| Basic Information | |
|---|---|
| Family ID | F084389 |
| Family Type | Metagenome |
| Number of Sequences | 112 |
| Average Sequence Length | 47 residues |
| Representative Sequence | RIKANWASSEGAEARTDALRITHTWIRTRGTWQIIGGMSAPVNANGQ |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.79 % |
| % of genes near scaffold ends (potentially truncated) | 97.32 % |
| % of genes from short scaffolds (< 2000 bps) | 91.96 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (21.429 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.143 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (66.964 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 40.00% Coil/Unstructured: 60.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF08002 | DUF1697 | 27.68 |
| PF00561 | Abhydrolase_1 | 5.36 |
| PF03734 | YkuD | 4.46 |
| PF02630 | SCO1-SenC | 3.57 |
| PF00248 | Aldo_ket_red | 2.68 |
| PF00106 | adh_short | 1.79 |
| PF00211 | Guanylate_cyc | 1.79 |
| PF12697 | Abhydrolase_6 | 1.79 |
| PF16864 | Dimerisation2 | 1.79 |
| PF02774 | Semialdhyde_dhC | 0.89 |
| PF02518 | HATPase_c | 0.89 |
| PF13181 | TPR_8 | 0.89 |
| PF06580 | His_kinase | 0.89 |
| PF01272 | GreA_GreB | 0.89 |
| PF12804 | NTP_transf_3 | 0.89 |
| PF13466 | STAS_2 | 0.89 |
| PF01118 | Semialdhyde_dh | 0.89 |
| PF13489 | Methyltransf_23 | 0.89 |
| PF00583 | Acetyltransf_1 | 0.89 |
| PF06736 | TMEM175 | 0.89 |
| PF00072 | Response_reg | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG3797 | Uncharacterized conserved protein, DUF1697 family | Function unknown [S] | 27.68 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 4.46 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 4.46 |
| COG1225 | Peroxiredoxin | Posttranslational modification, protein turnover, chaperones [O] | 3.57 |
| COG1999 | Cytochrome oxidase Cu insertion factor, SCO1/SenC/PrrC family | Posttranslational modification, protein turnover, chaperones [O] | 3.57 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 1.79 |
| COG0002 | N-acetyl-gamma-glutamylphosphate reductase | Amino acid transport and metabolism [E] | 0.89 |
| COG0136 | Aspartate-semialdehyde dehydrogenase | Amino acid transport and metabolism [E] | 0.89 |
| COG0782 | Transcription elongation factor, GreA/GreB family | Transcription [K] | 0.89 |
| COG2972 | Sensor histidine kinase YesM | Signal transduction mechanisms [T] | 0.89 |
| COG3275 | Sensor histidine kinase, LytS/YehU family | Signal transduction mechanisms [T] | 0.89 |
| COG3548 | Uncharacterized membrane protein | Function unknown [S] | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_17165699 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1257 | Open in IMG/M |
| 2170459022|GZEQPF102H8JBE | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 545 | Open in IMG/M |
| 2189573000|GPBTN7E02I7LSS | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 503 | Open in IMG/M |
| 2228664022|INPgaii200_c1069081 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 620 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100725253 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 702 | Open in IMG/M |
| 3300000890|JGI11643J12802_11629366 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1087 | Open in IMG/M |
| 3300000956|JGI10216J12902_120472137 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 542 | Open in IMG/M |
