| Basic Information | |
|---|---|
| Family ID | F084332 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 112 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MYQLVEEASKVLRQPPLEFDFENPPEDPKEIEKNMSEAMDKF |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 48.21 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 80.36 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (47.321 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine (15.179 % of family members) |
| Environment Ontology (ENVO) | Unclassified (63.393 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (90.179 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.14% β-sheet: 0.00% Coil/Unstructured: 62.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF13476 | AAA_23 | 8.04 |
| PF00149 | Metallophos | 1.79 |
| PF13555 | AAA_29 | 1.79 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 52.68 % |
| Unclassified | root | N/A | 47.32 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000949|BBAY94_10018890 | All Organisms → Viruses → Predicted Viral | 1928 | Open in IMG/M |
| 3300000949|BBAY94_10046834 | Not Available | 1203 | Open in IMG/M |
| 3300001346|JGI20151J14362_10010874 | All Organisms → Viruses | 5375 | Open in IMG/M |
| 3300003477|nap3_10067214 | Not Available | 824 | Open in IMG/M |
| 3300003620|JGI26273J51734_10008210 | All Organisms → Viruses → Predicted Viral | 4597 | Open in IMG/M |
| 3300005837|Ga0078893_13636330 | Not Available | 544 | Open in IMG/M |
| 3300006334|Ga0099675_1041755 | Not Available | 548 | Open in IMG/M |
| 3300007114|Ga0101668_1077639 | Not Available | 705 | Open in IMG/M |
| 3300007647|Ga0102855_1122999 | Not Available | 694 | Open in IMG/M |
| 3300007862|Ga0105737_1018480 | All Organisms → Viruses → Predicted Viral | 1598 | Open in IMG/M |
| 3300008961|Ga0102887_1011176 | All Organisms → Viruses → Predicted Viral | 3368 | Open in IMG/M |
| 3300009052|Ga0102886_1132044 | Not Available | 749 | Open in IMG/M |
| 3300009058|Ga0102854_1059358 | All Organisms → Viruses → Predicted Viral | 1096 | Open in IMG/M |
| 3300009077|Ga0115552_1043682 | All Organisms → Viruses → Predicted Viral | 2070 | Open in IMG/M |
| 3300009080|Ga0102815_10514807 | Not Available | 669 | Open in IMG/M |
| 3300009086|Ga0102812_10067707 | All Organisms → Viruses → Predicted Viral | 1975 | Open in IMG/M |
| 3300009420|Ga0114994_10043992 | All Organisms → Viruses → Predicted Viral | 3095 | Open in IMG/M |
| 3300009420|Ga0114994_10647938 | Not Available | 691 | Open in IMG/M |
| 3300009433|Ga0115545_1119767 | Not Available | 938 | Open in IMG/M |
| 3300009443|Ga0115557_1155161 | Not Available | 923 | Open in IMG/M |
| 3300009443|Ga0115557_1237468 | Not Available | 701 | Open in IMG/M |
| 3300009443|Ga0115557_1260346 | Not Available | 662 | Open in IMG/M |
| 3300009476|Ga0115555_1229599 | Not Available | 758 | Open in IMG/M |
| 3300009505|Ga0115564_10578672 | Not Available | 532 | Open in IMG/M |
| 3300009507|Ga0115572_10000840 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 25414 | Open in IMG/M |
| 3300009526|Ga0115004_10128845 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1538 | Open in IMG/M |
| 3300009593|Ga0115011_10231554 | All Organisms → Viruses → Predicted Viral | 1378 | Open in IMG/M |
| 3300010883|Ga0133547_10815738 | All Organisms → Viruses → Predicted Viral | 1830 | Open in IMG/M |
| 3300010883|Ga0133547_10846676 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1789 | Open in IMG/M |
| 3300010883|Ga0133547_10989907 | All Organisms → Viruses → Predicted Viral | 1628 | Open in IMG/M |
| 3300010883|Ga0133547_11929555 | Not Available | 1085 | Open in IMG/M |
| 3300012413|Ga0138258_1337766 | Not Available | 627 | Open in IMG/M |
| 3300012418|Ga0138261_1881738 | Not Available | 941 | Open in IMG/M |
