| Basic Information | |
|---|---|
| Family ID | F084320 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 112 |
| Average Sequence Length | 43 residues |
| Representative Sequence | TILEERLPVDLGMPAEVITHLECLEDHAEVHHEQHYTGKPD |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.94 % |
| % of genes near scaffold ends (potentially truncated) | 88.39 % |
| % of genes from short scaffolds (< 2000 bps) | 82.14 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (71.429 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil (20.536 % of family members) |
| Environment Ontology (ENVO) | Unclassified (50.893 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.786 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.64% β-sheet: 0.00% Coil/Unstructured: 75.36% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF13545 | HTH_Crp_2 | 13.39 |
| PF01545 | Cation_efflux | 4.46 |
| PF13620 | CarboxypepD_reg | 3.57 |
| PF03006 | HlyIII | 3.57 |
| PF00589 | Phage_integrase | 2.68 |
| PF00990 | GGDEF | 2.68 |
| PF05187 | ETF_QO | 1.79 |
| PF00171 | Aldedh | 1.79 |
| PF13442 | Cytochrome_CBB3 | 1.79 |
| PF00933 | Glyco_hydro_3 | 1.79 |
| PF02583 | Trns_repr_metal | 1.79 |
| PF13180 | PDZ_2 | 1.79 |
| PF02321 | OEP | 0.89 |
| PF01844 | HNH | 0.89 |
| PF01022 | HTH_5 | 0.89 |
| PF13424 | TPR_12 | 0.89 |
| PF13709 | DUF4159 | 0.89 |
| PF14107 | DUF4280 | 0.89 |
| PF14714 | KH_dom-like | 0.89 |
| PF06181 | Urate_ox_N | 0.89 |
| PF02012 | BNR | 0.89 |
| PF07883 | Cupin_2 | 0.89 |
| PF04311 | DUF459 | 0.89 |
| PF01433 | Peptidase_M1 | 0.89 |
| PF02838 | Glyco_hydro_20b | 0.89 |
| PF03466 | LysR_substrate | 0.89 |
| PF01551 | Peptidase_M23 | 0.89 |
| PF13883 | Pyrid_oxidase_2 | 0.89 |
| PF12371 | TMEM131_like_N | 0.89 |
| PF04389 | Peptidase_M28 | 0.89 |
| PF14559 | TPR_19 | 0.89 |
| PF07238 | PilZ | 0.89 |
| PF01636 | APH | 0.89 |
| PF04879 | Molybdop_Fe4S4 | 0.89 |
| PF00571 | CBS | 0.89 |
| PF13462 | Thioredoxin_4 | 0.89 |
| PF08239 | SH3_3 | 0.89 |
| PF13432 | TPR_16 | 0.89 |
| PF12769 | PNTB_4TM | 0.89 |
| PF05532 | CsbD | 0.89 |
| PF01925 | TauE | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 4.46 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 4.46 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 4.46 |
| COG1272 | Predicted membrane channel-forming protein YqfA, hemolysin III family | Intracellular trafficking, secretion, and vesicular transport [U] | 3.57 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 1.79 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 1.79 |
| COG2440 | Ferredoxin-like protein FixX | Energy production and conversion [C] | 1.79 |
| COG1937 | DNA-binding transcriptional regulator, FrmR family | Transcription [K] | 1.79 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.79 |
| COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 1.79 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 1.79 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 1.79 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.89 |
| COG2845 | Peptidoglycan O-acetyltransferase, SGNH hydrolase family | Cell wall/membrane/envelope biogenesis [M] | 0.89 |
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 0.89 |
| COG3525 | N-acetyl-beta-hexosaminidase | Carbohydrate transport and metabolism [G] | 0.89 |
| COG3748 | Uncharacterized membrane protein | Function unknown [S] | 0.89 |
| COG0308 | Aminopeptidase N, contains DUF3458 domain | Amino acid transport and metabolism [E] | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.43 % |