| 3300001431|F14TB_103283573 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300002126|JGI24035J26624_1021581 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 681 | Open in IMG/M |
| 3300002128|JGI24036J26619_10037507 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300002899|JGIcombinedJ43975_10107594 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 515 | Open in IMG/M |
| 3300004643|Ga0062591_101996752 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 598 | Open in IMG/M |
| 3300005172|Ga0066683_10819457 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300005177|Ga0066690_10011048 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4632 | Open in IMG/M |
| 3300005179|Ga0066684_10799634 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 623 | Open in IMG/M |
| 3300005180|Ga0066685_11162968 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 501 | Open in IMG/M |
| 3300005184|Ga0066671_10953647 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 541 | Open in IMG/M |
| 3300005330|Ga0070690_100184564 | All Organisms → cellular organisms → Bacteria | 1443 | Open in IMG/M |
| 3300005332|Ga0066388_105309719 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 653 | Open in IMG/M |
| 3300005344|Ga0070661_100722605 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 813 | Open in IMG/M |
| 3300005364|Ga0070673_102068802 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 541 | Open in IMG/M |
| 3300005438|Ga0070701_11234157 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300005439|Ga0070711_101268825 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300005439|Ga0070711_102076368 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 500 | Open in IMG/M |
| 3300005545|Ga0070695_100499376 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 941 | Open in IMG/M |
| 3300005556|Ga0066707_10021996 | All Organisms → cellular organisms → Bacteria | 3401 | Open in IMG/M |
| 3300005574|Ga0066694_10213107 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 917 | Open in IMG/M |
| 3300005574|Ga0066694_10436940 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300005587|Ga0066654_10716126 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 562 | Open in IMG/M |
| 3300005764|Ga0066903_100224433 | All Organisms → cellular organisms → Bacteria | 2854 | Open in IMG/M |
| 3300005764|Ga0066903_105358869 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 677 | Open in IMG/M |
| 3300006032|Ga0066696_10962559 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 543 | Open in IMG/M |
| 3300006237|Ga0097621_100269238 | All Organisms → cellular organisms → Bacteria | 1496 | Open in IMG/M |
| 3300006791|Ga0066653_10623363 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 550 | Open in IMG/M |
| 3300006796|Ga0066665_10461642 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1046 | Open in IMG/M |
| 3300006797|Ga0066659_10058230 | All Organisms → cellular organisms → Bacteria | 2474 | Open in IMG/M |
| 3300006854|Ga0075425_102336563 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 594 | Open in IMG/M |
| 3300009012|Ga0066710_100041697 | All Organisms → cellular organisms → Bacteria | 5548 | Open in IMG/M |
| 3300009012|Ga0066710_104010773 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 551 | Open in IMG/M |
| 3300009137|Ga0066709_100994980 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1227 | Open in IMG/M |
| 3300009137|Ga0066709_103270005 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 590 | Open in IMG/M |