| 3300012920|Ga0160423_10736264 | Not Available | 664 | Open in IMG/M |
| 3300012928|Ga0163110_10215714 | Not Available | 1367 | Open in IMG/M |
| 3300012936|Ga0163109_10064228 | All Organisms → Viruses → Predicted Viral | 2690 | Open in IMG/M |
| 3300012952|Ga0163180_11651323 | Not Available | 541 | Open in IMG/M |
| 3300012953|Ga0163179_10131036 | All Organisms → Viruses → Predicted Viral | 1852 | Open in IMG/M |
| 3300017742|Ga0181399_1006643 | All Organisms → Viruses → Predicted Viral | 3524 | Open in IMG/M |
| 3300017749|Ga0181392_1011770 | All Organisms → Viruses → Predicted Viral | 2860 | Open in IMG/M |
| 3300017751|Ga0187219_1037263 | Not Available | 1667 | Open in IMG/M |
| 3300017751|Ga0187219_1164955 | Not Available | 630 | Open in IMG/M |
| 3300017765|Ga0181413_1024865 | All Organisms → Viruses → Predicted Viral | 1878 | Open in IMG/M |
| 3300017781|Ga0181423_1005736 | All Organisms → cellular organisms → Bacteria | 5453 | Open in IMG/M |
| 3300017781|Ga0181423_1208158 | Not Available | 739 | Open in IMG/M |
| 3300017781|Ga0181423_1349437 | Not Available | 539 | Open in IMG/M |
| 3300017783|Ga0181379_1005148 | All Organisms → cellular organisms → Bacteria | 5690 | Open in IMG/M |
| 3300017783|Ga0181379_1106142 | All Organisms → Viruses → Predicted Viral | 1025 | Open in IMG/M |
| 3300017969|Ga0181585_10841277 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 592 | Open in IMG/M |
| 3300018049|Ga0181572_10379474 | Not Available | 886 | Open in IMG/M |
| 3300018420|Ga0181563_10048707 | All Organisms → Viruses → Predicted Viral | 3007 | Open in IMG/M |
| 3300020169|Ga0206127_1103896 | All Organisms → Viruses → Predicted Viral | 1195 | Open in IMG/M |
| 3300020258|Ga0211529_1042144 | Not Available | 781 | Open in IMG/M |
| 3300020264|Ga0211526_1070487 | Not Available | 593 | Open in IMG/M |
| 3300020282|Ga0211667_1026791 | All Organisms → Viruses → Predicted Viral | 1498 | Open in IMG/M |
| 3300020409|Ga0211472_10281681 | Not Available | 669 | Open in IMG/M |
| 3300020438|Ga0211576_10136083 | Not Available | 1337 | Open in IMG/M |
| 3300020438|Ga0211576_10178548 | All Organisms → Viruses → Predicted Viral | 1138 | Open in IMG/M |
| 3300020442|Ga0211559_10157444 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 1081 | Open in IMG/M |
| 3300020454|Ga0211548_10128549 | All Organisms → Viruses → Predicted Viral | 1217 | Open in IMG/M |
| 3300020456|Ga0211551_10123002 | All Organisms → Viruses → Predicted Viral | 1223 | Open in IMG/M |
| 3300020457|Ga0211643_10274793 | Not Available | 827 | Open in IMG/M |
| 3300020464|Ga0211694_10321842 | Not Available | 653 | Open in IMG/M |
| 3300020469|Ga0211577_10314747 | Not Available | 988 | Open in IMG/M |
| 3300020474|Ga0211547_10377212 | Not Available | 715 | Open in IMG/M |
| 3300021185|Ga0206682_10205680 | Not Available | 895 | Open in IMG/M |
| 3300021368|Ga0213860_10123464 | All Organisms → Viruses → Predicted Viral | 1137 | Open in IMG/M |
| 3300021368|Ga0213860_10159450 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 994 | Open in IMG/M |
| 3300021375|Ga0213869_10209881 | Not Available | 873 | Open in IMG/M |
| 3300021375|Ga0213869_10373579 | Not Available | 589 | Open in IMG/M |
| 3300021442|Ga0206685_10133666 | Not Available | 827 | Open in IMG/M |
| 3300021957|Ga0222717_10128355 | All Organisms → Viruses → Predicted Viral | 1563 | Open in IMG/M |
| 3300021957|Ga0222717_10633092 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 556 | Open in IMG/M |
| 3300021957|Ga0222717_10665611 | Not Available | 537 | Open in IMG/M |
| 3300021964|Ga0222719_10098016 | All Organisms → Viruses → Predicted Viral | 2146 | Open in IMG/M |
| 3300022905|Ga0255756_1052864 | All Organisms → Viruses → Predicted Viral | 2247 | Open in IMG/M |
