Metagenome Family F084378

Overview

Basic Information

• Family ID: F084378
• Family Type: Metagenome
• Number of Sequences: 112
• Average Sequence Length: 37 residues
• Representative Sequence: PIGVRSDEGDATAEAESIPLDCSGPKNLFVFYVIL
• Number of Associated Samples: 55
• Number of Associated Scaffolds: 112

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 3.64 %
• % of genes near scaffold ends (potentially truncated): 95.54 %
• % of genes from short scaffolds (< 2000 bps): 98.21 %
• Associated GOLD sequencing projects: 54
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.18

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (99.107 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (89.286 % of family members)
• Environment Ontology (ENVO): Unclassified (91.964 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant surface (91.964 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 11.11%
  β-sheet: 0.00%
  Coil/Unstructured: 88.89%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.11 %
All Organisms	root	All Organisms	0.89 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.11 %
cellular organisms	root	All Organisms → cellular organisms	0.89 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.11 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	0.89 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.11 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	0.89 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.11 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	0.89 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.11 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	0.89 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.11 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.89 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.11 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	0.89 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.11 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	0.89 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.11 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	0.89 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.11 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	0.89 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.11 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	0.89 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.11 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	0.89 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.11 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	0.89 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.11 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	0.89 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.11 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	0.89 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.11 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	0.89 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.11 %
