| Basic Information | |
|---|---|
| Family ID | F084378 |
| Family Type | Metagenome |
| Number of Sequences | 112 |
| Average Sequence Length | 37 residues |
| Representative Sequence | PIGVRSDEGDATAEAESIPLDCSGPKNLFVFYVIL |
| Number of Associated Samples | 55 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 3.64 % |
| % of genes near scaffold ends (potentially truncated) | 95.54 % |
| % of genes from short scaffolds (< 2000 bps) | 98.21 % |
| Associated GOLD sequencing projects | 54 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.18 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (99.107 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (89.286 % of family members) |
| Environment Ontology (ENVO) | Unclassified (91.964 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (91.964 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 11.11% β-sheet: 0.00% Coil/Unstructured: 88.89% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 99.11 % |
| All Organisms | root | All Organisms | 0.89 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 89.29% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 5.36% |
| Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 2.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015267 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015268 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015275 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015277 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015279 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015281 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015282 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015283 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015285 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015288 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015289 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015291 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015296 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015298 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015299 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015300 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015302 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015304 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015305 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015307 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015314 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015321 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015322 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015323 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015341 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015344 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015345 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015346 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015351 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015355 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015361 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017404 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017409 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017413 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017415 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017420 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017424 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017425 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017427 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017436 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017438 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017442 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017443 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017683 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017684 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017685 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017686 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017690 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300021060 | Phyllosphere microbial comminities from miscanthus, Michigan, USA - G6R3_NF_07NOV2016_LD2 MG | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0068869_1004652132 | 3300005334 | Miscanthus Rhizosphere | MVEIVFRRPISVTSDEGDATAEAESIPLDYSGPENLFVFFVIL* |
| Ga0068869_1015317171 | 3300005334 | Miscanthus Rhizosphere | CSVRPVGVKSDEGDATAEAESIPLDCSGPRNIFVFCVIL* |
| Ga0068868_1004876441 | 3300005338 | Miscanthus Rhizosphere | MLEIMSVRPVGVTSDEGDATAEAESIPLDCLGPGNLFVFFVIL* |
| Ga0068868_1022142421 | 3300005338 | Miscanthus Rhizosphere | LDNRKMLEIMNIRPVGVISDEGDATVEAKSIPLDCLGPRNHFVFL* |
| Ga0097621_1007906421 | 3300006237 | Miscanthus Rhizosphere | MLEIGSVRPIGVKSDEGDATAEAESIPLDCSGPRNLFVFFV* |
| Ga0068865_1014404881 | 3300006881 | Miscanthus Rhizosphere | CSVRPVGVRSDEGDVTVEAKSILLDCSGPRNLFVFM* |
| Ga0157374_103328661 | 3300013296 | Miscanthus Rhizosphere | PIGVRSDEGDATAEAESIPFDCSGPGNLFVFCVIL* |
| Ga0157374_120790271 | 3300013296 | Miscanthus Rhizosphere | VGVRSDEGDVAAEAESIPLDCSGPGNIFVFYVIL* |
| Ga0182122_10274241 | 3300015267 | Miscanthus Phyllosphere | HPVGVRSDEGDAMAEPESIPLGCSGTANLFVFCVNL* |
| Ga0182122_10577971 | 3300015267 | Miscanthus Phyllosphere | PIGVRSDEGDATAEAESIPLDCSGPKNLFVFYVIL* |
| Ga0182154_10284051 | 3300015268 | Miscanthus Phyllosphere | PVGVRSDEGDATAEVESIPLGCLGTRNLFIFCVIL* |
| Ga0182172_10057241 | 3300015275 | Miscanthus Phyllosphere | SVHPIGVRSDEGDDTIEAESIPLDCSGPGNLFFYVIL* |
| Ga0182172_10425631 | 3300015275 | Miscanthus Phyllosphere | CSVHPVGVRSDEGDVTAEAESILLDCSGPRNLFVFYVIL* |
| Ga0182172_10626781 | 3300015275 | Miscanthus Phyllosphere | PIGARSDEGDATAEAESIPLDCSGLGNHFVFCVI* |
| Ga0182128_10126891 | 3300015277 | Miscanthus Phyllosphere | VHLVGVRSDEGDATAEPESIPLGCSGTTNLFVFCVNL* |
| Ga0182128_10642211 | 3300015277 | Miscanthus Phyllosphere | VRPVGVRSDEGDATVEAESIPLDCSVPGNHFVFFV* |
| Ga0182174_10431171 | 3300015279 | Miscanthus Phyllosphere | SVRLVGFRSDEGDVTAEAESIPLECSGPGNLFVFM* |
| Ga0182174_10720111 | 3300015279 | Miscanthus Phyllosphere | ICPIGVRSDEGDATAEAESIPLDCSGPKNLFVFYVIL* |
| Ga0182174_10839471 | 3300015279 | Miscanthus Phyllosphere | VRPVGVRSDEGDATAEAESIPLDCLGPRNLFVFM* |