| Unclassified | root | N/A | 28.57 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004152|Ga0062386_101398142 | Not Available | 583 | Open in IMG/M |
| 3300004598|Ga0068975_1215083 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300004604|Ga0068943_1287300 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300004618|Ga0068963_1358937 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300004970|Ga0072320_1287348 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300005332|Ga0066388_108743169 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300005468|Ga0070707_101412249 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Thermoflavifilum | 663 | Open in IMG/M |
| 3300005542|Ga0070732_10274694 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1010 | Open in IMG/M |
| 3300006354|Ga0075021_10609618 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300009520|Ga0116214_1098680 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300009521|Ga0116222_1082431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1387 | Open in IMG/M |
| 3300009524|Ga0116225_1531223 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300009616|Ga0116111_1060506 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1056 | Open in IMG/M |
| 3300009623|Ga0116133_1079109 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300009637|Ga0116118_1213487 | Not Available | 602 | Open in IMG/M |
| 3300009637|Ga0116118_1259247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 532 | Open in IMG/M |
| 3300009839|Ga0116223_10064229 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2364 | Open in IMG/M |
| 3300010341|Ga0074045_10828869 | Not Available | 584 | Open in IMG/M |
| 3300010343|Ga0074044_10594058 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300010379|Ga0136449_101216440 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
| 3300011015|Ga0138535_107504 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300011081|Ga0138575_1025907 | Not Available | 587 | Open in IMG/M |
| 3300011081|Ga0138575_1183811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 608 | Open in IMG/M |
| 3300011082|Ga0138526_1055858 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300011084|Ga0138562_1189570 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300011090|Ga0138579_1120433 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300011109|Ga0138539_1107017 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300011305|Ga0138532_1126774 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300014153|Ga0181527_1130243 | Not Available | 1129 | Open in IMG/M |
| 3300014156|Ga0181518_10001313 | All Organisms → cellular organisms → Bacteria | 25661 | Open in IMG/M |
| 3300014159|Ga0181530_10359012 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300014164|Ga0181532_10057379 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2544 | Open in IMG/M |
| 3300014168|Ga0181534_10111010 | Not Available | 1379 | Open in IMG/M |
| 3300014168|Ga0181534_11011403 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 502 | Open in IMG/M |
| 3300014199|Ga0181535_10688433 | Not Available | 582 | Open in IMG/M |
| 3300014200|Ga0181526_10579247 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300014200|Ga0181526_10761947 | Not Available | 610 | Open in IMG/M |
| 3300014501|Ga0182024_10852542 | Not Available | 1104 | Open in IMG/M |
| 3300014501|Ga0182024_11806148 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 684 | Open in IMG/M |
