Basic Information | |
---|---|
Family ID | F084421 |
Family Type | Metagenome |
Number of Sequences | 112 |
Average Sequence Length | 47 residues |
Representative Sequence | MRSQKPTPFCENRAGERGAALITAVLLSLLLLAAGGILILTSTMTGITARD |
Number of Associated Samples | 84 |
Number of Associated Scaffolds | 112 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 95.19 % |
% of genes near scaffold ends (potentially truncated) | 91.96 % |
% of genes from short scaffolds (< 2000 bps) | 85.71 % |
Associated GOLD sequencing projects | 71 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.44 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (50.000 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (16.071 % of family members) |
Environment Ontology (ENVO) | Unclassified (50.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (82.143 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.43% β-sheet: 0.00% Coil/Unstructured: 45.57% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 112 Family Scaffolds |
---|---|---|
PF07963 | N_methyl | 11.61 |
PF13544 | Obsolete Pfam Family | 10.71 |
PF00318 | Ribosomal_S2 | 0.89 |
PF02113 | Peptidase_S13 | 0.89 |
PF00528 | BPD_transp_1 | 0.89 |
PF02518 | HATPase_c | 0.89 |
COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
---|---|---|---|
COG0052 | Ribosomal protein S2 | Translation, ribosomal structure and biogenesis [J] | 0.89 |
COG2027 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.89 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 50.00 % |
Unclassified | root | N/A | 50.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000789|JGI1027J11758_12893036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1714 | Open in IMG/M |
3300002155|JGI24033J26618_1067998 | Not Available | 532 | Open in IMG/M |
3300003267|soilL1_10011615 | All Organisms → cellular organisms → Bacteria | 4555 | Open in IMG/M |
3300004114|Ga0062593_103411775 | Not Available | 510 | Open in IMG/M |
3300004643|Ga0062591_101954120 | Not Available | 603 | Open in IMG/M |
3300005093|Ga0062594_100291130 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1233 | Open in IMG/M |
3300005290|Ga0065712_10240531 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 985 | Open in IMG/M |
3300005290|Ga0065712_10564406 | Not Available | 610 | Open in IMG/M |
3300005294|Ga0065705_10010978 | All Organisms → cellular organisms → Bacteria | 3484 | Open in IMG/M |
3300005294|Ga0065705_10076598 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 781 | Open in IMG/M |
3300005294|Ga0065705_10646946 | Not Available | 680 | Open in IMG/M |
3300005334|Ga0068869_100271787 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1360 | Open in IMG/M |
3300005334|Ga0068869_100657748 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 890 | Open in IMG/M |
3300005340|Ga0070689_100839106 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 810 | Open in IMG/M |
3300005345|Ga0070692_10096850 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1612 | Open in IMG/M |
3300005354|Ga0070675_101980673 | Not Available | 537 | Open in IMG/M |
3300005367|Ga0070667_101137366 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 730 | Open in IMG/M |