| 3300022909|Ga0255755_1061265 | Not Available | 1797 | Open in IMG/M |
| 3300022929|Ga0255752_10081571 | Not Available | 1834 | Open in IMG/M |
| (restricted) 3300024255|Ga0233438_10082897 | All Organisms → Viruses → Predicted Viral | 1510 | Open in IMG/M |
| (restricted) 3300024264|Ga0233444_10121130 | All Organisms → Viruses → Predicted Viral | 1322 | Open in IMG/M |
| 3300024301|Ga0233451_10279407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED287 | 656 | Open in IMG/M |
| 3300024348|Ga0244776_10282851 | All Organisms → Viruses → Predicted Viral | 1140 | Open in IMG/M |
| 3300025108|Ga0208793_1200385 | Not Available | 500 | Open in IMG/M |
| 3300025483|Ga0209557_1002466 | Not Available | 9461 | Open in IMG/M |
| 3300025685|Ga0209095_1116318 | Not Available | 818 | Open in IMG/M |
| 3300025694|Ga0209406_1014803 | All Organisms → Viruses → Predicted Viral | 3677 | Open in IMG/M |
| 3300025694|Ga0209406_1109835 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 922 | Open in IMG/M |
| 3300025704|Ga0209602_1017673 | All Organisms → Viruses → Predicted Viral | 3739 | Open in IMG/M |
| 3300025704|Ga0209602_1128789 | Not Available | 844 | Open in IMG/M |
| 3300025712|Ga0209305_1034237 | All Organisms → Viruses → Predicted Viral | 1862 | Open in IMG/M |
| 3300025767|Ga0209137_1159601 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium | 808 | Open in IMG/M |
| 3300025821|Ga0209600_1161537 | Not Available | 615 | Open in IMG/M |
| 3300025830|Ga0209832_1131064 | Not Available | 757 | Open in IMG/M |
| 3300025869|Ga0209308_10013940 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 5231 | Open in IMG/M |
| 3300025892|Ga0209630_10103242 | Not Available | 1533 | Open in IMG/M |
| 3300025892|Ga0209630_10294603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED287 | 740 | Open in IMG/M |
| 3300026136|Ga0208763_1004440 | All Organisms → Viruses → Predicted Viral | 2300 | Open in IMG/M |
| 3300026189|Ga0208405_1001645 | All Organisms → Viruses → Predicted Viral | 3803 | Open in IMG/M |
| 3300027253|Ga0208680_1027667 | All Organisms → Viruses → Predicted Viral | 1123 | Open in IMG/M |
| 3300027780|Ga0209502_10101715 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1457 | Open in IMG/M |
| 3300027906|Ga0209404_10158292 | All Organisms → Viruses → Predicted Viral | 1382 | Open in IMG/M |
| 3300028115|Ga0233450_10077183 | All Organisms → Viruses → Predicted Viral | 1860 | Open in IMG/M |
| 3300028196|Ga0257114_1315169 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium | 536 | Open in IMG/M |
| 3300028287|Ga0257126_1116832 | Not Available | 931 | Open in IMG/M |
| 3300028391|Ga0233394_1030458 | All Organisms → Viruses → Predicted Viral | 1390 | Open in IMG/M |
| 3300031628|Ga0308014_1024631 | Not Available | 1557 | Open in IMG/M |
| 3300031656|Ga0308005_10008513 | All Organisms → Viruses → Predicted Viral | 2887 | Open in IMG/M |
| 3300031683|Ga0308006_10259588 | Not Available | 542 | Open in IMG/M |
| 3300031851|Ga0315320_10283287 | All Organisms → Viruses → Predicted Viral | 1188 | Open in IMG/M |
| 3300031886|Ga0315318_10060439 | All Organisms → Viruses | 2043 | Open in IMG/M |
| 3300032130|Ga0315333_10167287 | Not Available | 1039 | Open in IMG/M |
| 3300032820|Ga0310342_102121227 | Not Available | 672 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 15.18% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 11.61% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 11.61% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 8.93% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 7.14% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 7.14% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 4.46% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 4.46% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.57% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 2.68% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 2.68% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.68% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 2.68% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.79% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 1.79% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.79% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 1.79% |