BOP clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade	0.89 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.11 %
Oryzoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae	0.89 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.11 %
Oryzeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae	0.89 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.11 %
Oryzinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae	0.89 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.11 %
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	0.89 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300005334|Ga0068869_100465213	Not Available	1050
3300005334|Ga0068869_101531717	Not Available	592
3300005338|Ga0068868_100487644	Not Available	1077
3300006237|Ga0097621_100790642	Not Available	879
3300006881|Ga0068865_101440488	Not Available	616
3300013296|Ga0157374_10332866	Not Available	1506
3300013296|Ga0157374_12079027	Not Available	594
3300015267|Ga0182122_1027424	Not Available	658
3300015267|Ga0182122_1057797	Not Available	536
3300015268|Ga0182154_1028405	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	656
3300015275|Ga0182172_1005724	Not Available	1022
3300015275|Ga0182172_1042563	Not Available	598
3300015275|Ga0182172_1062678	Not Available	535
3300015277|Ga0182128_1012689	Not Available	837
3300015277|Ga0182128_1064221	Not Available	536
3300015279|Ga0182174_1043117	Not Available	617
3300015279|Ga0182174_1072011	Not Available	531
3300015279|Ga0182174_1083947	Not Available	505
3300015281|Ga0182160_1039677	Not Available	624
3300015282|Ga0182124_1028768	Not Available	678
3300015282|Ga0182124_1029755	Not Available	672
3300015283|Ga0182156_1035792	Not Available	655
3300015285|Ga0182186_1040299	Not Available	622
3300015288|Ga0182173_1032508	Not Available	666
3300015288|Ga0182173_1081418	Not Available	511
3300015288|Ga0182173_1084332	Not Available	506
3300015289|Ga0182138_1045436	Not Available	614
3300015291|Ga0182125_1014644	Not Available	855
3300015296|Ga0182157_1014819	Not Available	883
3300015296|Ga0182157_1037687	Not Available	679
3300015298|Ga0182106_1038903	Not Available	673
3300015298|Ga0182106_1100698	Not Available	505
3300015299|Ga0182107_1035260	Not Available	697
3300015299|Ga0182107_1072360	Not Available	564
3300015300|Ga0182108_1007557	Not Available	1084
3300015302|Ga0182143_1023991	Not Available	773
3300015302|Ga0182143_1073334	Not Available	561
3300015304|Ga0182112_1040025	Not Available	672
3300015305|Ga0182158_1005655	Not Available	1140
3300015307|Ga0182144_1018515	Not Available	844
3300015307|Ga0182144_1073746	Not Available	567
3300015307|Ga0182144_1087342	Not Available	538
3300015307|Ga0182144_1095396	Not Available	524
3300015314|Ga0182140_1009974	Not Available	1022
3300015314|Ga0182140_1057446	Not Available	625
3300015314|Ga0182140_1086821	Not Available	551
3300015321|Ga0182127_1040297	Not Available	713