3300005438|Ga0070701_10694784 | Not Available | 684 | Open in IMG/M |
3300005438|Ga0070701_11077481 | Not Available | 564 | Open in IMG/M |
3300005440|Ga0070705_100344523 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1084 | Open in IMG/M |
3300005441|Ga0070700_101540341 | Not Available | 566 | Open in IMG/M |
3300005456|Ga0070678_100278242 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1414 | Open in IMG/M |
3300005457|Ga0070662_101591821 | Not Available | 564 | Open in IMG/M |
3300005458|Ga0070681_10367830 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1348 | Open in IMG/M |
3300005458|Ga0070681_11533329 | Not Available | 591 | Open in IMG/M |
3300005466|Ga0070685_10750324 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 716 | Open in IMG/M |
3300005507|Ga0074259_10928331 | Not Available | 500 | Open in IMG/M |
3300005518|Ga0070699_100234929 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1635 | Open in IMG/M |
3300005539|Ga0068853_101255962 | Not Available | 715 | Open in IMG/M |
3300005543|Ga0070672_100475131 | Not Available | 1079 | Open in IMG/M |
3300005545|Ga0070695_100296321 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1194 | Open in IMG/M |
3300005546|Ga0070696_100161037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1653 | Open in IMG/M |
3300005546|Ga0070696_100618229 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
3300005546|Ga0070696_100644827 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 858 | Open in IMG/M |
3300005549|Ga0070704_100190263 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1649 | Open in IMG/M |
3300005564|Ga0070664_100975972 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 796 | Open in IMG/M |
3300005578|Ga0068854_101710637 | Not Available | 575 | Open in IMG/M |
3300005578|Ga0068854_101874163 | Not Available | 551 | Open in IMG/M |
3300005615|Ga0070702_100617764 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 815 | Open in IMG/M |
3300005615|Ga0070702_101604014 | Not Available | 538 | Open in IMG/M |
3300005617|Ga0068859_100004775 | All Organisms → cellular organisms → Bacteria | 13784 | Open in IMG/M |
3300005617|Ga0068859_100207012 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2047 | Open in IMG/M |
3300005617|Ga0068859_100766764 | Not Available | 1053 | Open in IMG/M |
3300005617|Ga0068859_102696138 | Not Available | 546 | Open in IMG/M |
3300005618|Ga0068864_100492975 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1178 | Open in IMG/M |
3300005840|Ga0068870_10443482 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 854 | Open in IMG/M |
3300005841|Ga0068863_100254298 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1697 | Open in IMG/M |
3300005842|Ga0068858_101349842 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
3300005843|Ga0068860_102289839 | Not Available | 561 | Open in IMG/M |
3300005844|Ga0068862_100327808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1415 | Open in IMG/M |
3300005844|Ga0068862_101007672 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 824 | Open in IMG/M |
3300005844|Ga0068862_102546524 | Not Available | 523 | Open in IMG/M |