| Ga0182160_10396771 | 3300015281 | Miscanthus Phyllosphere | NICPVGVRSDEGDAMVEAESIPLDCSDPRNLFVFM* |
| Ga0182124_10287682 | 3300015282 | Miscanthus Phyllosphere | PIGVRSDEGDATAEAESIPLDCSGHRNLFLCVIL* |
| Ga0182124_10297552 | 3300015282 | Miscanthus Phyllosphere | PVGVRSGEGDAMPKAESIPLDYSGPRNIFVFCVIL* |
| Ga0182156_10357921 | 3300015283 | Miscanthus Phyllosphere | SVRPVGVRSDEGDVTAEAESILLDCSGPRNLFVFM* |
| Ga0182186_10402992 | 3300015285 | Miscanthus Phyllosphere | RLCSVRPIGFRTDEGDTTAEAKSIPLDCSGPGNHFVFFVIL* |
| Ga0182173_10325081 | 3300015288 | Miscanthus Phyllosphere | CFVHPVGVSSAEGDATAEAESIPLDCSGPRNSFIFYVIL* |
| Ga0182173_10814181 | 3300015288 | Miscanthus Phyllosphere | VRLVGFRSDEGDVTAEAESIPLDCSGPRNLFVFM* |
| Ga0182173_10843321 | 3300015288 | Miscanthus Phyllosphere | SVRHIGVRNDEGDATTEAESIKLGCSGTRNLFVFCVIL* |
| Ga0182138_10454361 | 3300015289 | Miscanthus Phyllosphere | PVCVRSDEGDVTAEAESILLDCLGPGNHFVFYVIL* |
| Ga0182125_10146441 | 3300015291 | Miscanthus Phyllosphere | RSDEGDAMAEAESIPFDCLGPGNLFVFCVILYEGKIN* |
| Ga0182157_10148191 | 3300015296 | Miscanthus Phyllosphere | PVGVTSDEGDATAEAESIPLDCSGPRNLCVFCVIL* |
| Ga0182157_10376871 | 3300015296 | Miscanthus Phyllosphere | CNICPVTVRRDEGDATAEAESIPLDCSDPRNLFVFM* |
| Ga0182106_10389031 | 3300015298 | Miscanthus Phyllosphere | PIGVRSDEGDATAEVDFIPLDCSGPGNNFVFCVAL* |
| Ga0182106_11006981 | 3300015298 | Miscanthus Phyllosphere | VRPVGVTSDEGDATAEAESIPLDCSGPRNLFIFCVIL* |
| Ga0182107_10352601 | 3300015299 | Miscanthus Phyllosphere | RPVGVRSDEGDATTEAESIPLDCLGPRNLFVFCVDL* |
| Ga0182107_10723602 | 3300015299 | Miscanthus Phyllosphere | VRPVGVRSDEGDATTEAESIPLDCLGPRNLFVSCVIL* |
| Ga0182108_10075573 | 3300015300 | Miscanthus Phyllosphere | RLVGVRSDEGDVTAEAESMPLHCSGPRNLFVFYVFL* |
| Ga0182143_10239911 | 3300015302 | Miscanthus Phyllosphere | LCSICPIGARSDEGDATAEVDFIPLHCSGPGNLFVF |
| Ga0182143_10733342 | 3300015302 | Miscanthus Phyllosphere | SVRPIGVRSDEGDATAEAESIPFDCSGPRNLFVFCVIL* |
| Ga0182143_11032991 | 3300015302 | Miscanthus Phyllosphere | RLDNRKMLGLCSVRPIGVRSDEGDATAEADFIPLDCLGPGNLFVFCVVL* |
| Ga0182112_10400252 | 3300015304 | Miscanthus Phyllosphere | SVRPIGVRSDEGDATVEAESISLGYSGIGNLFVFCVIL* |
| Ga0182158_10056551 | 3300015305 | Miscanthus Phyllosphere | CSVRPVGVRSDEGDAMAEVESIPLDCSSPGNLFVFM* |
| Ga0182144_10185151 | 3300015307 | Miscanthus Phyllosphere | VGVRSDEGDVTAEAESMPLHCSGPRNLFVFYVIL* |
| Ga0182144_10737462 | 3300015307 | Miscanthus Phyllosphere | LVGVRSDEGDVTAEAESMPLHCSGPRNLFVFYVFL* |
| Ga0182144_10873421 | 3300015307 | Miscanthus Phyllosphere | SYSARPVGVRSDEGDATVEVESIPLGYSGTGNLFVFCVIL* |
| Ga0182144_10953961 | 3300015307 | Miscanthus Phyllosphere | PVCVRSDEGDATVEAESIPLDCSGPGNHFVFCVIL* |
| Ga0182140_10099741 | 3300015314 | Miscanthus Phyllosphere | VRPVCVRSDEGDVTAEAESILLDCSGPRNVFVFYVIL* |
| Ga0182140_10574461 | 3300015314 | Miscanthus Phyllosphere | RSCSVHPVGVRSDEGDATVEAESIPLDYSGPRNLFVFCVIL* |
| Ga0182140_10868211 | 3300015314 | Miscanthus Phyllosphere | CSVHPVGVRSDEGDVTAEAESIPLDCSGPGNLFVFYVIL* |
| Ga0182127_10402971 | 3300015321 | Miscanthus Phyllosphere | PVGVRSDEGDVTAEAESILLDCSGPRNLFVFYVIL* |
| Ga0182110_10031721 | 3300015322 | Miscanthus Phyllosphere | CSVRPVGVRSDEGDVTTEAESILLDCSGPGNLFVFYVIL* |
