | Soil | VISRQKIVGWILIAVSAGYIAYFLRVRLFTPGPILENKEWVQFIG |
| Ga0310917_100399783 | 3300031833 | Soil | VPGPALSRQKLIGGILIVVSAAYIAWFVRVRLFTAGPAVEKKEWLQ |
| Ga0310917_108370461 | 3300031833 | Soil | VISRQKIVGWILIAVSAAYIAYFLRVRLFTPGPILENKEWVQFVGS |
| Ga0318551_102582541 | 3300031896 | Soil | VISRQKIVGWILIAVSAAYIAYFLRVRLFTPGPILENKEWVQFVGSIVTLMLG |
| Ga0306923_111266052 | 3300031910 | Soil | VISRQKIVGWILIAVSAAYIAYFLRVRLFTPGPILEKKEWAQFIGSIVILMLG |
| Ga0310910_100061481 | 3300031946 | Soil | VISRQKLVGWILIVVSAAYIAYFLRVRLFTPGPILEKKEWVQFIGSIVILM |
| Ga0306922_101082991 | 3300032001 | Soil | MRTVISRQKIVGWILIVASVAYIAYFLRVRLFTPGPILENKEWV |
| Ga0318532_100853292 | 3300032051 | Soil | VISRQKIVGWILIAVSAAYIAYFLRVRLFTPGPILENK |
| Ga0318533_102478561 | 3300032059 | Soil | MRTVISRQKIVGWILIVASVAYIAYFLRVRLFTPG |
| Ga0318504_101423212 | 3300032063 | Soil | VISRQKIVGWILIAVSAAYIAYFLRVRLFTPGPILENKEWVQFI |
| Ga0306924_116447011 | 3300032076 | Soil | MSRQKLVGWILIAVSVAYVVWFLRVRLFEPGPALE |
| Ga0318518_104990522 | 3300032090 | Soil | VISRQKIVGWILIVVSAAYIAYFLRVRLFTPGPILENKEWVQ |
| Ga0307471_1034483522 | 3300032180 | Hardwood Forest Soil | VISRQKLVGWILIVVSAAYIVYFLRVRLLDVGPIV |
| Ga0364924_144344_1_144 | 3300033811 | Sediment | MVISRQQVIGWILIVVSVAYIAYFLRVRLFTPGPIVEKKEWVQFIGSF |
| Ga0364923_0060864_799_906 | 3300034690 | Sediment | MISRQKIVGWVLVIVSIGYIAYFLRVRLFAPGPMIE |
| Ga0373959_0205594_405_521 | 3300034820 | Rhizosphere Soil | MVISRQKIVGWALVIVSVAYIAYFLRVRLFAPGPVIEKK |
| ⦗Top⦘ |