3300006196|Ga0075422_10374819 | Not Available | 625 | Open in IMG/M |
3300006806|Ga0079220_10970076 | Not Available | 670 | Open in IMG/M |
3300006844|Ga0075428_100673512 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1103 | Open in IMG/M |
3300006853|Ga0075420_101343315 | Not Available | 613 | Open in IMG/M |
3300006903|Ga0075426_10935617 | Not Available | 654 | Open in IMG/M |
3300009101|Ga0105247_10481026 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 901 | Open in IMG/M |
3300009147|Ga0114129_12264609 | Not Available | 653 | Open in IMG/M |
3300009147|Ga0114129_13437753 | Not Available | 508 | Open in IMG/M |
3300009148|Ga0105243_12328745 | Not Available | 573 | Open in IMG/M |
3300009162|Ga0075423_12225664 | Not Available | 596 | Open in IMG/M |
3300009174|Ga0105241_11145371 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 734 | Open in IMG/M |
3300009174|Ga0105241_11869520 | Not Available | 588 | Open in IMG/M |
3300009545|Ga0105237_10425263 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1334 | Open in IMG/M |
3300009789|Ga0126307_10484259 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 998 | Open in IMG/M |
3300010045|Ga0126311_11813966 | Not Available | 517 | Open in IMG/M |
3300010047|Ga0126382_12294204 | Not Available | 521 | Open in IMG/M |
3300010359|Ga0126376_10057440 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2784 | Open in IMG/M |
3300010397|Ga0134124_10190123 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1857 | Open in IMG/M |
3300010397|Ga0134124_11736831 | Not Available | 657 | Open in IMG/M |
3300010397|Ga0134124_12718894 | Not Available | 538 | Open in IMG/M |
3300010397|Ga0134124_12781079 | Not Available | 533 | Open in IMG/M |
3300010400|Ga0134122_10121183 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2095 | Open in IMG/M |
3300013760|Ga0120188_1008447 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 884 | Open in IMG/M |
3300014326|Ga0157380_10347958 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1386 | Open in IMG/M |
3300015262|Ga0182007_10350868 | Not Available | 554 | Open in IMG/M |
3300015372|Ga0132256_103232975 | Not Available | 548 | Open in IMG/M |
3300015373|Ga0132257_100195057 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2396 | Open in IMG/M |
3300015373|Ga0132257_101107746 | Not Available | 1000 | Open in IMG/M |
3300021445|Ga0182009_10363442 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 741 | Open in IMG/M |
3300024290|Ga0247667_1048977 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 787 | Open in IMG/M |
3300025908|Ga0207643_10530357 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 754 | Open in IMG/M |
3300025918|Ga0207662_10901410 | Not Available | 626 | Open in IMG/M |
3300025926|Ga0207659_10587056 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 949 | Open in IMG/M |
3300025931|Ga0207644_11825963 | Not Available | 508 | Open in IMG/M |
3300025935|Ga0207709_11702473 | Not Available | 524 | Open in IMG/M |
3300025936|Ga0207670_10568545 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 928 | Open in IMG/M |
3300025941|Ga0207711_11884797 | Not Available | 541 | Open in IMG/M |