| Ga0182110_10433611 | 3300015322 | Miscanthus Phyllosphere | PVGVRSDEGDATAEAESIPLGCSGTANLFVFCVNL* |
| Ga0182110_11203631 | 3300015322 | Miscanthus Phyllosphere | HPVGVRSDEGDATAEAESIPFDCSGPENLFVFYVIL* |
| Ga0182129_10456511 | 3300015323 | Miscanthus Phyllosphere | ICPIGVKSDEGDAMAEAESIPFDCLGPRNLFDFCEIL* |
| Ga0182187_11226001 | 3300015341 | Miscanthus Phyllosphere | HPVGVISDEGDATTEAKYIPLDCSGHGNLFVFYVIL* |
| Ga0182187_11422681 | 3300015341 | Miscanthus Phyllosphere | ICPIGVRSDEGDATAEAESIPLDCLGPKNLFVFYVIL* |
| Ga0182189_10936451 | 3300015344 | Miscanthus Phyllosphere | CSVHLVGFRSDEGDVTAEAESIPLDCSGPGNLFVFYVIL* |
| Ga0182189_11166481 | 3300015344 | Miscanthus Phyllosphere | VRPVGVRSDEGDAMAEAESILFDCSGPGNLFVFCVIL* |
| Ga0182189_11220891 | 3300015344 | Miscanthus Phyllosphere | GVRSDEGDAMAEAESIPLGCSDTRNLFVFCVILY* |
| Ga0182111_12323131 | 3300015345 | Miscanthus Phyllosphere | RPVGVTSDEGHATAEAESIPLAFSGTGNLFVFFAIL* |
| Ga0182139_11298642 | 3300015346 | Miscanthus Phyllosphere | VRPVGVRSDEGDAMAEAESIPFDCSGPGNLFVFCVIF* |
| Ga0182139_12378381 | 3300015346 | Miscanthus Phyllosphere | VRLVGFRSDEGDVKAEAESMPLDCSGPGNLFVFI* |
| Ga0182161_12190471 | 3300015351 | Miscanthus Phyllosphere | VRHIGVRNDEGDATTEAESIKLGCSGTGNLFVFCVIL* |
| Ga0182161_12329621 | 3300015351 | Miscanthus Phyllosphere | CSVRPVGVTSDEGDATAEAESIPLDCLGPGNLFVFFVIL* |
| Ga0182159_10814041 | 3300015355 | Miscanthus Phyllosphere | RPVGVKSEGDATGEVESIPLGCSTTGNLFVFCVIL* |
| Ga0182159_11134132 | 3300015355 | Miscanthus Phyllosphere | SGFVRPVGVKSDGDATGEVEYIPLGCSGTGNLFVFFVIL* |
| Ga0182159_11921701 | 3300015355 | Miscanthus Phyllosphere | RPVGVRSDEGDATAEAESIPLDCSGPRNFFFCVIL* |
| Ga0182145_11412831 | 3300015361 | Miscanthus Phyllosphere | CPIGVRSDEGDATAEAESIPLDCSGPKNLFVFYVIL* |
| Ga0182203_11030861 | 3300017404 | Miscanthus Phyllosphere | RSCNIRPIGVRSDEGDATAEAKSIPLDCSDPGDLLVFM |
| Ga0182204_11047181 | 3300017409 | Miscanthus Phyllosphere | LVGVRSDEGDVTAEAESMPLHCSGPRNLFVFYVFL |
| Ga0182204_11188961 | 3300017409 | Miscanthus Phyllosphere | VRPIGVRSDEGDATIEAESIPLDYSGPGHLFFYVIL |
| Ga0182222_10015431 | 3300017413 | Miscanthus Phyllosphere | PVGVRSDEGDVTAEAESILLDCSGPRNLFVFYVIL |
| Ga0182222_10028971 | 3300017413 | Miscanthus Phyllosphere | RPVGVRSDEGDATAEAESIPLGCSGTRNLYIFCVIL |
| Ga0182222_10201831 | 3300017413 | Miscanthus Phyllosphere | SCSVRPIGVRSDEGDATIEAESIPLDCSGPGHLFFYVIL |
| Ga0182222_10860191 | 3300017413 | Miscanthus Phyllosphere | VRPVGVRSDEGDMTAEAESILLDCSGPQNLFVFYVIL |
| Ga0182202_10124001 | 3300017415 | Miscanthus Phyllosphere | SFSVRPVGVRSDEGYATTEAESIPSGFSGTGNLFFSLIL |
| Ga0182202_10632611 | 3300017415 | Miscanthus Phyllosphere | PPIGVRSDEGDATTEAKSIPLGCSGSTNRFVFSVILLEGQIK |
| Ga0182228_10627261 | 3300017420 | Miscanthus Phyllosphere | HPPRRFRSDEGDVTAEAESIPLDCSDPRNLFVFYVIL |
| Ga0182228_11186102 | 3300017420 | Miscanthus Phyllosphere | VCPVGVRSDEGDVRVEAESILLDCSGPGNPFVFYVIL |
| Ga0182219_10514881 | 3300017424 | Miscanthus Phyllosphere | ICPIGVRSDEGDATAEAESIPLDCSGPKNLFVFYVIL |
| Ga0182219_10722341 | 3300017424 | Miscanthus Phyllosphere | SVHPVGVRSDEGDAMAEAKSIPLDCSCPRNHFVYL |
| Ga0182219_10817691 | 3300017424 | Miscanthus Phyllosphere | LVGVRSDEGDVTAEAESMPLHCLGPRNLFVFYVIL |