| Polar Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine | 1.79% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.89% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.89% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.89% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.89% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.89% |
| Estuarine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Estuarine | 0.89% |
| Volcanic Co2 Seep Seawater | Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seep Seawater | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000949 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 | Host-Associated | Open in IMG/M |
| 3300001346 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 | Environmental | Open in IMG/M |
| 3300003477 | Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 3 | Environmental | Open in IMG/M |
| 3300003620 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300006334 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0025m | Environmental | Open in IMG/M |
| 3300007114 | Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble', waterEBis4 | Environmental | Open in IMG/M |
| 3300007647 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02 | Environmental | Open in IMG/M |
| 3300007862 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2um | Environmental | Open in IMG/M |
| 3300008961 | Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02 | Environmental | Open in IMG/M |
| 3300009052 | Estuarine microbial communities from the Columbia River estuary - metaG 1550A-02 | Environmental | Open in IMG/M |
| 3300009058 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02 | Environmental | Open in IMG/M |
| 3300009077 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 | Environmental | Open in IMG/M |
| 3300009080 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 | Environmental | Open in IMG/M |
| 3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009443 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421 | Environmental | Open in IMG/M |
| 3300009476 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 | Environmental | Open in IMG/M |
| 3300009505 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009526 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300012413 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA6.ICE_1m.20151110 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012418 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA12.A_72.20151113 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300017742 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018049 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020169 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1 | Environmental | Open in IMG/M |
| 3300020258 | Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556061-ERR598949) | Environmental | Open in IMG/M |
| 3300020264 | Marine microbial communities from Tara Oceans - TARA_B100000066 (ERX556116-ERR599158) | Environmental | Open in IMG/M |
| 3300020282 | Marine microbial communities from Tara Oceans - TARA_B100000963 (ERX556074-ERR599169) | Environmental | Open in IMG/M |