3300025942|Ga0207689_10623929 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 908 | Open in IMG/M |
3300025945|Ga0207679_10480858 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1106 | Open in IMG/M |
3300025961|Ga0207712_10481066 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1058 | Open in IMG/M |
3300026023|Ga0207677_11072304 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 733 | Open in IMG/M |
3300026075|Ga0207708_11619658 | Not Available | 569 | Open in IMG/M |
3300026088|Ga0207641_11478345 | Not Available | 681 | Open in IMG/M |
3300026089|Ga0207648_10548824 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1061 | Open in IMG/M |
3300026095|Ga0207676_10085502 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2574 | Open in IMG/M |
3300028380|Ga0268265_10434024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus | 1223 | Open in IMG/M |
3300028380|Ga0268265_10867854 | Not Available | 884 | Open in IMG/M |
3300028380|Ga0268265_12315602 | Not Available | 544 | Open in IMG/M |
3300028381|Ga0268264_12048877 | Not Available | 581 | Open in IMG/M |
3300031716|Ga0310813_10824391 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 837 | Open in IMG/M |
3300031716|Ga0310813_11677188 | Not Available | 595 | Open in IMG/M |
3300032126|Ga0307415_100562877 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1008 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 16.07% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 13.39% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 6.25% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.25% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.46% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 4.46% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 3.57% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.57% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.57% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.68% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.68% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.68% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.68% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.68% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.68% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.79% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.79% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.79% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.79% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.79% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.79% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.89% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.89% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.89% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.89% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.89% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.89% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.89% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.89% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Host-Associated | Open in IMG/M |
3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