3300015322|Ga0182110_1003172	Not Available	1434
3300015322|Ga0182110_1043361	Not Available	695
3300015322|Ga0182110_1120363	Not Available	508
3300015323|Ga0182129_1045651	Not Available	666
3300015341|Ga0182187_1122600	Not Available	601
3300015341|Ga0182187_1142268	Not Available	570
3300015344|Ga0182189_1093645	Not Available	701
3300015344|Ga0182189_1116648	Not Available	648
3300015344|Ga0182189_1122089	Not Available	638
3300015345|Ga0182111_1232313	Not Available	513
3300015346|Ga0182139_1129864	Not Available	643
3300015346|Ga0182139_1237838	Not Available	508
3300015351|Ga0182161_1219047	Not Available	545
3300015351|Ga0182161_1232962	Not Available	531
3300015355|Ga0182159_1081404	Not Available	932
3300015355|Ga0182159_1113413	Not Available	815
3300015355|Ga0182159_1192170	Not Available	654
3300015361|Ga0182145_1141283	Not Available	560
3300017404|Ga0182203_1103086	Not Available	586
3300017409|Ga0182204_1104718	Not Available	524
3300017409|Ga0182204_1118896	Not Available	503
3300017413|Ga0182222_1001543	Not Available	1512
3300017413|Ga0182222_1002897	Not Available	1276
3300017413|Ga0182222_1020183	Not Available	773
3300017413|Ga0182222_1086019	Not Available	534
3300017415|Ga0182202_1012400	Not Available	1050
3300017415|Ga0182202_1063261	Not Available	648
3300017420|Ga0182228_1062726	Not Available	655
3300017420|Ga0182228_1118610	Not Available	519
3300017424|Ga0182219_1051488	Not Available	686
3300017424|Ga0182219_1072234	Not Available	618
3300017424|Ga0182219_1081769	Not Available	596
3300017425|Ga0182224_1016750	Not Available	1014
3300017427|Ga0182190_1002944	Not Available	1816
3300017427|Ga0182190_1041791	Not Available	799
3300017427|Ga0182190_1160464	Not Available	507
3300017436|Ga0182209_1016581	Not Available	1036
3300017436|Ga0182209_1021985	Not Available	956
3300017436|Ga0182209_1037569	Not Available	815
3300017436|Ga0182209_1118417	Not Available	570
3300017438|Ga0182191_1057633	Not Available	739
3300017438|Ga0182191_1106929	Not Available	603
3300017438|Ga0182191_1117791	Not Available	584
3300017442|Ga0182221_1050131	Not Available	733
3300017442|Ga0182221_1077227	Not Available	643
3300017442|Ga0182221_1148045	Not Available	526
3300017443|Ga0182193_1118297	Not Available	601
3300017683|Ga0182218_1054622	Not Available	690
3300017683|Ga0182218_1056437	Not Available	683
3300017684|Ga0182225_1026924	Not Available	847
3300017684|Ga0182225_1080598	Not Available	603
3300017684|Ga0182225_1096044	Not Available	571
3300017684|Ga0182225_1143798	Not Available	503
3300017685|Ga0182227_1118943	Not Available	529
3300017686|Ga0182205_1066282	Not Available	691
3300017686|Ga0182205_1080280	Not Available	649
3300017686|Ga0182205_1145196	Not Available	532
3300017690|Ga0182223_1024189	Not Available	785
3300017690|Ga0182223_1057914	Not Available	622
3300021060|Ga0182232_1021965	Not Available	1108
3300021060|Ga0182232_1045218	Not Available	736
3300021060|Ga0182232_1048335	Not Available	708
3300025942|Ga0207689_10637493	Not Available	897