| 3300009137|Ga0066709_104149550 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 527 | Open in IMG/M |
| 3300009553|Ga0105249_11563730 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 732 | Open in IMG/M |
| 3300010043|Ga0126380_10978774 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 710 | Open in IMG/M |
| 3300010304|Ga0134088_10483286 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300010322|Ga0134084_10046714 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1263 | Open in IMG/M |
| 3300010323|Ga0134086_10438585 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 531 | Open in IMG/M |
| 3300010359|Ga0126376_11533269 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 696 | Open in IMG/M |
| 3300010361|Ga0126378_10631399 | All Organisms → cellular organisms → Bacteria | 1185 | Open in IMG/M |
| 3300010361|Ga0126378_12193314 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300010362|Ga0126377_11093294 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 866 | Open in IMG/M |
| 3300010362|Ga0126377_11934176 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 666 | Open in IMG/M |
| 3300010398|Ga0126383_11435227 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 780 | Open in IMG/M |
| 3300010398|Ga0126383_11980527 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 670 | Open in IMG/M |
| 3300010399|Ga0134127_10556497 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 1169 | Open in IMG/M |
| 3300011271|Ga0137393_10472920 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1075 | Open in IMG/M |
| 3300012198|Ga0137364_10069838 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2400 | Open in IMG/M |
| 3300012198|Ga0137364_10906444 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 667 | Open in IMG/M |
| 3300012200|Ga0137382_10553741 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 819 | Open in IMG/M |
| 3300012206|Ga0137380_10642905 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 925 | Open in IMG/M |
| 3300012207|Ga0137381_10728274 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 861 | Open in IMG/M |
| 3300012209|Ga0137379_11385747 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 607 | Open in IMG/M |
| 3300012211|Ga0137377_10525896 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1121 | Open in IMG/M |
| 3300012211|Ga0137377_11228585 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 679 | Open in IMG/M |
| 3300012350|Ga0137372_10504051 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 900 | Open in IMG/M |
| 3300012354|Ga0137366_10705941 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 719 | Open in IMG/M |
| 3300012356|Ga0137371_10457074 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300012358|Ga0137368_10134068 | All Organisms → cellular organisms → Bacteria | 1853 | Open in IMG/M |
| 3300012360|Ga0137375_10239372 | All Organisms → cellular organisms → Bacteria | 1685 | Open in IMG/M |
| 3300012362|Ga0137361_11436609 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 613 | Open in IMG/M |
| 3300012685|Ga0137397_10115958 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1971 | Open in IMG/M |
| 3300012929|Ga0137404_10355989 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
| 3300012948|Ga0126375_10231346 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1237 | Open in IMG/M |