| 3300020409 | Marine microbial communities from Tara Oceans - TARA_A100001403 (ERX555912-ERR599106) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020442 | Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162) | Environmental | Open in IMG/M |
| 3300020454 | Marine microbial communities from Tara Oceans - TARA_B100001769 (ERX556037-ERR599170) | Environmental | Open in IMG/M |
| 3300020456 | Marine microbial communities from Tara Oceans - TARA_B100001741 (ERX555984-ERR599123) | Environmental | Open in IMG/M |
| 3300020457 | Marine microbial communities from Tara Oceans - TARA_B100001113 (ERX555941-ERR599014) | Environmental | Open in IMG/M |
| 3300020464 | Marine microbial communities from Tara Oceans - TARA_B100000530 (ERX556075-ERR599101) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300020474 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976) | Environmental | Open in IMG/M |
| 3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
| 3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021442 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022905 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG | Environmental | Open in IMG/M |
| 3300022909 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG | Environmental | Open in IMG/M |
| 3300022929 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG | Environmental | Open in IMG/M |
| 3300024255 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MG | Environmental | Open in IMG/M |
| 3300024264 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MG | Environmental | Open in IMG/M |
| 3300024301 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504CT (spades assembly) | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025483 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025685 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 (SPAdes) | Environmental | Open in IMG/M |
| 3300025694 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 (SPAdes) | Environmental | Open in IMG/M |
| 3300025704 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 (SPAdes) | Environmental | Open in IMG/M |
| 3300025712 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 (SPAdes) | Environmental | Open in IMG/M |
| 3300025767 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025821 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421 (SPAdes) | Environmental | Open in IMG/M |
| 3300025830 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 (SPAdes) | Environmental | Open in IMG/M |
| 3300025869 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes) | Environmental | Open in IMG/M |
| 3300025892 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300026136 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45B (SPAdes) | Environmental | Open in IMG/M |
| 3300026189 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF84A (SPAdes) | Environmental | Open in IMG/M |
| 3300027253 | Estuarine microbial communities from the Columbia River estuary - metaG 1556A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027780 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028115 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501CT (spades assembly) | Environmental | Open in IMG/M |
| 3300028196 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10m | Environmental | Open in IMG/M |
| 3300028287 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI060_120m | Environmental | Open in IMG/M |
| 3300028391 | Seawater microbial communities from Monterey Bay, California, United States - 24D | Environmental | Open in IMG/M |
| 3300031628 | Marine microbial communities from water near the shore, Antarctic Ocean - #229 | Environmental | Open in IMG/M |
| 3300031656 | Marine microbial communities from water near the shore, Antarctic Ocean - #67 | Environmental | Open in IMG/M |