3300005507 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 | Host-Associated | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300013760 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep2 | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI1027J11758_128930364 | 3300000789 | Soil | MRSHKAAKPTRKRQNERGAALITAILLSLLLLAAGGTLVL |
JGI24033J26618_10679981 | 3300002155 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSQKPLYESRAAERGAALITAVLLSLLLLAAGGTLILTA |
soilL1_100116153 | 3300003267 | Sugarcane Root And Bulk Soil | MRTQKLTPSRDKRAGERGAALITAVLLSLLLLAAGGILILTSTMTGVTARELDS* |
Ga0062593_1034117751 | 3300004114 | Soil | MRSQKPNAFSERRAGERGAALITAVLLSMLLLAAGGVLILTSTMT |
Ga0062591_1019541201 | 3300004643 | Soil | MKSLKTTVLFKSRTGEQGAALITALLLSLLLLAAGGTLILTTTMTGLTARDSTTE |
Ga0062594_1002911303 | 3300005093 | Soil | MRLQTTLFESRGSERGAALVTAILLSLLLLAAGGTLILTATMTGITARDST |
Ga0065712_102405312 | 3300005290 | Miscanthus Rhizosphere | MRSQKPTFKDRSNEKGAALITAVLLSMLLLAAGGTLILTTTMTGIT |
Ga0065712_105644061 | 3300005290 | Miscanthus Rhizosphere | MRREKSEVVHSMRSTKPNDLFRDRRGERGAALITAVLLSMLMLAAGGTLIMTSTMSGLTA |
Ga0065705_100109785 | 3300005294 | Switchgrass Rhizosphere | MRSHKPASHCENRTGERGAALITAVLLSLLLLAAGGILILTSTMTGIT |
Ga0065705_100765982 | 3300005294 | Switchgrass Rhizosphere | MRSQKPNAFSERRAGERGAALITAVLLSMLLLAAGGVLILTSTMTG |
Ga0065705_106469461 | 3300005294 | Switchgrass Rhizosphere | MKSQTTTAILKSRTSEKGAALITAVLLSLLLLAAGGTLILTTTMTG |
Ga0068869_1002717873 | 3300005334 | Miscanthus Rhizosphere | MRSHKSVSHCESRAGERGAALITAVLLSLLLLAAGGILILTSTMTGITARDS |
Ga0068869_1006577481 | 3300005334 | Miscanthus Rhizosphere | MRLQKPTLLTESRSSERGAALITAILLSLLLLAAGGILILTATMTG |
Ga0070689_1008391061 | 3300005340 | Switchgrass Rhizosphere | MRSQKRNAFSERRAGERGAALITAVLLSMLLLAAGGVLILTSTMTG |
Ga0070692_100968504 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSQKPIRTFESSVGERGAALITAVLLSLLLLAAGGTLILTATMTGITARDSTAEMQ |
Ga0070675_1019806731 | 3300005354 | Miscanthus Rhizosphere | MKSHKPTPFCESRAGERGAALITAVLLSMLLLAAGGILILTSTMTGIT |
Ga0070667_1011373661 | 3300005367 | Switchgrass Rhizosphere | MKSHKPTLFCESRAGERGAALITAVLLSLLLLAAGGILILTSTMTGITARDSTAEMQA |
Ga0070701_106947841 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSQKPNAFSERRAGERGAALITAVLLSMLLLAAGGVLILTSTMTGIT |
Ga0070701_110774812 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLQKPTLLTESRSSERGAALITAILLSLLLLAAGGILILTATMTGITARDSTAEMQ |
Ga0070705_1003445231 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSQKPNAFSERRAGERGAALITAVLLSMLLLAAGGVLILT |
Ga0070700_1015403411 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSQKPTFKDRSNEKGAALITAVLLSLLLLAAGGTLILTTT |
Ga0070678_1002782421 | 3300005456 | Miscanthus Rhizosphere | MRSTKPNDLFRDRRGERGAALITAVLLSMLMLAAGGTLIMTSTMSGLTARDS |
Ga0070662_1015918211 | 3300005457 | Corn Rhizosphere | MKSQKQSRSGERGAALITAVLLSMLLLAAGGILILTSTMTGITARDSTA |
Ga0070681_103678301 | 3300005458 | Corn Rhizosphere | MRSQTTTAFPDSRGGEKGAALITTLLLSFLLLAAGGTLILSTTMAGITARDST |
Ga0070681_115333292 | 3300005458 | Corn Rhizosphere | MRSQTPTRLLENRAGERGAALLTAVLLSMLLLAASGTLILTTTMTGITARDAT |
Ga0070685_107503241 | 3300005466 | Switchgrass Rhizosphere | MRSHKPVSACESRAGERGAALITAVLLSLLLLAAGGILILTSTMTGITARDSTAEMQA |