| 3300012948|Ga0126375_11723488 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300012955|Ga0164298_10719413 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300012957|Ga0164303_10313920 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 930 | Open in IMG/M |
| 3300012976|Ga0134076_10478245 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 566 | Open in IMG/M |
| 3300012984|Ga0164309_10315733 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
| 3300012989|Ga0164305_10913526 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300013307|Ga0157372_11916762 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 681 | Open in IMG/M |
| 3300014166|Ga0134079_10065097 | All Organisms → cellular organisms → Bacteria | 1317 | Open in IMG/M |
| 3300015357|Ga0134072_10101382 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300016294|Ga0182041_10416359 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1147 | Open in IMG/M |
| 3300016371|Ga0182034_10977988 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 730 | Open in IMG/M |
| 3300018431|Ga0066655_10750037 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 662 | Open in IMG/M |
| 3300018433|Ga0066667_11136891 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300018482|Ga0066669_12017673 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300019362|Ga0173479_10053495 | All Organisms → cellular organisms → Bacteria | 1335 | Open in IMG/M |
| 3300019789|Ga0137408_1026033 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1446 | Open in IMG/M |
| 3300019885|Ga0193747_1088171 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 759 | Open in IMG/M |
| 3300020018|Ga0193721_1000448 | All Organisms → cellular organisms → Bacteria | 11688 | Open in IMG/M |
| 3300021411|Ga0193709_1079738 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 730 | Open in IMG/M |
| 3300021475|Ga0210392_10160923 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1542 | Open in IMG/M |
| 3300021560|Ga0126371_11409069 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300024279|Ga0247692_1005583 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2035 | Open in IMG/M |
| 3300024331|Ga0247668_1066310 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 730 | Open in IMG/M |
| 3300025915|Ga0207693_10661278 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 811 | Open in IMG/M |
| 3300025925|Ga0207650_10791822 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 803 | Open in IMG/M |
| 3300026307|Ga0209469_1009557 | All Organisms → cellular organisms → Bacteria | 3708 | Open in IMG/M |
| 3300026307|Ga0209469_1074288 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1027 | Open in IMG/M |
| 3300026312|Ga0209153_1149795 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 872 | Open in IMG/M |
| 3300026313|Ga0209761_1191286 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 913 | Open in IMG/M |
| 3300026323|Ga0209472_1128114 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300026330|Ga0209473_1321477 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300026490|Ga0257153_1063094 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 751 | Open in IMG/M |
| 3300026547|Ga0209156_10214526 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 912 | Open in IMG/M |
| 3300028146|Ga0247682_1040007 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 840 | Open in IMG/M |