| 3300014501|Ga0182024_12613907 | Not Available | 542 | Open in IMG/M |
| 3300014839|Ga0182027_12008730 | Not Available | 553 | Open in IMG/M |
| 3300017822|Ga0187802_10354951 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300017924|Ga0187820_1086276 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 889 | Open in IMG/M |
| 3300017924|Ga0187820_1122760 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 763 | Open in IMG/M |
| 3300017926|Ga0187807_1282849 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300017930|Ga0187825_10239152 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300017935|Ga0187848_10284876 | Not Available | 692 | Open in IMG/M |
| 3300017938|Ga0187854_10057738 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1916 | Open in IMG/M |
| 3300017946|Ga0187879_10547116 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300017946|Ga0187879_10631165 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300017973|Ga0187780_10170065 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1515 | Open in IMG/M |
| 3300018002|Ga0187868_1203082 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 688 | Open in IMG/M |
| 3300018033|Ga0187867_10809740 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 508 | Open in IMG/M |
| 3300018034|Ga0187863_10637278 | Not Available | 600 | Open in IMG/M |
| 3300018038|Ga0187855_10796919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 551 | Open in IMG/M |
| 3300018042|Ga0187871_10257191 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300018044|Ga0187890_10750045 | Not Available | 552 | Open in IMG/M |
| 3300018047|Ga0187859_10423393 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300018062|Ga0187784_10083735 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2593 | Open in IMG/M |
| 3300018086|Ga0187769_10413829 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1014 | Open in IMG/M |
| 3300019275|Ga0187798_1275473 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300021181|Ga0210388_10104905 | All Organisms → cellular organisms → Bacteria | 2423 | Open in IMG/M |
| 3300021404|Ga0210389_10009801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7407 | Open in IMG/M |
| 3300021420|Ga0210394_11343953 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300021420|Ga0210394_11811773 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300021477|Ga0210398_10316846 | All Organisms → cellular organisms → Bacteria | 1272 | Open in IMG/M |
| 3300021559|Ga0210409_10428842 | Not Available | 1181 | Open in IMG/M |
| 3300023090|Ga0224558_1153790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
| 3300024227|Ga0228598_1040676 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300025496|Ga0208191_1014065 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2097 | Open in IMG/M |
| 3300025576|Ga0208820_1063634 | Not Available | 986 | Open in IMG/M |
| 3300025914|Ga0207671_11459363 | Not Available | 529 | Open in IMG/M |
| 3300027497|Ga0208199_1108634 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300027625|Ga0208044_1126866 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 723 | Open in IMG/M |
| 3300027905|Ga0209415_10036431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 6847 | Open in IMG/M |
| 3300027905|Ga0209415_10901252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus saanensis → Terriglobus saanensis SP1PR4 | 601 | Open in IMG/M |
| 3300028268|Ga0255348_1070971 | Not Available | 603 | Open in IMG/M |