| 3300031683 | Marine microbial communities from water near the shore, Antarctic Ocean - #69 | Environmental | Open in IMG/M |
| 3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
| 3300031886 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 3416 | Environmental | Open in IMG/M |
| 3300032130 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 34915 | Environmental | Open in IMG/M |
| 3300032820 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MG | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| BBAY94_100188903 | 3300000949 | Macroalgal Surface | MYQLVEEAMKVLREPTTDFDFENPPEDPKEIEKNMAEAM |
| BBAY94_100468342 | 3300000949 | Macroalgal Surface | MYQLVEEAMKVLREPTTEFDFENPPEDPKEIEKNMAEAM |
| JGI20151J14362_100108747 | 3300001346 | Pelagic Marine | MLELIEEASKVLRTPPPEFDFENPPEDPKEIETNLSSAMEQFGGIG |
| nap3_100672141 | 3300003477 | Estuarine | MYELVEEASKVLRTPPPEFDFENPKEDPKEIEKNMVEAMKKFGGIGLSAN |
| JGI26273J51734_100082105 | 3300003620 | Marine | MLELIEEASKVLRTPPPEFDFENPPEDPKEIEINMASAMEQFGGIGLSA |
| Ga0078893_136363302 | 3300005837 | Marine Surface Water | MYELVEEATKVLRNPTSEFDFENPPECPKEVEKNLSEAMERFGGIGLSA |
| Ga0099675_10417552 | 3300006334 | Marine | MYDLVEEASKVLRNPTSEFDFENPPEDPKEIEKNLGEAMDRFGGIGLSANQLGL |
| Ga0101668_10776392 | 3300007114 | Volcanic Co2 Seep Seawater | MYELVEEASQVLREPPPVFDFENPPEDPKEIASKMAE |
| Ga0102855_11229992 | 3300007647 | Estuarine | MYQLIEEASKVLRTPPLVFDFENRTDAEEIEKSLT |
| Ga0105737_10184801 | 3300007862 | Estuary Water | MYQLIEEASKVLRTPPLVFDFENRTDAEEIEKSLTE |
| Ga0102887_10111761 | 3300008961 | Estuarine | MYQLVEEASKVLRTRPSDFDFETREDAEEIESKLSETMEQYGGL |
| Ga0102886_11320442 | 3300009052 | Estuarine | MYQLIEEASKVLRTPPLVFDFENRTDAEEIEKSLTEAMERLGGIGLSAN |
| Ga0102854_10593582 | 3300009058 | Estuarine | MYQLIEEASKVLRTPPLVFDFENRTDAEEIEKSLTEAMERFGGIGLSANQ |
| Ga0115552_10436823 | 3300009077 | Pelagic Marine | MYTLVEEASKVLRTPPLEFDFDNPSEDPKEIESLLSEAMDRFGGIGLSANQVGLDV |
| Ga0102815_105148072 | 3300009080 | Estuarine | MYELVEEASKVLRTPPLKFDFENPSQDPKEVEEQLANAMENFGGIGLSANQV |
| Ga0102812_100677073 | 3300009086 | Estuarine | MYTLVEEASRVLRTPPLEFDFDKPSEDPKEIESLLSEAMDRFGGIGLSA |
| Ga0114994_100439923 | 3300009420 | Marine | MYQLIEEASKVLRTPPMEFDFAKPTHDPKEVETKLGDA |
| Ga0114994_106479381 | 3300009420 | Marine | MYELVEEASKVLRTPPLVLDFENPTHDPKEVEEKLAEAMTKF |
| Ga0115545_11197671 | 3300009433 | Pelagic Marine | MYQLVEEASKVLRQPPEIFDFENPREDPKEIEKNMAEAMD |
| Ga0115557_11551612 | 3300009443 | Pelagic Marine | MLELIEEASKVLRTPPPEFDFDKPPEDPEEIEFNLAAAMEQYGGIGLSANQVGL |
| Ga0115557_12374681 | 3300009443 | Pelagic Marine | MLELIEEASKVLRTPPPEFDFENPPEDPKEIETNL |
| Ga0115557_12603461 | 3300009443 | Pelagic Marine | MYELVEEASKVLRTPPLKFDFENPSQDPKEVEEQLANAMEN |
| Ga0115555_12295992 | 3300009476 | Pelagic Marine | MYQLIEEASKVLRTPPLVFDFENRTDAEEIEKSLTEAME |
| Ga0115564_105786722 | 3300009505 | Pelagic Marine | MYELVEEASKVLRTPPLKFDFENPSQDPKEVEEQL |
| Ga0115572_100008401 | 3300009507 | Pelagic Marine | MYQLVEEASKVLRTRPNDFDFETREDAEEIESKLSETMEQYGGLGLSAN |
| Ga0115004_101288451 | 3300009526 | Marine | MYELVEEASKVLRTPPLVFDFENPTHDPKEVEQKLSEAMDKFGGIGLSANQVGL |
| Ga0115011_102315541 | 3300009593 | Marine | MYQLVEEASKVLRIPPLEFDFKNPTHDPKEVEQKLAEAMEKFGGLGLSANQV |
| Ga0133547_108157381 | 3300010883 | Marine | MYELIQEASKVLRTPPLVLDFENPSHDPKDVEVKLGE |
| Ga0133547_108466763 | 3300010883 | Marine | MYELVEEASKVLRTPPLVFDFENPTHDPKEVEQKLSEA |
| Ga0133547_109899073 | 3300010883 | Marine | MYELVEEASKVLRTPPLVFDFENPSHDPKEVEQKLSEAMDKF |
| Ga0133547_119295551 | 3300010883 | Marine | MYELIEEASKVLRTPPQKFDFETRTDAEEIEKALSDAMANFGG |
| Ga0138258_13377661 | 3300012413 | Polar Marine | MYQLIEEASKVLRTPPQTFDFEKRTDAEEIEKALSDAMGRFGGIG |
| Ga0138261_18817382 | 3300012418 | Polar Marine | MYELIQEASKVLRTPPLVLDFENPSHDPKDVEVKLAEAMTKFGGLGLSANQVGL |