| Ga0182224_10167501 | 3300017425 | Miscanthus Phyllosphere | LVGFRSDEGDVTAEAESIPLDCSGPGNLFVFYVIL |
| Ga0182190_10029441 | 3300017427 | Miscanthus Phyllosphere | CSVRPVGVRSDEGDATVEAESIPLDCSVPGNHFVFFV |
| Ga0182190_10417912 | 3300017427 | Miscanthus Phyllosphere | SLRPVGVKTDEGDATAEAESIPLDCLGPGNSLFFCVILKEGQIK |
| Ga0182190_11604641 | 3300017427 | Miscanthus Phyllosphere | CFVHPVGVRSDEGDATAEAESIPLDCLGPRNNFIFYVIL |
| Ga0182209_10165811 | 3300017436 | Miscanthus Phyllosphere | CSICPIGVRSDEGDATAEAESIPLDCSGPKNLFVFYVIL |
| Ga0182209_10219851 | 3300017436 | Miscanthus Phyllosphere | RPVGVRRDEGDAMVEAESIPFDCSGPGNLFVFCVIL |
| Ga0182209_10375691 | 3300017436 | Miscanthus Phyllosphere | RPIGVKSDEGDATAEAKSIPLDCSGPGNLFHFLCNFV |
| Ga0182209_11184171 | 3300017436 | Miscanthus Phyllosphere | RSCNICPVGVRSYEGDATAEAESVPLDFSGSGNLFVFFV |
| Ga0182191_10576331 | 3300017438 | Miscanthus Phyllosphere | CSVRLVGFRSDEGDVTAEAESIPLDCSGPGNLFVFM |
| Ga0182191_11069291 | 3300017438 | Miscanthus Phyllosphere | PVGVRSDEGDMTAEAESILLDCSGPQNLFVFYVIL |
| Ga0182191_11177912 | 3300017438 | Miscanthus Phyllosphere | VHPVGVRSDEGDATGEAKHIPLGCSGTGNLFVFCVIL |
| Ga0182221_10501312 | 3300017442 | Miscanthus Phyllosphere | PVGVRSDEGDATAEAESIPLDCSGPGNLFIFCVVF |
| Ga0182221_10772271 | 3300017442 | Miscanthus Phyllosphere | PVSVRSDEGDAMAEAKSIPLDYLGPGTLFVFCVIL |
| Ga0182221_11480451 | 3300017442 | Miscanthus Phyllosphere | PVGVRSDEGDVTAEAESILLDCLGPRNLFVFYVIL |
| Ga0182193_11182971 | 3300017443 | Miscanthus Phyllosphere | PVGVRSDEGDATAEAESIPLGCLDTRKLFAFCVIL |
| Ga0182218_10546221 | 3300017683 | Miscanthus Phyllosphere | VHPVGVRSDEGDATGEAKHIPLGCSGTGNLFVFYVIL |
| Ga0182218_10564371 | 3300017683 | Miscanthus Phyllosphere | NICPIGVKSDEGDAMAEAESIPFGCLGPGNLFVFCAIL |
| Ga0182225_10269242 | 3300017684 | Miscanthus Phyllosphere | SIRLVGVRSDEGDVTAEAESMPLHCSGPRNLFVFYVFL |
| Ga0182225_10805981 | 3300017684 | Miscanthus Phyllosphere | SDEGDATTEAKSIPLGCSGSRNLFVFSIILLEGQIK |
| Ga0182225_10960442 | 3300017684 | Miscanthus Phyllosphere | VHPVGVRSDEGDATAEAESIPFDCSGPENLFVFYVIL |
| Ga0182225_11437981 | 3300017684 | Miscanthus Phyllosphere | PVGVTSDEGDATAEAESIPLDCSGPRNLFIFCVIL |
| Ga0182227_11189431 | 3300017685 | Miscanthus Phyllosphere | VRLVGFRSDEGDVTAEAESIPLDCSGPGNLFVFYVIL |
| Ga0182205_10662822 | 3300017686 | Miscanthus Phyllosphere | SVRPVGVRSDEGDATAEAESIPLDCLGPRNLFVFFV |
| Ga0182205_10802803 | 3300017686 | Miscanthus Phyllosphere | CSVRPVGVRSDEGDATVEAESIPLGCSGTRNLFVFCVIL |
| Ga0182205_11451961 | 3300017686 | Miscanthus Phyllosphere | PIGVRSDEGDVTAEAESIPLECLGPENLFVFCVVL |
| Ga0182223_10241891 | 3300017690 | Miscanthus Phyllosphere | IRPVGVRSDERDATVEAESIPLGCSGTRNLFVFCVIL |
| Ga0182223_10579141 | 3300017690 | Miscanthus Phyllosphere | VRPVGVRSDKGDATAEAESIPLDCLRPRNLFVSYVIL |
| Ga0182232_10219651 | 3300021060 | Phyllosphere | YFVHPVGVKSEGDATGEVESIPLGCSTTGNIFVFCVIL |
| Ga0182232_10452181 | 3300021060 | Phyllosphere | VHPVGVRSDEGDATVEAESIPLDYSGPRNLFVFCVIL |
| Ga0182232_10483351 | 3300021060 | Phyllosphere | MLGLCSVRPICVRSDEGDATAEADFIPLDCLGPGNLFVFCVVL |
| Ga0207689_106374931 | 3300025942 | Miscanthus Rhizosphere | VRPIGFRTDEGDTTAEAKSIPLDCSGPGNLFVFFVIL |
| ⦗Top⦘ |