| 3300028560|Ga0302144_10300334 | Not Available | 520 | Open in IMG/M |
| 3300028566|Ga0302147_10159017 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300028574|Ga0302153_10301201 | Not Available | 548 | Open in IMG/M |
| 3300028873|Ga0302197_10380398 | Not Available | 626 | Open in IMG/M |
| 3300028882|Ga0302154_10018431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4335 | Open in IMG/M |
| 3300029914|Ga0311359_10024459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 7155 | Open in IMG/M |
| 3300029914|Ga0311359_10246078 | All Organisms → cellular organisms → Bacteria | 1524 | Open in IMG/M |
| 3300029945|Ga0311330_10761484 | Not Available | 738 | Open in IMG/M |
| 3300029956|Ga0302150_10291666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus saanensis → Terriglobus saanensis SP1PR4 | 609 | Open in IMG/M |
| 3300029994|Ga0302283_1078772 | All Organisms → cellular organisms → Bacteria | 1419 | Open in IMG/M |
| 3300030011|Ga0302270_10099809 | All Organisms → cellular organisms → Bacteria | 1835 | Open in IMG/M |
| 3300030020|Ga0311344_11221909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Aquabacterium → Aquabacterium soli | 565 | Open in IMG/M |
| 3300030044|Ga0302281_10224980 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 776 | Open in IMG/M |
| 3300030524|Ga0311357_10429002 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
| 3300031261|Ga0302140_10851612 | Not Available | 644 | Open in IMG/M |
| 3300031524|Ga0302320_10231391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 2579 | Open in IMG/M |
| 3300031525|Ga0302326_13702538 | Not Available | 503 | Open in IMG/M |
| 3300031708|Ga0310686_116324960 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300031719|Ga0306917_10055018 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2694 | Open in IMG/M |
| 3300031748|Ga0318492_10371485 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 750 | Open in IMG/M |
| 3300031788|Ga0302319_11485666 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300031805|Ga0318497_10716773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 561 | Open in IMG/M |
| 3300032160|Ga0311301_10817369 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
| 3300032160|Ga0311301_12404512 | Not Available | 594 | Open in IMG/M |
| 3300032805|Ga0335078_10019191 | All Organisms → cellular organisms → Bacteria | 10168 | Open in IMG/M |
| 3300033004|Ga0335084_11997533 | Not Available | 565 | Open in IMG/M |
| 3300033134|Ga0335073_11336712 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 705 | Open in IMG/M |
| 3300033134|Ga0335073_12114821 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 509 | Open in IMG/M |
| 3300033887|Ga0334790_019433 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3108 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 20.54% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 13.39% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 9.82% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 8.