| 3300028708|Ga0307295_10051031 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1068 | Open in IMG/M |
| 3300028782|Ga0307306_10117613 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 719 | Open in IMG/M |
| 3300028799|Ga0307284_10151605 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 894 | Open in IMG/M |
| 3300028885|Ga0307304_10039947 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1693 | Open in IMG/M |
| 3300031847|Ga0310907_10818696 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 522 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 21.43% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 16.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.71% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.82% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 8.04% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.46% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.46% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.89% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.89% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.89% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.89% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2170459022 | Grass soil microbial communities from Rothamsted Park, UK - FA2 (control condition) | Environmental | Open in IMG/M |
| 2189573000 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms) | Environmental | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Host-Associated | Open in IMG/M |
| 3300002128 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Environmental | Open in IMG/M |
| 3300002899 | Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607) | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300021411 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3c2 | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024279 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33 | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300028146 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23 | Environmental | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_02706070 | 2088090014 | Soil | VNWATSEGVEVRKDALRITHTWIRTHGTWQIVGGMSAPVNAEGK |
| FA2_06573320 | 2170459022 | Grass Soil | AEIKTDSLRITHTWTRTPGRWQIIGGMSSPVNATGQ |
| N55_05458150 | 2189573000 | Grass Soil | NGEGAEARTDRLRITHTWIRTGGTWQIIGGMSSPVNAEGK |
| INPgaii200_10690812 | 2228664022 | Soil | ADIAINHYRIKLNWARIDNGEAARTDGLRITHTWIRIGDRWQIIGGMSAPVNPDGK |
| INPhiseqgaiiFebDRAFT_1007252532 | 3300000364 | Soil | IKATWATSEGVEVRKDILRITHTWIRTHGTWQILGGMSAPVNSEGK* |
| JGI11643J12802_116293663 | 3300000890 | Soil | RINMTWANSAGAEVRTDRMRITHTWIRAQDTWQIIGGMSSPVNANSQ* |
| JGI10216J12902_1204721372 | 3300000956 | Soil | WADGAGAEVRTDRLRITHTWTRTHGAWHIIGGMSSPVNADGK* |
| F14TB_1032835732 | 3300001431 | Soil | RIKITWANGEGAEVKNDALRIMHTWLRTDGTWQIAGGMSAPVNAEGK* |
| JGI24035J26624_10215811 | 3300002126 | Corn, Switchgrass And Miscanthus Rhizosphere | DLAMDYYRIKATWANSTGAEVKTDRIRITHTWIRTAGTWQIIGGMSSPVDATGQ* |
| JGI24036J26619_100375071 | 3300002128 | Corn, Switchgrass And Miscanthus Rhizosphere | MDYYRIKATWTDSTGAEVRTDGLRITHTWTRTHGTWQIIGGMSSPVNATGQ* |
| JGIcombinedJ43975_101075942 | 3300002899 | Soil | YRIKATWAASDKSKVRTDALRITHTWIRTHDTWQILGGMSAPVNEKGQ* |
| Ga0062591_1019967522 | 3300004643 | Soil | YRIKANWASSDTGEVVRTDAMRITHTWIRTNGTWQILGGMSAPVNADGK* |
| Ga0066683_108194571 | 3300005172 | Soil | WATSEGVEVRKDTLRITHTWIRTHGTWQILGGMSAPVNSEGK* |