| Ga0160423_107362642 | 3300012920 | Surface Seawater | MYELVEEASQVLREPPPVFDFENPPEDPKEIASKMAETMDKFGGLGLSANQ |
| Ga0163110_102157141 | 3300012928 | Surface Seawater | MYDLVEEASKVLRNPTSEFDFENPPEDPKEIEKNLGEAMDRFGGIGLSAN |
| Ga0163109_100642283 | 3300012936 | Surface Seawater | MYELVEEATKVLREPTDKFDFENPPEDPKEVEKNLSEAM |
| Ga0163180_116513231 | 3300012952 | Seawater | MYELVEESLKVLREPTDEFDFENPPEDPKSIEKNLAEAMER |
| Ga0163179_101310362 | 3300012953 | Seawater | MYQLIEEASKVLRTPPPEFDFENPPEDPKEIAKNLGEAR |
| Ga0181399_10066431 | 3300017742 | Seawater | MYELVEEASKVLRTPPPQFDFDNPSHDPKEISDKLIELCTQYNGIGLSANQ |
| Ga0181392_10117703 | 3300017749 | Seawater | MLELIEEASKVLRTPPPEFDFENPPEDPEEIEFNMAAAM |
| Ga0187219_10372631 | 3300017751 | Seawater | MYQLVEEASKVLRQPPEVFDFENPREDPKEIEKNMSEAMD |
| Ga0187219_11649551 | 3300017751 | Seawater | MLELIEEASKVLRQPPEVFDFENPREDPKEIEKNMSEA |
| Ga0181413_10248653 | 3300017765 | Seawater | MYQLIEEASKVLRTPPQLFNFEERKDAEEIETALSEAMDRFGGI |
| Ga0181423_10057368 | 3300017781 | Seawater | MYQLVEEASKVLRQPPEVFDFENPREDPKEIEKNMSEAMDKFGGL |
| Ga0181423_12081581 | 3300017781 | Seawater | MLELIEEASKVLRQPPEVFDFENPREDPKEIEKNMSEAMDKFGGL |
| Ga0181423_13494371 | 3300017781 | Seawater | MYQLVEEAMKVLREPTTDFDFENPPEDPKEIEKNMAEAMER |
| Ga0181379_10051488 | 3300017783 | Seawater | MYQLVEEASKVLRQPPEIFDFENPREDPKEIEKNMSEAMDKFGGLGLSANQVG |
| Ga0181379_11061422 | 3300017783 | Seawater | MLELIEEASKVLRTPPPEFDFENPPEDPEEIEFNMAAAMEQ |
| Ga0181585_108412771 | 3300017969 | Salt Marsh | MYELVEEASKVLRTPPQPFDFENRTDAKEIEEKLAESMEK |
| Ga0181572_103794742 | 3300018049 | Salt Marsh | MLELIDEASRVLRTPPPEFDFENPPEDPKEIEKNLATAMEQFGGIGLSANQV |
| Ga0181563_100487073 | 3300018420 | Salt Marsh | MYELIDEASKVLRTPPPEFDFENPPEDPKEIEKNLADAME |
| Ga0206127_11038962 | 3300020169 | Seawater | MYQLIEEASKVLRTPPLVFDFENRTDAEEIEKSLTEAMEKFGGIG |
| Ga0211529_10421442 | 3300020258 | Marine | MYSLVEEASQVLREPPPVFDFDNPPEDPKEIASKMAETMEKFGGLG |
| Ga0211526_10704872 | 3300020264 | Marine | MYQLVEEASKVLRTPPMEFDFENPTHDPKEIEEKL |
| Ga0211667_10267911 | 3300020282 | Marine | MYELIEEASQVLRTPPPVFDFENPAEPPEEIAKNMAEAMEKFGGLGLSAN |
| Ga0211472_102816812 | 3300020409 | Marine | MYELVEEATKVLREPTDEFDFKNPPEDPKEVEKNLGEAMER |
| Ga0211576_101360831 | 3300020438 | Marine | MYQLVEEASKVLRQPPEVFDFENPREDPKEIEKNMSEAMDKFG |
| Ga0211576_101785482 | 3300020438 | Marine | MYQLVEEASKVLRQPPEIFDFENPREDPKEIEKNMSEAMDKFG |
| Ga0211559_101574442 | 3300020442 | Marine | MYQLVEEASKVLRTPPIEFDFKNPTHDPKEIEEKLSEAMEKFGGIGLSAN |
| Ga0211548_101285491 | 3300020454 | Marine | MYQLIEEASQVLRTPPEVFDFENPPEDPKEIAENMSKAMDKFGGLGLSANQV |
| Ga0211551_101230022 | 3300020456 | Marine | MYELVEEASKVLRNPTVPFDFENPQVDPKELIEGLINVLEKNGGIGLSA |
| Ga0211643_102747931 | 3300020457 | Marine | MHKLIEEASKVLREPTDEFDFENPPEDPIEVEKNLSELMEHYGGIGLSANQLGL |
| Ga0211694_103218422 | 3300020464 | Marine | MYELVEESLKVLREPTDEFDFENPPEDPKEVEKNLGEAMERFGGIGLS |
| Ga0211577_103147471 | 3300020469 | Marine | MYQLVEEASKVLRQPPEIFDFENPREDPKEIEKNMS |
| Ga0211547_103772121 | 3300020474 | Marine | MYQLIEEASQVLRTPPELFDFENPAEPPEEIAKNM |
| Ga0206682_102056802 | 3300021185 | Seawater | MYQLIEEASKVLRTPPQLFNFEERKDAEEIETALSEAMDRFGGIGLSANQVGLDA |
| Ga0213860_101234641 | 3300021368 | Seawater | MYELIQEASNVLRNPTTDFDFDNPPEDPKEIEKNMAEAMEKYGGLGLS |
| Ga0213860_101594501 | 3300021368 | Seawater | MYELVEEASKVLRTPPQPFDFENRTDAKEIEEKLGEAMDKFGGIGL |
| Ga0213869_102098812 | 3300021375 | Seawater | MYELVEEASKVLRQPPEIFDFENPREDPKEIEKNMSEAM |
| Ga0213869_103735791 | 3300021375 | Seawater | MLELIEEASKVLRTPPPEFDFENPPEDPKEIETNLS |
| Ga0206685_101336661 | 3300021442 | Seawater | MYKLVEEASKVLRTPPDEFDFNEPPEDPKEIEKNLAECVSTFGGLGLSANQLG |
| Ga0222717_101283551 | 3300021957 | Estuarine Water | MLELIEEASKVLRTPPPEFDFENPPEDPEEIEFNMAAAMEQF |
| Ga0222717_106330922 | 3300021957 | Estuarine Water | MYTLIEEASKVLRTPPAPFDFESREDAKEIETKLSEAMD |