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.14% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 6.25% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.46% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.57% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.57% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 2.68% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 2.68% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.79% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.79% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.79% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.79% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.89% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.89% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.89% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.89% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004598 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 72 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004604 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 31 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004618 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 55 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004970 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009637 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011015 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 13 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011081 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 60 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011082 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 4 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011084 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 47 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011090 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 69 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011109 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 18 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011305 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 10 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014496 | Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018002 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300019275 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300023090 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24 | Environmental | Open in IMG/M |
| 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
| 3300025412 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025496 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025576 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028268 | Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T-25.v5 | Environmental | Open in IMG/M |
| 3300028560 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300028566 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_2 | Environmental | Open in IMG/M |
| 3300028574 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300028873 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300028882 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029956 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_2 | Environmental | Open in IMG/M |
| 3300029994 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_4 | Environmental | Open in IMG/M |
| 3300030011 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_3 | Environmental | Open in IMG/M |
| 3300030020 | II_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030044 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_2 | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300031261 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1 | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062386_1013981422 | 3300004152 | Bog Forest Soil | LEERLPGELTMPAEVITHLESREDHAEVHHREHYTGLPQ* |
| Ga0068975_12150831 | 3300004598 | Peatlands Soil | HRLATILEERLPTDLGVPAEVITHLECLEDHADVHHDQHYTGKPE* |