| Ga0066690_100110487 | 3300005177 | Soil | RIKATWANSKGVEVKTDALRITHTWIRTRDTWQIIAGMSAQVNAEGK* |
| Ga0066684_107996342 | 3300005179 | Soil | ANGAGAEGKTDRLRITHTWIRTHGTWQIIGGMSSPLTATGQ* |
| Ga0066685_111629681 | 3300005180 | Soil | YYRINATWANGAGVEVRTDRLRITHTWTRTHGTWQIIGGMSLPCERGG* |
| Ga0066671_109536471 | 3300005184 | Soil | RATWSGEKQPGSKAEALRITHTWIRHDGTWQIFGGMSAPVNAQGK* |
| Ga0070690_1001845642 | 3300005330 | Switchgrass Rhizosphere | GDLAMDYYRIKATWANSTGAEVKTDRIRITHTWIRKDGTWQIIGGMSSPVDATGQ* |
| Ga0066388_1053097191 | 3300005332 | Tropical Forest Soil | DIALNYYRISLTWANRQGAEFRTDKLRITHTWIRTHDTWQIIGGMSSPANADGQ* |
| Ga0070661_1007226051 | 3300005344 | Corn Rhizosphere | DYYRIKATWANSTGAEVKTDRIRITHTWIRKEGTWQIIGGMSSPVNTAGQ* |
| Ga0070673_1020688022 | 3300005364 | Switchgrass Rhizosphere | RIKATWTNTAGAEVKNDRMRITHTWIRTHGMWQIIGGMSAPVNAEGQ* |
| Ga0070701_112341571 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | TGDLALDYYRIKATWANSTGAEVRTDRLRITHTWTRTHGTWQIIGGMSSPVNTAGR* |
| Ga0070711_1012688251 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MDYYRIKATWANSTGAEVRTDSLRITHTWTRTHGTWQIIGGMSSPVNATGQ* |
| Ga0070711_1020763681 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | INHYRIKATWPNSEGAEVKTDALRITHTWIRTNRTWQILGGMSVPVSDKGQ* |
| Ga0070695_1004993761 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | ATWTNTAGAEVKNDRMRITHTWIRTHGMWQIIGGMSAPVNAEGQ* |
| Ga0066707_100219961 | 3300005556 | Soil | IKTDAFRITHTWMRTHGTWQILGGMSAPVNSEGK* |
| Ga0066694_102131072 | 3300005574 | Soil | LAIHVTGDVAINHYRIEATRAASDDSKVRTDVLRITHTWVRAHDTWQILGGISAPVNDKGQ* |
| Ga0066694_104369401 | 3300005574 | Soil | DYYRINATWANSQGTEVRTDRLRITHTWIRTGGTWQIIGGMSSPVNAESK* |
| Ga0066654_107161261 | 3300005587 | Soil | SKVRTDVLRITHTWVRAHDTWQILGGISAPVNDKGQ* |
| Ga0066903_1002244333 | 3300005764 | Tropical Forest Soil | MNWAKGEQPETKNDTMRITHTWIRTDGTWQIIGGMSAPVNADGK* |
| Ga0066903_1053588691 | 3300005764 | Tropical Forest Soil | AGAEVRTDRIRVTHTWLRTHGDWQIVGGMSSPVNAEGQ* |
| Ga0066696_109625591 | 3300006032 | Soil | EGVGVKTDALRITHTWIRTHAIWQIIGGMSAPVNAEGK* |
| Ga0097621_1002692382 | 3300006237 | Miscanthus Rhizosphere | EAAGPEVTRITHTWIRIDGRWQILGGMSAPVNAEGK* |
| Ga0066653_106233631 | 3300006791 | Soil | VEARKDAFRITHTWIRTHGTWQILGGMSAPVDAEGK* |
| Ga0066665_104616421 | 3300006796 | Soil | GVEVRKDTLRITHTWIRTHGTWQILGGMSAPVNSEGK* |
| Ga0066659_100582301 | 3300006797 | Soil | VRKDTLRITHTWIRTHGTWQILGGMSAPVNSEGK* |
| Ga0075425_1023365632 | 3300006854 | Populus Rhizosphere | WANSTGAQVRSDRLRITHTWIRTRGTWQIIGGMSSPVNAEGK* |
| Ga0066710_10004169712 | 3300009012 | Grasslands Soil | AINHYRINAAWTNGEGGKVRTDRLRVTHTWIRTGGTWQIIGGMSSPVNTEGK |
| Ga0066710_1040107731 | 3300009012 | Grasslands Soil | IEQLAIQVTGDIAINHYRIKANWATSEGVEVRKDTLRITHSWIRTHGTWQILGGMSAPVNSEGK |
| Ga0066709_1009949801 | 3300009137 | Grasslands Soil | AEARTDALRITHTWIRTRGTWQIIGGMSAPVNANGQ* |
| Ga0066709_1032700051 | 3300009137 | Grasslands Soil | IEQLAIQVTGDIAINHYRIKANWATSEGVEVRKDTLRITHSWIRTHGTWQILGGMSAPVNSEGK* |
| Ga0066709_1041495502 | 3300009137 | Grasslands Soil | YRIKANWATSEGAEVRTDVLRITHTWIHTHGTWQILGGMSAPVNAKGQ* |
| Ga0105249_115637301 | 3300009553 | Switchgrass Rhizosphere | YRINANWANGAGAELRIDRLRITHTWIRTHDTWQIIGGMSSPVNADGQ* |
| Ga0126380_109787741 | 3300010043 | Tropical Forest Soil | VKITGDIAIDHYRIKLNWVRIDNGEAARTDGLRITHTWVRTGDTWQILGGMSAPVNSEGK |
| Ga0134088_104832861 | 3300010304 | Grasslands Soil | RIKANWASSEGAEARTDALRITHTWIRTRGTWQIIGGMSAPVNANGQ* |