Ga0074259_109283312 | 3300005507 | Arabidopsis Rhizosphere | MRSTKPNDLFRDRRGERGAALITAVLLSMLMLAAGGTLIMTSTMSGLTARDSTSEMQA |
Ga0070699_1002349294 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSTKPTKLSRNRHDERGAALVTAILLSMLLLAAGGTLIM |
Ga0068853_1012559622 | 3300005539 | Corn Rhizosphere | MNSQQPTFKNRSNEKGAALITAVLLSLLLLAAGGTLILTTTMTGITARDSTAEMQAY |
Ga0070672_1004751311 | 3300005543 | Miscanthus Rhizosphere | MKSQKAIQLSKERTGERGAALITAVLLSMLLLAAGGTLVLTSTMT |
Ga0070695_1002963211 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSQKASKPTRERQNERGAALITAILLSLLLLAAGGTLVLTT |
Ga0070696_1001610371 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSQKPIRTFESSVGERGAALITAVLLSLLLLAAGGTLILTATMTGITA |
Ga0070696_1006182291 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSHYRTPIYESRAGERGAALITAVLLSLLLLAAGGILILTSTMTGVTARDSTAEMQAYY |
Ga0070696_1006448272 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLQKPTLLTESRSSERGAALITAILLSLLLLAAGGILILTATMTGITARDSTA |
Ga0070704_1001902634 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MKSQKANMFCESRAGERGAALITAVLLSLLLLAAGGILILTSTMTS |
Ga0070704_1009592011 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MKSQMQSRAGERGAALITAVLLSMLLLAAGGILILTSTMTG |
Ga0070664_1009759722 | 3300005564 | Corn Rhizosphere | MRSHKPTPFYETRAGERGAALITAVLLSLLLLAAGGILILTS |
Ga0068857_1016742681 | 3300005577 | Corn Rhizosphere | MKTQKQSRAGERGAALITAVLLSMLLLAAGGILILTSTMTGITARDS |
Ga0068854_1017106371 | 3300005578 | Corn Rhizosphere | MRSQQPALKNRSSEKGAALITAVLLSLLLLAAGGTLILTTTMSGITARDSTAEMQAYYA |
Ga0068854_1018741632 | 3300005578 | Corn Rhizosphere | MRSHKADKSTRKRQNERGAALITAILLSLLLLAAGGTLVLTTSMTGITALD |
Ga0070702_1006177641 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTHKPKRAGEKGAALITAVLLSMLLLAAGGTLVLTSTMTGI |
Ga0070702_1016040141 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTEKRIPCLAGRAGEKGAALITAVLLSMLLLAAGGTLILT |
Ga0068859_10000477516 | 3300005617 | Switchgrass Rhizosphere | MRSQKPTPCFKDRVGEKGAALITAVLLSMLLLAAGGTLVLTSTMTGITAR |
Ga0068859_1002070121 | 3300005617 | Switchgrass Rhizosphere | MRSQKPNAFSERRAGERGAALITAVLLSMLLLAAGGV |
Ga0068859_1007667641 | 3300005617 | Switchgrass Rhizosphere | MRTLKPTSNRAGEKGAALITAVLLSMLLLAAGGTLVLTSTMTGITARD |
Ga0068859_1026961382 | 3300005617 | Switchgrass Rhizosphere | MRSQKPALKNRSSEKGAALITAVLLSLLLLAAGGTLILTTTMSGITARDS |
Ga0068864_1004929753 | 3300005618 | Switchgrass Rhizosphere | MKSQMQSRAGERGAALITAVLLSMLLLAAGGILILTSTMTGI |
Ga0068870_104434821 | 3300005840 | Miscanthus Rhizosphere | MSSQKPALKNRSNEKGAALITAVLLSLLLLAAGGTL |
Ga0068863_1002542981 | 3300005841 | Switchgrass Rhizosphere | MRSQKPTLKNRSSEKGAALITAVLLSLLLLAAGGTLILTTTMS |
Ga0068858_1013498421 | 3300005842 | Switchgrass Rhizosphere | MRSHKSVSHCESRAGERGAALITAVLLSLLLLAAGGILILTSTMTGITA |
Ga0068860_1022898392 | 3300005843 | Switchgrass Rhizosphere | MRSQQPALKNRSSEKGAALITAVLLSLLLLAAGGTLILTTTMSGITARDSTAEMQ |
Ga0068862_1003278083 | 3300005844 | Switchgrass Rhizosphere | MRSQKPTFKDRSNEKGAALITAVLLSLLLLAAGGTLILTTTMTGITARDST |
Ga0068862_1010076721 | 3300005844 | Switchgrass Rhizosphere | MRSQKPIRTFESSVGERGAALITAVLLSLLLLAAGGTLILTATM |