| Ga0068943_12873001 | 3300004604 | Peatlands Soil | LATILEERLPSELGMPAEVITHLESVEDHADVHREPHYTGKPE* |
| Ga0068963_13589371 | 3300004618 | Peatlands Soil | VSEAHRLATILEERLPVELEMPAEVITHLECLEDHADVHSAQHYIGKPD* |
| Ga0072320_12873481 | 3300004970 | Peatlands Soil | ATILEERLPVELEMPAEVITHLECLEDHADVHSAQHYIGKPD* |
| Ga0066388_1087431692 | 3300005332 | Tropical Forest Soil | EAHRLATALEERLPVELGKPAEVITHLESIDDHEDVHATEHYTGRPE* |
| Ga0070707_1014122492 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | TILEERLPIDLGTPAEVITHLECLEDHADVHHEQHYTGKPE* |
| Ga0070732_102746942 | 3300005542 | Surface Soil | LATALEERLPAQLGSPAEVITHLESVEDHEAVHSQEHYTGRPE* |
| Ga0075021_106096181 | 3300006354 | Watersheds | RLPAELDMPAEVVTHLEALEDHDHVHRQEHYTGKPQ* |
| Ga0116214_10986801 | 3300009520 | Peatlands Soil | LLFPRLTPVSEAHRLATILEERLPVELEMPAEVITHLECLEDHADVHSAQHYIGKPD* |
| Ga0116222_10824311 | 3300009521 | Peatlands Soil | TSVSQAHSLATILEERLPVDLGMPAEVITHLECLEDHAEVHHEQHYTGKPD* |
| Ga0116225_15312231 | 3300009524 | Peatlands Soil | LPTDLGVPAEVITHLECLEDHADVHHDQHYTGKPE* |
| Ga0116111_10605063 | 3300009616 | Peatland | PAELAMPAEVMTHLESLGDHSDVHRERYYTGKPE* |
| Ga0116133_10791092 | 3300009623 | Peatland | EERLAETLGQPSEVFTHLEAQDDHEVVHRAMHYTGKPGER* |
| Ga0116118_12134872 | 3300009637 | Peatland | LLYHLEERLPAKLGMPAEVMTHLEFLEDHADVHREQHYTGKPE* |
| Ga0116118_12592471 | 3300009637 | Peatland | ERLPAELGMPAEVITHLESLEDHGEVHREQHYTGKPE* |
| Ga0116223_100642293 | 3300009839 | Peatlands Soil | PVDLGMPAEVITHLECLEDHAEVHHEQHYTGKPD* |
| Ga0074045_108288691 | 3300010341 | Bog Forest Soil | RLPAELGMPAEVITHLESLEDHADVHREQHYTGKPE* |
| Ga0074044_105940581 | 3300010343 | Bog Forest Soil | PPELSVPAEVFTHLESAEDHAAVHAKEHYTGKPE* |
| Ga0136449_1012164401 | 3300010379 | Peatlands Soil | TSVSEAHRLATILEERLPAELGMPAEVITHLEPLEDHAEVHREQHYTGKPA* |
| Ga0138535_1075041 | 3300011015 | Peatlands Soil | RLPTDLGVPAEVITHLECLEDHADVHHDQHYTGKPE* |
| Ga0138575_10259072 | 3300011081 | Peatlands Soil | FPRLTSVSEAHRLATILEERLPVDLGMPAEVITHLECLEDHADVHHEEHYTGKPE* |
| Ga0138575_11838111 | 3300011081 | Peatlands Soil | LPEGLGVPAEVITHLESLEDHASVHHAEHYTGRPL* |
| Ga0138526_10558581 | 3300011082 | Peatlands Soil | RLATILEERLPTDLGVPAEVITHLECLEDHADVHHDQHYTGKPE* |
| Ga0138562_11895702 | 3300011084 | Peatlands Soil | VSEAHRLATILEERLPTDLGVPAEVITHLECLEDHADVHHDQHYTGKPE* |
| Ga0138579_11204331 | 3300011090 | Peatlands Soil | SVSEAHRLATILEERLPTDLGVPAEVITHLECLEDHADVHHDQHYTGKPE* |
| Ga0138539_11070172 | 3300011109 | Peatlands Soil | ALEERLPVELGSRAEVITHLESLEDHEHVHSTGHYTGRPE* |
| Ga0138532_11267741 | 3300011305 | Peatlands Soil | TILEERLPVELEMPAEVITHLECLEDHADVHSAQHYIGKPD* |
| Ga0181527_11302432 | 3300014153 | Bog | ATILEERLPAELGMPAEVVTHLEALEDHAVVHHREHYTGKPG* |
| Ga0181524_105206242 | 3300014155 | Bog | AQDLEMPAEVTTHLESLEDHTVVHHVQHYTGRPD* |
| Ga0181518_1000131319 | 3300014156 | Bog | MAVGEAHRLATLLEERLSQELSVPAEVFTDLESAEDHAAVHAKEQYTGKPEETPLQV* |
| Ga0181530_103590122 | 3300014159 | Bog | GEAHRLATLLEERLPPELSVPAEVFTHLESVEDHAAVHTKEHYTGRPE* |
| Ga0181532_100573794 | 3300014164 | Bog | LLEERLPRELSVPAEVFTHLESAEDHAVVHAKEHYTGKPE* |
| Ga0181534_101110102 | 3300014168 | Bog | AHRLATILEERLPRELGAPAEVITHLESSEDHADVHYERHYTGKPE* |
| Ga0181534_110114031 | 3300014168 | Bog | SLTSVSEAHTLATTLEERLPKELGMPAEVITHLEALEDHADVHHSQHYTGKPD* |
| Ga0181535_106884332 | 3300014199 | Bog | EAHRLATLLEERLPCELSVPAEVFTHLESVEDHAAVHAQEHYTGKPE* |
| Ga0181526_105792472 | 3300014200 | Bog | PAELGVPAEVITHLESLEDHADVHCERHYTGKPD* |
| Ga0181526_107619471 | 3300014200 | Bog | EAHRLATLLEERLPETLGQPAELITHLEAQDDHEAVHRALHYTGKPGVR* |