| Ga0134084_100467141 | 3300010322 | Grasslands Soil | HYRIKANWASSEGAEARTDALRITHTWIRTRGTWQIIGGMSAPVNANGQ* |
| Ga0134086_104385851 | 3300010323 | Grasslands Soil | DIAMDYYRINATWANGAGAEVRTDRLRITHTWIRTHGTWQIIGGMSSPVNANGQ* |
| Ga0126376_115332692 | 3300010359 | Tropical Forest Soil | DIAMDYYRIKATWANSTGAEVTTDRIRITHTWIRTHGTWQIIGGMSSPVNADGQ* |
| Ga0126378_106313991 | 3300010361 | Tropical Forest Soil | IATNYYRIDFTWANSTGAEVKTDRMRITHTWIRTRGTWQIIGGMSSPVNATGQ* |
| Ga0126378_121933141 | 3300010361 | Tropical Forest Soil | RIKATWANREGAEVRTDALRITHTWLRTHGAWQIIGGMSAPVNSEGK* |
| Ga0126377_110932941 | 3300010362 | Tropical Forest Soil | YRIKITWANGQNAEARTDTMRITHTWIKTNGSWQIIGGMSAPVNADGK* |
| Ga0126377_119341762 | 3300010362 | Tropical Forest Soil | YYRIKATWANREGAEVRTDALRITHTWLRTHGAWQIIGGMSAPVNSEGK* |
| Ga0126383_114352271 | 3300010398 | Tropical Forest Soil | AIDHYRIKLNWARIDNGEAARTDGLRITHTWVRTGDTWQILGGMSAPVNSEGK* |
| Ga0126383_119805271 | 3300010398 | Tropical Forest Soil | IATNYYRIDFTWANSAGAEVKTDRLRITHTWIRTRGTWQIIGGMSSPVNETGR* |
| Ga0134127_105564971 | 3300010399 | Terrestrial Soil | KANWAKGNSGDILQTDAMRITHTWIRTNGTWQILGGMSAPVNEKGQ* |
| Ga0137393_104729202 | 3300011271 | Vadose Zone Soil | VAINHYRIKANWANNEGAEVRTDALRITHTWIRTHGTWQIIGGMSAPVNSEGK* |
| Ga0137364_100698384 | 3300012198 | Vadose Zone Soil | TGDVAINHYRIKATWAASDDSEVRTNVLRITHTWVRAHDTWQILGGMSAPVNDKGQ* |
| Ga0137364_109064442 | 3300012198 | Vadose Zone Soil | TWANNEGAEVRTDAFRITHTWIRTHDNWQIIGGMSAPVNPEGK* |
| Ga0137382_105537411 | 3300012200 | Vadose Zone Soil | TWADNEGVGVKTDALRITHTWIRTHGIWQIIGGMSAPVNAEGK* |
| Ga0137380_106429051 | 3300012206 | Vadose Zone Soil | NNEGAEVRTDVLRITHTWIRAHDTWQILGGMSAPVNEKGQ* |
| Ga0137381_107282742 | 3300012207 | Vadose Zone Soil | VHVTGDVAINHYRIKATWAASDDSKVRTDVLRITHTWVRAHDTWQILGGRPTTVNKKGQ* |
| Ga0137379_113857471 | 3300012209 | Vadose Zone Soil | WATSETAKVQTDALRITHTWIRTHGTWQILGGMSAPVNADGK* |
| Ga0137377_105258961 | 3300012211 | Vadose Zone Soil | KATWANNEGAEVRTDAFRITHTWIRTHDNWQIIGGMSAPVNPEGK* |
| Ga0137377_112285851 | 3300012211 | Vadose Zone Soil | IAINHYRINGAWTNGEGGKVRTDRLRITHTWIRTGGTWQIIGGMSSPVNTEGK* |
| Ga0137372_105040511 | 3300012350 | Vadose Zone Soil | WATSEGVELRKDTLRITHTWIRTHGTWQILGGMSAPVNSEGK* |
| Ga0137366_107059411 | 3300012354 | Vadose Zone Soil | SKVRTDVLRITHTWVRAHGTWQILGGMSAPINDKGQ* |
| Ga0137371_104570741 | 3300012356 | Vadose Zone Soil | ANWATSETAKARTDALRITHTWIRTRGAWQILGGMSAPVNEKGQ* |
| Ga0137368_101340681 | 3300012358 | Vadose Zone Soil | ATSEGVEVRKDALRITHTWIRTHGTWQILGGMSAPVDAEGK* |
| Ga0137375_102393721 | 3300012360 | Vadose Zone Soil | IKANWATSEGVEVRKDALRITHTWIRTHGTWQILGGMSAPVDAEGK* |
| Ga0137361_114366092 | 3300012362 | Vadose Zone Soil | AIDHYRIKATWSASDESKVRTDVLRITHTWVRAHDTWQILGGMSAPVNDEGQ* |
| Ga0137397_101159581 | 3300012685 | Vadose Zone Soil | GDIAMDYYRIKATWANSTGAEVRTDRIRITHTWFRTHGTWQIIGGMSSPVNATGQ* |
| Ga0137404_103559891 | 3300012929 | Vadose Zone Soil | ANWAASGTAKVRTDALRITHTWIRTHGTWQILGGMSAPVNAEGK* |
| Ga0126375_102313461 | 3300012948 | Tropical Forest Soil | TGKVVRTDALRITHTWIKTNGTWQIIGGMSAPVNADGK* |
| Ga0126375_117234882 | 3300012948 | Tropical Forest Soil | MTAGIAMDYYRINVTWANSAGTEVKTDRLPITHTWIRTHGTWQIIVGMSSPVNATGQ* |
| Ga0164298_107194131 | 3300012955 | Soil | IKATWANSTGAEVSTDRLRITHTWTLTHGTWQIIGGMSSPVNATGQ* |
| Ga0164303_103139201 | 3300012957 | Soil | LAMDYYRIKATWANSTGAEVKTDRIRITHTWIRTAGTWQIIGGMSSPVNTAGQ* |
| Ga0134076_104782451 | 3300012976 | Grasslands Soil | RIRANWANNEGAEVRTDVLRITHTWIRAHDTWQILGGMSAPVNEKGQ* |