Ga0068862_1014001952 | 3300005844 | Switchgrass Rhizosphere | MKTQKQSRAGERGAALITAVLLSMLLLAAGGILILTSTMTGITARDST |
Ga0068862_1025465242 | 3300005844 | Switchgrass Rhizosphere | MSSHQPAFKNRSNEKGAALITAVLLSLLLLAAGGTLILTTTMTGITARD |
Ga0075422_103748191 | 3300006196 | Populus Rhizosphere | MRLQTTLSESRSSERGAALVTAILLSLLLLAAGGTLILTATMT |
Ga0079220_109700761 | 3300006806 | Agricultural Soil | MRSQTPTRSFESRTGERGAALLTAVLLSMLLLAASGTLVLTTTMTGITARDATA |
Ga0075428_1006735123 | 3300006844 | Populus Rhizosphere | MRLQTSVSESRGSERGAALVTAIMLSLLLLAAGGTLILTATMTGITARDSTAEMQ |
Ga0075420_1013433152 | 3300006853 | Populus Rhizosphere | MRSKKQTALFESCAGERGAALITAVLLSLLLLAAGGTLILTATMTGT |
Ga0075426_109356172 | 3300006903 | Populus Rhizosphere | MRSQKRNDLFQNRHGERGAALITAVLLSMLLLAAGGTLIMTSTM |
Ga0105245_123304511 | 3300009098 | Miscanthus Rhizosphere | MTSTKSCESRAGERCAALITAVLLSLLLLAAGGIL |
Ga0105247_104810262 | 3300009101 | Switchgrass Rhizosphere | MRSQKPALKNRSSEKGAALITAVLLSLLLLAAGGTLILTTTMSGITA |
Ga0114129_122646091 | 3300009147 | Populus Rhizosphere | MKSQKPLHESRAGERGAALITAVLLSLLLLAAGGTLILTATMTSI |
Ga0114129_134377532 | 3300009147 | Populus Rhizosphere | MRLQNPTLLSESRGSERGAALVTTILLSLLLLAAGGTLIL |
Ga0105243_123287452 | 3300009148 | Miscanthus Rhizosphere | MRLQKPTLLTESRSSERGAALITAILLSLLLLAAGGILILTATMTGITARDSTAEMQA |
Ga0075423_122256642 | 3300009162 | Populus Rhizosphere | MRSQKATKLTSKRHHERGAALITELLLSLLLLAAGGTLVLTTSMTGITALDSTAEMQA |
Ga0105241_111453712 | 3300009174 | Corn Rhizosphere | MKSQNTTALFKSRTDEPGAALITALLLSLLLLAAGGTLILTTTMTGLTARDSTAE |
Ga0105241_112551302 | 3300009174 | Corn Rhizosphere | MKSPMQRLSGERGAALITAVLLSMLLLAAGGLLILTSTMTGITARDSTA |
Ga0105241_118695202 | 3300009174 | Corn Rhizosphere | MKSHKPTPFCESRAGERGAALITAVLLSLLLLAAGGILILTSTMTGITAR |
Ga0105237_104252633 | 3300009545 | Corn Rhizosphere | MSSHQPAFKNRQNEKGAALITAVLLSLLLLAAGGTLILTTTMTGITAR |
Ga0126307_104842591 | 3300009789 | Serpentine Soil | MRSQKPTPFCENRAGERGAALITAVLLSLLLLAAGGILILTSTMTGITARD |
Ga0126311_118139662 | 3300010045 | Serpentine Soil | MRSQKPTPFCESRAGERGAALITAVLLSLLLLAAGGVLILTSTM |
Ga0126382_122942042 | 3300010047 | Tropical Forest Soil | MKPTNFYESRAGERGAALITAVLLSMLLLAAGGILILTSTMT |
Ga0126376_100574405 | 3300010359 | Tropical Forest Soil | MRTQKRSAHAAKRAGEKGAALITAVLLSMLLLAAGGTLVLTS |
Ga0134124_101901234 | 3300010397 | Terrestrial Soil | MRSQKPNAFSERRAGERGAALITAVLLSMLLLAAGGVLILTSTM |
Ga0134124_117368311 | 3300010397 | Terrestrial Soil | MKSQKAIQLSKERTGERGAALITAVLLSMLLLAAGGTLVLTSTMTGIT |
Ga0134124_127188942 | 3300010397 | Terrestrial Soil | MSSHQPTFNHRPNEKGAALITAMLLSLLLLAAGGTLILTTTMT |
Ga0134124_127810791 | 3300010397 | Terrestrial Soil | MRSQTTTTFPDSRANERGAALITTVLLSFLLLAAGGTLIM |
Ga0134122_101211834 | 3300010400 | Terrestrial Soil | MRSQKPTLKNRSNEKGAALITAVLLSLLLLAAGGTLIMTTTMTGVTARDSTAEMQAYY |
Ga0157375_113145642 | 3300013308 | Miscanthus Rhizosphere | MKTQKQSRAGERGAALITAVLLSMLLLAAGGILILTS |
Ga0120188_10084471 | 3300013760 | Terrestrial | MRLQKPTALTESRGSERGAALITAILLSLLLLAAGGTLILTATMTGITARDSTAEMQAY |
Ga0157380_103479583 | 3300014326 | Switchgrass Rhizosphere | MRSQKPTFKNRSSEKGAALITAVLLSLLLLAAGGTLILTTTM |
Ga0182007_103508681 | 3300015262 | Rhizosphere | MRLQTTTTAFPEKRASEKGAALITAVLLSLLLLAAGGTLILTTAM |