| Ga0182011_107524882 | 3300014496 | Fen | AIDSEMPSEVTTHLESREDHSKVHHVQHYTGRPD* |
| Ga0182024_108525423 | 3300014501 | Permafrost | LEERLPSELGMPAEIITHLECLEDHADVHHEQHYTGKPE* |
| Ga0182024_118061482 | 3300014501 | Permafrost | VSEAHGLAKVLEERLPVDLGMPAKVITHLECVEDHADVHHYQ |
| Ga0182024_126139072 | 3300014501 | Permafrost | PVELGIPAEVSTHLESLEDHAAVHHHMHYTGKPD* |
| Ga0182027_120087302 | 3300014839 | Fen | ERLPAELGMPAEVITHLEALEDHAEVHHHEHYTGKPGSG* |
| Ga0187802_103549512 | 3300017822 | Freshwater Sediment | HRLATMLEERLPVDLGMPAEVITHLECLEDHADVHHEEHYTGKPE |
| Ga0187820_10862762 | 3300017924 | Freshwater Sediment | FPRLTSVSEAHRLATMLEERLPVDLGMPAEVITHLECLEDHADVHHEEHYTGKPE |
| Ga0187820_11227601 | 3300017924 | Freshwater Sediment | TILEERLPVDLGMPAEVITHLECLEDHAEVHHEQHYTGKPD |
| Ga0187807_12828492 | 3300017926 | Freshwater Sediment | EAHRLATILEERLPVDLGMPAEVITHLECLEDHADVHREEHYTGKPE |
| Ga0187825_102391521 | 3300017930 | Freshwater Sediment | AHRLATALEERLPVALGKPAEVITHLESVEDHEHVHATEHYTGRPE |
| Ga0187848_102848762 | 3300017935 | Peatland | PRLTLVSDAHRLATILEERLPAELGMPAEVITHLEALEDHAEVHHREHYTGKPG |
| Ga0187854_100577381 | 3300017938 | Peatland | RLPAELGMPAEVVTHLESLEDHADVHHEQHYTGKPD |
| Ga0187879_105471162 | 3300017946 | Peatland | ATALEERLPAELGMPAEVITHLEALEDHAEVHHHQHYTGKPG |
| Ga0187879_106311652 | 3300017946 | Peatland | ATLLEERLAETLGQPSEVFTHLEAQDDHEVVHRAMHYTGKPGER |
| Ga0187780_101700653 | 3300017973 | Tropical Peatland | RLATALEEGLPERLRAPAEVITHLESIEDHENVHSREHYTGRPGVGITDR |
| Ga0187782_102971491 | 3300017975 | Tropical Peatland | ERLAVDLDMPAEVNTHLESLDDHSEVHGVEHYTGRPD |
| Ga0187868_12030821 | 3300018002 | Peatland | ALEERLPNELHMPAEVITHLESAEDHALVHHRQHYTGKPD |
| Ga0187867_108097401 | 3300018033 | Peatland | EERLAEDLEMPAEVITHLESLEDHAEVHRVEHYTGRPD |
| Ga0187863_106372782 | 3300018034 | Peatland | VETLGQPAEVITHLEARDDHEAVHRAVHYTGKPGER |
| Ga0187855_107969191 | 3300018038 | Peatland | LLFPRHTSVSEAHGLATILEERLPVELGMPAEVITHLESVEDHAEVHHRQHYTGRPD |
| Ga0187871_102571911 | 3300018042 | Peatland | RLATLLEERLPQELSVPAEVFTHLESAEDHAAVHAKEHYTGKPE |
| Ga0187890_107500452 | 3300018044 | Peatland | EERLPQELTVPAEVFTHLESAEDHEAVHTRQHYTGKPE |
| Ga0187859_104233931 | 3300018047 | Peatland | LPAELGMPAEVTTHLESLEDHADVHREQHYTGKPD |
| Ga0187784_100837351 | 3300018062 | Tropical Peatland | ERLPVELHTPAEVITHLESLEDHEHVHATEHYTGRPE |
| Ga0187769_104138292 | 3300018086 | Tropical Peatland | MLEERLPTELKMPAEVVTHLEALEDHADVHREDHYTGKPE |
| Ga0187798_12754732 | 3300019275 | Peatland | LATLLEERLPEALGQPAEVITHLEAQDDHEMVHRDPHYTGKP |
| Ga0210388_101049052 | 3300021181 | Soil | LFPRQTSVSEAHRLATIPEERLPVNLGMPAEVITHMECLEDHAEVHREQHYTGKPE |
| Ga0210389_100098017 | 3300021404 | Soil | LPVELGRPAEVITHLESLEDHEHVHSTGHVTDRTG |
| Ga0210394_113439532 | 3300021420 | Soil | LTSVSDAHRLATILEERLPINLGMPAEVITHLECLEDHADVHHEQHYTGKPE |
| Ga0210394_118117731 | 3300021420 | Soil | EERLPTDLGMPAEVITHLECLEDHADVHHDQHYTGKPE |
| Ga0210398_103168462 | 3300021477 | Soil | LFPRQTSVSEAHRLATIPEERLPVNLGMPAEVITHMECLEDHAEVH |
| Ga0210409_104288422 | 3300021559 | Soil | ELWSTEIEMPAEVMTHLESLEDRADVHYEQHYTGKPE |
| Ga0224558_11537901 | 3300023090 | Soil | ERLPAELGTPAEVITHLESLEDHADVHREQHYTGKPE |
| Ga0228598_10406761 | 3300024227 | Rhizosphere | RMTSVSEAHRLATILEERLPTDLGMPAEVITHLECLEDHAEVHHDQHYTGKPE |
| Ga0208194_10455752 | 3300025412 | Peatland | QLALDLEMPAEVTTHLESLEDHSEVHHMQHYTGRPD |
| Ga0208191_10140653 | 3300025496 | Peatland | TILEERLPAELAMPAEVMTHLESLGDHSDVHRERYYTGKPE |
| Ga0208820_10636342 | 3300025576 | Peatland | LLYHLEERLPAKLGMPAEVMTHLEFLEDHADVHREQHYTGKPE |