| Ga0222717_106656111 | 3300021957 | Estuarine Water | MYELVEEASKVLRTPPPQFDFDNPSHDPKEISDKLIELC |
| Ga0222719_100980161 | 3300021964 | Estuarine Water | MYQLVEEASKVLRQPPLEFDFENPPEDPKEIEKNMSEAMDKF |
| Ga0255756_10528643 | 3300022905 | Salt Marsh | MYELIDEASKVLRTPPPEFDFENPPEDPKEIEKNLA |
| Ga0255755_10612653 | 3300022909 | Salt Marsh | MYELIDEASKVLRTPPPEFDFENPPEDPKEIEKNLAAAMERFG |
| Ga0255752_100815711 | 3300022929 | Salt Marsh | MYELIDEASKVLRTPPPEFDFENPPEDPKEIEKNLAAAME |
| (restricted) Ga0233438_100828971 | 3300024255 | Seawater | MLELIEEASKVLRTPPPEFDFENPPEDPKEIEINM |
| (restricted) Ga0233444_101211301 | 3300024264 | Seawater | MLELIEEASKVLRTPPPEFDFENPPEDPKEIEINMAAAME |
| Ga0233451_102794072 | 3300024301 | Salt Marsh | MLELIEEASKVLRNPPELFDFENPPEDPKLIEEKMSEA |
| Ga0244776_102828512 | 3300024348 | Estuarine | MYELVEEASKVLRTPPLVFDFENPSHDPKEVEQKLSEAMDKFGGIG |
| Ga0208793_12003851 | 3300025108 | Marine | MYELVEEASKVLRTPPLKFDFENPSQDPKEVEEQLANAMENFGGIGLSA |
| Ga0209557_10024661 | 3300025483 | Marine | MLELIEEASKVLRTPPPEFDFENPPEDPKEIEINMAAAMEQFGG |
| Ga0209095_11163182 | 3300025685 | Pelagic Marine | MYQLVEEASKVLRQPPEIFDFENPREDPKEIEKNMAEAMDK |
| Ga0209406_10148034 | 3300025694 | Pelagic Marine | MYTLVEEASKVLRTPPAVFDFENPPHDPKELESLMSEAMEKFGGIGL |
| Ga0209406_11098351 | 3300025694 | Pelagic Marine | MYELVEEASKVLRTPPLKFDFENPSQDPKEVEEQLANAMENFGGIGLSANQ |
| Ga0209602_10176731 | 3300025704 | Pelagic Marine | MYELIQEASKVLRTPPAVFDFENPPHDPKELESLMSEAMEKFG |
| Ga0209602_11287891 | 3300025704 | Pelagic Marine | MYTLVEEASKVLRTPPLEFDFDNPSEDPKEIESLLSEAMDRFGGIG |
| Ga0209305_10342371 | 3300025712 | Pelagic Marine | MYQLVEEASKVLRQPPEIFDFENPREDPKEIEKNMAEA |
| Ga0209137_11596011 | 3300025767 | Marine | MYELVEEASKVLRTPPLVFDFENPSHDPKEVEQKLSEAM |
| Ga0209600_11615372 | 3300025821 | Pelagic Marine | MLELIEEASKVLRTPPPEFDFDKPPEDPEEIEFNLAAAMEQYGGIGLS |
| Ga0209832_11310641 | 3300025830 | Pelagic Marine | MYQLIEEASKVLRTPPLVFDFENRTDAEEIEKSLTEAM |
| Ga0209308_100139406 | 3300025869 | Pelagic Marine | MLELIEEASKVLRTPPPEFDFENPPEDPKEIETNLSSAMEQF |
| Ga0209630_101032421 | 3300025892 | Pelagic Marine | MLELIEEASKVLRTPPPEFDFENPPEDPKEIETNLSSAMEQ |
| Ga0209630_102946032 | 3300025892 | Pelagic Marine | MYELIQEASKVLRTPPAVFDFENPPHDPKELESLMSEAMEKFGGIGLSANQVG |
| Ga0208763_10044401 | 3300026136 | Marine | MYQLIEEASQVLRTPPPVFDFENPAEPPEEIAKNMAEAMEKFGGLGLSAN |
| Ga0208405_10016451 | 3300026189 | Marine | MYSLVEEASQVLREPPPVFDFDNPPEDPKEIASKMAE |
| Ga0208680_10276672 | 3300027253 | Estuarine | MYQLVEEASKVLRTRPSDFDFETREDAEEIESKLSETME |
| Ga0209502_101017151 | 3300027780 | Marine | MYELVEEASKVLRTPPLVFDFENPTHDPKEVEQKLS |
| Ga0209404_101582921 | 3300027906 | Marine | MYQLVEEASKVLRIPPLEFDFKNPTHDPKEVEQKLAEAMEKFGGLGL |
| Ga0233450_100771831 | 3300028115 | Salt Marsh | MYELIDEASKVLRTPPPEFDFENPPEDPKEIEKNLAAAMER |
| Ga0257114_13151691 | 3300028196 | Marine | MYELVEEASKVLRTPPLVFDFENPSHDPKEVEQKLSEAMDKFGGI |
| Ga0257126_11168322 | 3300028287 | Marine | MLELIEEASKVLRTPPPEFDFENPPEDPKEIEINMAAAM |
| Ga0233394_10304581 | 3300028391 | Seawater | MYELIDEASKVLRTPPPVFDFENPPEDPKEIETNLASAMERFGGIGLSANQ |
| Ga0308014_10246311 | 3300031628 | Marine | MYELIQEASKVLRTPPLVLDFENPSHDPKDVEVKLAEA |
| Ga0308005_100085131 | 3300031656 | Marine | MYELIQEASKVLRTPPLVLDFENPSHDPKDVEVKLAEAMTKFGGLGL |
| Ga0308006_102595882 | 3300031683 | Marine | MYQLIEEASKVLRTPPQTFDFEKRTDAEEIEKALSDAMGRFGGIGLSANQ |
| Ga0315320_102832871 | 3300031851 | Seawater | MLELIEEASKVLRTPPPEFDFENPPEDPEEIEFNMA |
| Ga0315318_100604393 | 3300031886 | Seawater | MYKLVEEASKVLRTPPDEFDFNEPPEDPKEIEKNLAECVSTFGGLGL |
| Ga0315333_101672871 | 3300032130 | Seawater | MHKLIEEASKVLREPTDLFDFENPPEDPKEIEKNLAEAMSRFGGLGLSA |
| Ga0310342_1021212271 | 3300032820 | Seawater | MGDGTKLYELIEEASKVLRTPPADFDFDNPSADPKEIETNLSETLTKFG |
| ⦗Top⦘ |