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Category

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	91.96%
Rhizoplane	Host-Associated → Plants → Rhizoplane	5.36%
Rhizosphere	Host-Associated → Plants → Rhizosphere	1.79%
Roots	Host-Associated → Plants → Roots	0.89%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	91.96%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	5.36%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	1.79%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.89%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	91.96%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	5.36%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	1.79%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.89%

Habitat

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	89.29%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	5.36%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	2.68%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.79%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.89%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated
3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Host-Associated
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated
3300021060	Phyllosphere microbial comminities from miscanthus, Michigan, USA - G6R3_NF_07NOV2016_LD2 MG	Host-Associated
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068869_1004652132	3300005334	Miscanthus Rhizosphere	MVEIVFRRPISVTSDEGDATAEAESIPLDYSGPENLFVFFVIL*
Ga0068869_1015317171	3300005334	Miscanthus Rhizosphere	CSVRPVGVKSDEGDATAEAESIPLDCSGPRNIFVFCVIL*
Ga0068868_1004876441	3300005338	Miscanthus Rhizosphere	MLEIMSVRPVGVTSDEGDATAEAESIPLDCLGPGNLFVFFVIL*
Ga0068868_1022142421	3300005338	Miscanthus Rhizosphere	LDNRKMLEIMNIRPVGVISDEGDATVEAKSIPLDCLGPRNHFVFL*
Ga0097621_1007906421	3300006237	Miscanthus Rhizosphere	MLEIGSVRPIGVKSDEGDATAEAESIPLDCSGPRNLFVFFV*
Ga0068865_1014404881	3300006881	Miscanthus Rhizosphere	CSVRPVGVRSDEGDVTVEAKSILLDCSGPRNLFVFM*
Ga0157374_103328661	3300013296	Miscanthus Rhizosphere	PIGVRSDEGDATAEAESIPFDCSGPGNLFVFCVIL*
Ga0157374_120790271	3300013296	Miscanthus Rhizosphere	VGVRSDEGDVAAEAESIPLDCSGPGNIFVFYVIL*
Ga0182122_10274241	3300015267	Miscanthus Phyllosphere	HPVGVRSDEGDAMAEPESIPLGCSGTANLFVFCVNL*
Ga0182122_10577971	3300015267	Miscanthus Phyllosphere	PIGVRSDEGDATAEAESIPLDCSGPKNLFVFYVIL*
Ga0182154_10284051	3300015268	Miscanthus Phyllosphere	PVGVRSDEGDATAEVESIPLGCLGTRNLFIFCVIL*
Ga0182172_10057241	3300015275	Miscanthus Phyllosphere	SVHPIGVRSDEGDDTIEAESIPLDCSGPGNLFFYVIL*
Ga0182172_10425631	3300015275	Miscanthus Phyllosphere	CSVHPVGVRSDEGDVTAEAESILLDCSGPRNLFVFYVIL*
Ga0182172_10626781	3300015275	Miscanthus Phyllosphere	PIGARSDEGDATAEAESIPLDCSGLGNHFVFCVI*
Ga0182128_10126891	3300015277	Miscanthus Phyllosphere	VHLVGVRSDEGDATAEPESIPLGCSGTTNLFVFCVNL*
Ga0182128_10642211	3300015277	Miscanthus Phyllosphere	VRPVGVRSDEGDATVEAESIPLDCSVPGNHFVFFV*