| Ga0207671_114593631 | 3300025914 | Corn Rhizosphere | RLATLLEERLMEALGQPAEVITHLEAQDDHEVVHRAAHYTGKPGSERSND |
| Ga0208199_11086341 | 3300027497 | Peatlands Soil | EAHRLATILEERLPVELEMPAEVITHLECLEDHADVHSAQHYIGKPD |
| Ga0208044_11268661 | 3300027625 | Peatlands Soil | LPTDLGVPAEVITHLECLEDHADVHHDQHYTGKPE |
| Ga0209415_100364311 | 3300027905 | Peatlands Soil | HLLFPRLTSVSEAHRLATILEERLPVDLGMPAEVITHLECLEDHADVHHEEHYTGKPE |
| Ga0209415_109012522 | 3300027905 | Peatlands Soil | LFPRLTPVSEAHGLATILEERLPAELGTPAEVITHLEALEDHAEVHHREHYTGKPE |
| Ga0255348_10709711 | 3300028268 | Soil | VEERLAAELTTPTEVITHMEAEEDHESVHAHEHYTGLPL |
| Ga0302144_103003342 | 3300028560 | Bog | TSVSETHGLATILEERLPAELGMPAEVITHLEALEDHADVHHHQHYTGKPE |
| Ga0302147_101590173 | 3300028566 | Bog | LTEEIGMPAEVITHLESLEDHADVNHSQHYTGKPE |
| Ga0302153_103012011 | 3300028574 | Bog | AHGLATILEERLPAELGMPAEVITHLEALEDHADVHHHQHYTGKPE |
| Ga0302197_103803982 | 3300028873 | Bog | DAHALATTIEERLPAELGMPAEIITHLEALEDHAEVHRREHYTGKPE |
| Ga0302154_100184311 | 3300028882 | Bog | HALATTIEERLPAELGMPAEIITHLEALEDHAEVHRREHYTGKPE |
| Ga0311359_100244598 | 3300029914 | Bog | TSVSDAHALATILEERLPAELGMPAEVITHLEALEDHAEVHHHQHYTGKPG |
| Ga0311359_102460784 | 3300029914 | Bog | LEERLPPELSVPAEVFTHLESVEDHAAVHTKEHYTGKPE |
| Ga0311330_107614843 | 3300029945 | Bog | TSVSDAHALATTIEERLPVELGMPAEIITHLEALEDHAQVHRREHYTGKPE |
| Ga0302150_102916661 | 3300029956 | Bog | ILEERLPAELGMPAEVITHLEALEDHAVVHHREHYTGKPG |
| Ga0302283_10787723 | 3300029994 | Fen | LFPNLTSVSEAHGLATILEERLPAELGMPAEVITHLEALEDHAVVHHREHYTGKPG |
| Ga0302270_100998093 | 3300030011 | Bog | VSEAHGLATILEERLPAELGMPAEVITHLEALEDHAVVHHREHYTGKPG |
| Ga0311344_100166079 | 3300030020 | Bog | EERLALDSEMPLEVTTHLESREDHSKVHHVQHYTGRPD |
| Ga0311344_112219091 | 3300030020 | Bog | HGLATVLEERLPMELGIPAEVITHLECVEDHAVVHHHEHYTGKPD |
| Ga0302281_102249802 | 3300030044 | Fen | RLPVELGKPAEVTTHLESLEDHAAVHHHIHYTGKPD |
| Ga0311357_104290021 | 3300030524 | Palsa | NLATMVEERLPVELGMPAEVVTHLEGLEDHSEAHHHRQRYTGKPD |
| Ga0302140_108516122 | 3300031261 | Bog | SEAHALATMIEERLPVELGVPAELITHIEALEDHAEVHHHEHYTGKPG |
| Ga0302320_102313911 | 3300031524 | Bog | LLFPRLTSVSDAHALATTVEERLPAELGMPAEIITHLEALEDHAEVHRRQHYTGKPE |
| Ga0302326_137025382 | 3300031525 | Palsa | RLAAELTMPTEVITHMEAEEDHESVHAREHYTGLPS |
| Ga0310686_1163249601 | 3300031708 | Soil | ATPVGAAHRLATQLEERLPQELSVPAEVFTNLESVEDHAAVHTKEHYTGKPE |
| Ga0306917_100550183 | 3300031719 | Soil | VIEERLPAELSMPAEVITHLESEEDHQEVHTREHYTGLPL |
| Ga0318492_103714852 | 3300031748 | Soil | VIEERLPAELSMPAEVITHLESEEDHQEVHTREHYT |
| Ga0302319_114856662 | 3300031788 | Bog | ATVLEERLAAEMTVPTEVVTHLEAAEDHASVHHWAHYTGLPK |
| Ga0318497_107167731 | 3300031805 | Soil | VIEERLPAELSMPAEVITHLESEEDHQEVHTREHY |
| Ga0311301_108173691 | 3300032160 | Peatlands Soil | TSVSEAHRLATILEERLPAELGMPAEVITHLEPLEDHAEVHREQHYTGKPA |
| Ga0311301_124045121 | 3300032160 | Peatlands Soil | LPADLGMPAEVITHLESLEDHGDVHGARHYTGKPE |
| Ga0335078_100191918 | 3300032805 | Soil | LFPRLTSVSEAHRLATILEERLPAELGMPAEVMTHLESVEDHADVHHGQHYTGKPE |
| Ga0335084_119975332 | 3300033004 | Soil | TIEEELPRGLEVPAEVITHLESMEDHADVHKAVHYTGRPS |
| Ga0335073_113367122 | 3300033134 | Soil | TLLEERLGETLGQPAEVITHLEAQDDHEVVHRAAHYTGKPASR |
| Ga0335073_121148212 | 3300033134 | Soil | TVLEERLPVELGMRAEVLTHLEALEDHTDVHSREHYTGKPA |
| Ga0326727_104023582 | 3300033405 | Peat Soil | ERLAVDLEMPAEVTTHLESIEDHSVVHHMQHYTGRPD |
| Ga0334790_019433_2976_3107 | 3300033887 | Soil | LATHVEERLAETLGQPAEVITHLEALDDHEAVHRALHYTGKPS |
| ⦗Top⦘ |