| Ga0164309_103157331 | 3300012984 | Soil | KATWANSTGAEVKTDRIRITHTWIRKDGTWQIIGGMSSPVNTAGQ* |
| Ga0164305_109135261 | 3300012989 | Soil | GRTESNTEVIRITHTWLRAHGSWQIIGGMSAPVNAEGK* |
| Ga0157372_119167621 | 3300013307 | Corn Rhizosphere | IINWTNSTNTGADAITNKIRITHTWLRTRDTWVILGGMSAPVNEHGQ* |
| Ga0134079_100650971 | 3300014166 | Grasslands Soil | WTKKDTGEVARTDAMRITHTWIRTNGTWQIIGGMSAPVNADGK* |
| Ga0134072_101013821 | 3300015357 | Grasslands Soil | GDVAINYYRIKATWSNREGVEVKADALRITHTWIRTHGTWQIIAGMSAQVNAEGK* |
| Ga0182041_104163591 | 3300016294 | Soil | NGAGTEVKTDRLRITHAWIRTHGTWQIIGGMSSPVNATGQ |
| Ga0182034_109779881 | 3300016371 | Soil | ANSEGVEVRADKLRITHTWIRTGGTWQIIGGMSSPVNAKGK |
| Ga0066655_107500372 | 3300018431 | Grasslands Soil | DVAIDHYRIKATWAPSDDSKVRTDVLRITHTWIRAHDTWQILGGMSAPVNDKGQ |
| Ga0066667_111368911 | 3300018433 | Grasslands Soil | TSETAKARTDALRITHTWIRTRGAWQILGGMSAPVNEKGQ |
| Ga0066669_120176732 | 3300018482 | Grasslands Soil | TNHYQSKANGATSQPAKAMTDAWRITHTWIRTRGAWQILGGMSAPVNEKGQ |
| Ga0173479_100534952 | 3300019362 | Soil | DLAMDYYRIKATWADNTGAEVKTDRIRITHTWIRTHGTWQIIGGMSSPVNATGQ |
| Ga0137408_10260333 | 3300019789 | Vadose Zone Soil | ATNEGVEVRKDALRITHTWIRNHGTWQIVGGMSAPVNAKGQ |
| Ga0193747_10881711 | 3300019885 | Soil | IKATWAANDDSKVRTDVFRITHTWIRAHDTWQILGGMSAPVDDKGQ |
| Ga0193721_10004481 | 3300020018 | Soil | AANDDSKVRTDVFRITHTWIRAHDTWQILGGMSAPVDDKGQ |
| Ga0193709_10797382 | 3300021411 | Soil | WGGPRPTESKTEFLRITHTWICTHGAWQIIGGMSAPVNANGQ |
| Ga0210392_101609233 | 3300021475 | Soil | ANSTGAEVKTDSLRITHTWTRKHGTWQIIGGMSSPVNATGQ |
| Ga0126371_114090691 | 3300021560 | Tropical Forest Soil | AVDSQATRITHTWIRIDGRWQILGGMSAPVNAEGK |
| Ga0247692_10055832 | 3300024279 | Soil | TGPTESNTEILRATHTWLRTHGAWQIIGGMAAPVNAEGK |
| Ga0247668_10663101 | 3300024331 | Soil | GPTESNTEILRATHTWLRTHGAWQIIGGMAAPVNAEGK |
| Ga0207693_106612781 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | INATWANGAGAEVRTDRFRITHTWTRTHGTWQIIGGMSSPVNADGQ |
| Ga0207650_107918221 | 3300025925 | Switchgrass Rhizosphere | TQVTGDLAMDYYRIKATWANGTGAEVRTDRLRITHTWTRTHGTWQIIGGMSSPVNTAGR |
| Ga0209469_10095571 | 3300026307 | Soil | SEGVEVRKDTLRITHTWIRTHGTWQILGGMSAPVNSEGK |
| Ga0209469_10742881 | 3300026307 | Soil | WAPSDDSKVRTDVLRITHTWIRAHDTWQILGGMSAPVNDKGQ |
| Ga0209153_11497951 | 3300026312 | Soil | HYRIKLNWAKNDTGEVARTDAMRITHTWIRTNGAWQIIGGMSAPVNAAGK |
| Ga0209761_11912861 | 3300026313 | Grasslands Soil | SEGAEARTDALRITHTWIRTRGTWQIIGGMSAPVNANGQ |
| Ga0209472_11281141 | 3300026323 | Soil | PGPTESNTEILRATHTWLRTHGAWQIIGGMAAPVNAEGK |
| Ga0209473_13214771 | 3300026330 | Soil | IEQLAIQVTGDIAINYYRIKLNWATSEGVEARKDAFRVTHIWIRTHGTWQILGGMSAPVDAEGK |
| Ga0257153_10630942 | 3300026490 | Soil | IEQLAICVIGDVAIDHYRIKMNWANREGPDATTEALRITHTWIRTHGVWQIIGGMAAPVNSEGK |
| Ga0209156_102145263 | 3300026547 | Soil | TWAASDDSKVRTDVLRITHTWVRAHDTWQILGGMSAPVNDKGQ |
| Ga0247682_10400071 | 3300028146 | Soil | RIIAMWADSTGAEAKTDKMRITHTWIRTHGTWQIIGGMSSPVNANGR |
| Ga0307295_100510313 | 3300028708 | Soil | GDMAMDYYRIKATWADGTGAEVRTDRLRITHTWIRTHGTWQIIGGMSSPLNTAGQ |
| Ga0307306_101176131 | 3300028782 | Soil | YRIKATWADNTGAEVRTDGLRVAHAWTRTHGTWQIIGGMSSPVNATGQ |
| Ga0307284_101516051 | 3300028799 | Soil | ADNTGAEVRTDGLRVAHAWTRTHGTWQIIGGMSSPLNATGQ |
| Ga0307304_100399474 | 3300028885 | Soil | YRIKANWATNEGVEVRKDALRITHTWIHNHGTWQIVGGMSAPVNAKGQ |
| Ga0310907_108186961 | 3300031847 | Soil | NATWADETGAEVRTDRMRITHTWIRTHGTWQIIGGMSSPVNPEGQ |
| ⦗Top⦘ |