Ga0182174_10431171	3300015279	Miscanthus Phyllosphere	SVRLVGFRSDEGDVTAEAESIPLECSGPGNLFVFM*
Ga0182174_10720111	3300015279	Miscanthus Phyllosphere	ICPIGVRSDEGDATAEAESIPLDCSGPKNLFVFYVIL*
Ga0182174_10839471	3300015279	Miscanthus Phyllosphere	VRPVGVRSDEGDATAEAESIPLDCLGPRNLFVFM*
Ga0182160_10396771	3300015281	Miscanthus Phyllosphere	NICPVGVRSDEGDAMVEAESIPLDCSDPRNLFVFM*
Ga0182124_10287682	3300015282	Miscanthus Phyllosphere	PIGVRSDEGDATAEAESIPLDCSGHRNLFLCVIL*
Ga0182124_10297552	3300015282	Miscanthus Phyllosphere	PVGVRSGEGDAMPKAESIPLDYSGPRNIFVFCVIL*
Ga0182156_10357921	3300015283	Miscanthus Phyllosphere	SVRPVGVRSDEGDVTAEAESILLDCSGPRNLFVFM*
Ga0182186_10402992	3300015285	Miscanthus Phyllosphere	RLCSVRPIGFRTDEGDTTAEAKSIPLDCSGPGNHFVFFVIL*
Ga0182173_10325081	3300015288	Miscanthus Phyllosphere	CFVHPVGVSSAEGDATAEAESIPLDCSGPRNSFIFYVIL*
Ga0182173_10814181	3300015288	Miscanthus Phyllosphere	VRLVGFRSDEGDVTAEAESIPLDCSGPRNLFVFM*
Ga0182173_10843321	3300015288	Miscanthus Phyllosphere	SVRHIGVRNDEGDATTEAESIKLGCSGTRNLFVFCVIL*
Ga0182138_10454361	3300015289	Miscanthus Phyllosphere	PVCVRSDEGDVTAEAESILLDCLGPGNHFVFYVIL*
Ga0182125_10146441	3300015291	Miscanthus Phyllosphere	RSDEGDAMAEAESIPFDCLGPGNLFVFCVILYEGKIN*
Ga0182157_10148191	3300015296	Miscanthus Phyllosphere	PVGVTSDEGDATAEAESIPLDCSGPRNLCVFCVIL*
Ga0182157_10376871	3300015296	Miscanthus Phyllosphere	CNICPVTVRRDEGDATAEAESIPLDCSDPRNLFVFM*
Ga0182106_10389031	3300015298	Miscanthus Phyllosphere	PIGVRSDEGDATAEVDFIPLDCSGPGNNFVFCVAL*
Ga0182106_11006981	3300015298	Miscanthus Phyllosphere	VRPVGVTSDEGDATAEAESIPLDCSGPRNLFIFCVIL*
Ga0182107_10352601	3300015299	Miscanthus Phyllosphere	RPVGVRSDEGDATTEAESIPLDCLGPRNLFVFCVDL*
Ga0182107_10723602	3300015299	Miscanthus Phyllosphere	VRPVGVRSDEGDATTEAESIPLDCLGPRNLFVSCVIL*
Ga0182108_10075573	3300015300	Miscanthus Phyllosphere	RLVGVRSDEGDVTAEAESMPLHCSGPRNLFVFYVFL*
Ga0182143_10239911	3300015302	Miscanthus Phyllosphere	LCSICPIGARSDEGDATAEVDFIPLHCSGPGNLFVF
Ga0182143_10733342	3300015302	Miscanthus Phyllosphere	SVRPIGVRSDEGDATAEAESIPFDCSGPRNLFVFCVIL*
Ga0182143_11032991	3300015302	Miscanthus Phyllosphere	RLDNRKMLGLCSVRPIGVRSDEGDATAEADFIPLDCLGPGNLFVFCVVL*
Ga0182112_10400252	3300015304	Miscanthus Phyllosphere	SVRPIGVRSDEGDATVEAESISLGYSGIGNLFVFCVIL*
Ga0182158_10056551	3300015305	Miscanthus Phyllosphere	CSVRPVGVRSDEGDAMAEVESIPLDCSSPGNLFVFM*
Ga0182144_10185151	3300015307	Miscanthus Phyllosphere	VGVRSDEGDVTAEAESMPLHCSGPRNLFVFYVIL*
Ga0182144_10737462	3300015307	Miscanthus Phyllosphere	LVGVRSDEGDVTAEAESMPLHCSGPRNLFVFYVFL*
Ga0182144_10873421	3300015307	Miscanthus Phyllosphere	SYSARPVGVRSDEGDATVEVESIPLGYSGTGNLFVFCVIL*
Ga0182144_10953961	3300015307	Miscanthus Phyllosphere	PVCVRSDEGDATVEAESIPLDCSGPGNHFVFCVIL*
Ga0182140_10099741	3300015314	Miscanthus Phyllosphere	VRPVCVRSDEGDVTAEAESILLDCSGPRNVFVFYVIL*
Ga0182140_10574461	3300015314	Miscanthus Phyllosphere	RSCSVHPVGVRSDEGDATVEAESIPLDYSGPRNLFVFCVIL*
Ga0182140_10868211	3300015314	Miscanthus Phyllosphere	CSVHPVGVRSDEGDVTAEAESIPLDCSGPGNLFVFYVIL*