Ga0132256_1032329752 | 3300015372 | Arabidopsis Rhizosphere | MKLQPPTKTVDVRSNERGAALITTILLSTLLLAAGGILILVTAMTGTNAVDAT |
Ga0132257_1001950571 | 3300015373 | Arabidopsis Rhizosphere | MRREKSEVVHSMRSTKPNDLFRDRRGERGAALITAVLLSMLMLAAGGTLIMTSTMSGLTARDSTSE |
Ga0132257_1011077463 | 3300015373 | Arabidopsis Rhizosphere | MKSQNTTALFKSRIGEQGAALITALLLSLLLLAAGGT |
Ga0182009_103634422 | 3300021445 | Soil | MRSQTTTAFPDSRANEKGAALITTVLLSFLLLAAGGTLILVT |
Ga0247667_10489771 | 3300024290 | Soil | MRSKTPTGLFESRAGERGAALITAVLLSMLLLAASGTLILTTTMTGITARD |
Ga0207643_105303571 | 3300025908 | Miscanthus Rhizosphere | MSSQKPALKNRSNEKGAALITAVLLSLLLLAAGGTLILTTTMT |
Ga0207654_107272362 | 3300025911 | Corn Rhizosphere | MKSQKQSRSGERGAALITAVLLSMLLLAAGGILILTSTMTGIT |
Ga0207662_109014103 | 3300025918 | Switchgrass Rhizosphere | MRSQKPLYESRAAERGAALITAVLLSLLLLAAGGTLILTATMTNITARD |
Ga0207659_105870561 | 3300025926 | Miscanthus Rhizosphere | MRSTKPNDLFRDRRGERGAALITAVLLSMLMLAAG |
Ga0207644_118259631 | 3300025931 | Switchgrass Rhizosphere | MRSTKPNDLFRDRRGERGAALITAVLLSMLMLAAGGTLIMTSTMSGLTARDSTSE |
Ga0207709_117024731 | 3300025935 | Miscanthus Rhizosphere | MKSHKPTLFCESRAGERGAALITAVLLSLLLLAAGGILILTSTMTGITARDSTAEMQAY |
Ga0207670_105685451 | 3300025936 | Switchgrass Rhizosphere | MRSQKPTFKNRSNEKGAALITAVLLSLLLLAAGCTLILTTSMSGIIARDSTAEMQ |
Ga0207711_118847971 | 3300025941 | Switchgrass Rhizosphere | MRSHKPTPFYESRAGERGAALITAVLLSLLLLAAGGILILTSTMTGITARDSTAE |
Ga0207689_106239292 | 3300025942 | Miscanthus Rhizosphere | MRLQKPTLLTESRSSERGAALITAILLSLLLLAAGGIL |
Ga0207679_104808581 | 3300025945 | Corn Rhizosphere | MRSHKPTPFYETRAGERGAALITAVLLSLLLLAAGGILILTSTMTGI |
Ga0207679_108184921 | 3300025945 | Corn Rhizosphere | MKSHMQSRAGERGAALITAVLLSMLLLAAGGILILTSTMTGITARDSTAEMQAY |
Ga0207712_104810663 | 3300025961 | Switchgrass Rhizosphere | MSSHQPAFKNRSNEKGAALITAVLLSLLLLAAGGTLILTTTMTG |
Ga0207677_110723042 | 3300026023 | Miscanthus Rhizosphere | MRSTKPNDLFRDRRGERGAALITAVLLSMLMLAAGGTLIMTSTMSG |
Ga0207708_116196582 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSQKPTFKDRSNEKGAALITAVLLSLLLLAAGGTLILTTTM |
Ga0207641_114783452 | 3300026088 | Switchgrass Rhizosphere | MKSQNTTALFKSRTDEQGAALITALLLSLLLLAAGGTLILTTTMTGLTA |
Ga0207648_105488241 | 3300026089 | Miscanthus Rhizosphere | MRSQKPLYESRAAERGAALITAVLLSLLLLAAGGTLILTATMTNITARDSTA |
Ga0207676_100855021 | 3300026095 | Switchgrass Rhizosphere | MRSQKPTFKNRSSEKGAALITAVLLSLLLLAAGGTLILTTTMSGITA |
Ga0268265_104340243 | 3300028380 | Switchgrass Rhizosphere | MKSQKAIQLSKERTGERGAALITAVLLSMLLLAAG |
Ga0268265_108678541 | 3300028380 | Switchgrass Rhizosphere | MKSHKPTLFCESRAGERGAALITAVLLSLLLLAAGGILILTSTMTGITARDSTAE |
Ga0268265_123156022 | 3300028380 | Switchgrass Rhizosphere | MSSHQPAFKNRSNEKGAALITAVLLSLLLLAAGGTLILTTTMTGITARDSTAEMQ |
Ga0268264_120488771 | 3300028381 | Switchgrass Rhizosphere | MRSHKPVSHCESRAGERGAALITAVLLSLLLLAAGGILILTSTMTGITARDSTAEM |
Ga0310813_108243911 | 3300031716 | Soil | MRSHEYYKNRAGERGAALITAVLLSLLLLAAGGILILTSTMTGIT |
Ga0310813_116771882 | 3300031716 | Soil | MRTLKPTSNRAGEKGAALITAVLLSMLLLAAGGTLVL |
Ga0307415_1005628773 | 3300032126 | Rhizosphere | MRSQKPIRTFESSVGERGAALITAVLLSLLLLAAGGTLIL |
⦗Top⦘ |