Ga0182127_10402971	3300015321	Miscanthus Phyllosphere	PVGVRSDEGDVTAEAESILLDCSGPRNLFVFYVIL*
Ga0182110_10031721	3300015322	Miscanthus Phyllosphere	CSVRPVGVRSDEGDVTTEAESILLDCSGPGNLFVFYVIL*
Ga0182110_10433611	3300015322	Miscanthus Phyllosphere	PVGVRSDEGDATAEAESIPLGCSGTANLFVFCVNL*
Ga0182110_11203631	3300015322	Miscanthus Phyllosphere	HPVGVRSDEGDATAEAESIPFDCSGPENLFVFYVIL*
Ga0182129_10456511	3300015323	Miscanthus Phyllosphere	ICPIGVKSDEGDAMAEAESIPFDCLGPRNLFDFCEIL*
Ga0182187_11226001	3300015341	Miscanthus Phyllosphere	HPVGVISDEGDATTEAKYIPLDCSGHGNLFVFYVIL*
Ga0182187_11422681	3300015341	Miscanthus Phyllosphere	ICPIGVRSDEGDATAEAESIPLDCLGPKNLFVFYVIL*
Ga0182189_10936451	3300015344	Miscanthus Phyllosphere	CSVHLVGFRSDEGDVTAEAESIPLDCSGPGNLFVFYVIL*
Ga0182189_11166481	3300015344	Miscanthus Phyllosphere	VRPVGVRSDEGDAMAEAESILFDCSGPGNLFVFCVIL*
Ga0182189_11220891	3300015344	Miscanthus Phyllosphere	GVRSDEGDAMAEAESIPLGCSDTRNLFVFCVILY*
Ga0182111_12323131	3300015345	Miscanthus Phyllosphere	RPVGVTSDEGHATAEAESIPLAFSGTGNLFVFFAIL*
Ga0182139_11298642	3300015346	Miscanthus Phyllosphere	VRPVGVRSDEGDAMAEAESIPFDCSGPGNLFVFCVIF*
Ga0182139_12378381	3300015346	Miscanthus Phyllosphere	VRLVGFRSDEGDVKAEAESMPLDCSGPGNLFVFI*
Ga0182161_12190471	3300015351	Miscanthus Phyllosphere	VRHIGVRNDEGDATTEAESIKLGCSGTGNLFVFCVIL*
Ga0182161_12329621	3300015351	Miscanthus Phyllosphere	CSVRPVGVTSDEGDATAEAESIPLDCLGPGNLFVFFVIL*
Ga0182159_10814041	3300015355	Miscanthus Phyllosphere	RPVGVKSEGDATGEVESIPLGCSTTGNLFVFCVIL*
Ga0182159_11134132	3300015355	Miscanthus Phyllosphere	SGFVRPVGVKSDGDATGEVEYIPLGCSGTGNLFVFFVIL*
Ga0182159_11921701	3300015355	Miscanthus Phyllosphere	RPVGVRSDEGDATAEAESIPLDCSGPRNFFFCVIL*
Ga0182145_11412831	3300015361	Miscanthus Phyllosphere	CPIGVRSDEGDATAEAESIPLDCSGPKNLFVFYVIL*
Ga0182203_11030861	3300017404	Miscanthus Phyllosphere	RSCNIRPIGVRSDEGDATAEAKSIPLDCSDPGDLLVFM
Ga0182204_11047181	3300017409	Miscanthus Phyllosphere	LVGVRSDEGDVTAEAESMPLHCSGPRNLFVFYVFL
Ga0182204_11188961	3300017409	Miscanthus Phyllosphere	VRPIGVRSDEGDATIEAESIPLDYSGPGHLFFYVIL
Ga0182222_10015431	3300017413	Miscanthus Phyllosphere	PVGVRSDEGDVTAEAESILLDCSGPRNLFVFYVIL
Ga0182222_10028971	3300017413	Miscanthus Phyllosphere	RPVGVRSDEGDATAEAESIPLGCSGTRNLYIFCVIL
Ga0182222_10201831	3300017413	Miscanthus Phyllosphere	SCSVRPIGVRSDEGDATIEAESIPLDCSGPGHLFFYVIL
Ga0182222_10860191	3300017413	Miscanthus Phyllosphere	VRPVGVRSDEGDMTAEAESILLDCSGPQNLFVFYVIL
Ga0182202_10124001	3300017415	Miscanthus Phyllosphere	SFSVRPVGVRSDEGYATTEAESIPSGFSGTGNLFFSLIL
Ga0182202_10632611	3300017415	Miscanthus Phyllosphere	PPIGVRSDEGDATTEAKSIPLGCSGSTNRFVFSVILLEGQIK
Ga0182228_10627261	3300017420	Miscanthus Phyllosphere	HPPRRFRSDEGDVTAEAESIPLDCSDPRNLFVFYVIL
Ga0182228_11186102	3300017420	Miscanthus Phyllosphere	VCPVGVRSDEGDVRVEAESILLDCSGPGNPFVFYVIL
Ga0182219_10514881	3300017424	Miscanthus Phyllosphere	ICPIGVRSDEGDATAEAESIPLDCSGPKNLFVFYVIL
Ga0182219_10722341	3300017424	Miscanthus Phyllosphere	SVHPVGVRSDEGDAMAEAKSIPLDCSCPRNHFVYL
Ga0182219_10817691	3300017424	Miscanthus Phyllosphere	LVGVRSDEGDVTAEAESMPLHCLGPRNLFVFYVIL
Ga0182224_10167501	3300017425	Miscanthus Phyllosphere	LVGFRSDEGDVTAEAESIPLDCSGPGNLFVFYVIL
Ga0182190_10029441	3300017427	Miscanthus Phyllosphere	CSVRPVGVRSDEGDATVEAESIPLDCSVPGNHFVFFV
Ga0182190_10417912	3300017427	Miscanthus Phyllosphere	SLRPVGVKTDEGDATAEAESIPLDCLGPGNSLFFCVILKEGQIK
Ga0182190_11604641	3300017427	Miscanthus Phyllosphere	CFVHPVGVRSDEGDATAEAESIPLDCLGPRNNFIFYVIL
Ga0182209_10165811	3300017436	Miscanthus Phyllosphere	CSICPIGVRSDEGDATAEAESIPLDCSGPKNLFVFYVIL
Ga0182209_10219851	3300017436	Miscanthus Phyllosphere	RPVGVRRDEGDAMVEAESIPFDCSGPGNLFVFCVIL
Ga0182209_10375691	3300017436	Miscanthus Phyllosphere	RPIGVKSDEGDATAEAKSIPLDCSGPGNLFHFLCNFV
Ga0182209_11184171	3300017436	Miscanthus Phyllosphere	RSCNICPVGVRSYEGDATAEAESVPLDFSGSGNLFVFFV
Ga0182191_10576331	3300017438	Miscanthus Phyllosphere	CSVRLVGFRSDEGDVTAEAESIPLDCSGPGNLFVFM
Ga0182191_11069291	3300017438	Miscanthus Phyllosphere	PVGVRSDEGDMTAEAESILLDCSGPQNLFVFYVIL
Ga0182191_11177912	3300017438	Miscanthus Phyllosphere	VHPVGVRSDEGDATGEAKHIPLGCSGTGNLFVFCVIL
Ga0182221_10501312	3300017442	Miscanthus Phyllosphere	PVGVRSDEGDATAEAESIPLDCSGPGNLFIFCVVF
Ga0182221_10772271	3300017442	Miscanthus Phyllosphere	PVSVRSDEGDAMAEAKSIPLDYLGPGTLFVFCVIL
Ga0182221_11480451	3300017442	Miscanthus Phyllosphere	PVGVRSDEGDVTAEAESILLDCLGPRNLFVFYVIL
Ga0182193_11182971	3300017443	Miscanthus Phyllosphere	PVGVRSDEGDATAEAESIPLGCLDTRKLFAFCVIL
Ga0182218_10546221	3300017683	Miscanthus Phyllosphere	VHPVGVRSDEGDATGEAKHIPLGCSGTGNLFVFYVIL
Ga0182218_10564371	3300017683	Miscanthus Phyllosphere	NICPIGVKSDEGDAMAEAESIPFGCLGPGNLFVFCAIL
Ga0182225_10269242	3300017684	Miscanthus Phyllosphere	SIRLVGVRSDEGDVTAEAESMPLHCSGPRNLFVFYVFL
Ga0182225_10805981	3300017684	Miscanthus Phyllosphere	SDEGDATTEAKSIPLGCSGSRNLFVFSIILLEGQIK
Ga0182225_10960442	3300017684	Miscanthus Phyllosphere	VHPVGVRSDEGDATAEAESIPFDCSGPENLFVFYVIL
Ga0182225_11437981	3300017684	Miscanthus Phyllosphere	PVGVTSDEGDATAEAESIPLDCSGPRNLFIFCVIL
Ga0182227_11189431	3300017685	Miscanthus Phyllosphere	VRLVGFRSDEGDVTAEAESIPLDCSGPGNLFVFYVIL
Ga0182205_10662822	3300017686	Miscanthus Phyllosphere	SVRPVGVRSDEGDATAEAESIPLDCLGPRNLFVFFV
Ga0182205_10802803	3300017686	Miscanthus Phyllosphere	CSVRPVGVRSDEGDATVEAESIPLGCSGTRNLFVFCVIL
Ga0182205_11451961	3300017686	Miscanthus Phyllosphere	PIGVRSDEGDVTAEAESIPLECLGPENLFVFCVVL
Ga0182223_10241891	3300017690	Miscanthus Phyllosphere	IRPVGVRSDERDATVEAESIPLGCSGTRNLFVFCVIL
Ga0182223_10579141	3300017690	Miscanthus Phyllosphere	VRPVGVRSDKGDATAEAESIPLDCLRPRNLFVSYVIL
Ga0182232_10219651	3300021060	Phyllosphere	YFVHPVGVKSEGDATGEVESIPLGCSTTGNIFVFCVIL
Ga0182232_10452181	3300021060	Phyllosphere	VHPVGVRSDEGDATVEAESIPLDYSGPRNLFVFCVIL
Ga0182232_10483351	3300021060	Phyllosphere	MLGLCSVRPICVRSDEGDATAEADFIPLDCLGPGNLFVFCVVL
Ga0207689_106374931	3300025942	Miscanthus Rhizosphere	VRPIGFRTDEGDTTAEAKSIPLDCSGPGNLFVFFVIL