NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F084295

Metagenome Family F084295

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F084295
Family Type Metagenome
Number of Sequences 112
Average Sequence Length 61 residues
Representative Sequence LRLGLASVLMLSGIKLIDFAGADYVIAAGVVIAGLAFAGWGFVARLGRRPRPETATSSD
Number of Associated Samples 105
Number of Associated Scaffolds 112

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.80 %
% of genes near scaffold ends (potentially truncated) 97.32 %
% of genes from short scaffolds (< 2000 bps) 98.21 %
Associated GOLD sequencing projects 99
AlphaFold2 3D model prediction Yes
3D model pTM-score0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (77.679 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(22.321 % of family members)
Environment Ontology (ENVO) Unclassified
(37.500 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(53.571 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 52.87%    β-sheet: 0.00%    Coil/Unstructured: 47.13%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.40
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 112 Family Scaffolds
PF13860FlgD_ig 62.50
PF00551Formyl_trans_N 8.93
PF00496SBP_bac_5 4.46
PF02911Formyl_trans_C 4.46
PF02585PIG-L 1.79
PF09594GT87 0.89
PF07690MFS_1 0.89

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 112 Family Scaffolds
COG0223Methionyl-tRNA formyltransferaseTranslation, ribosomal structure and biogenesis [J] 4.46
COG2120N-acetylglucosaminyl deacetylase, LmbE familyCarbohydrate transport and metabolism [G] 1.79


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms77.68 %
UnclassifiedrootN/A22.32 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000881|JGI10215J12807_1137546All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium758Open in IMG/M
3300000891|JGI10214J12806_11478991All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium919Open in IMG/M
3300000956|JGI10216J12902_111250828All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300000956|JGI10216J12902_117279060All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1248Open in IMG/M
3300001205|C688J13580_1035588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium643Open in IMG/M
3300004643|Ga0062591_101770280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia629Open in IMG/M
3300005093|Ga0062594_102189994All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium597Open in IMG/M
3300005179|Ga0066684_10718885All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300005187|Ga0066675_10128061All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1717Open in IMG/M
3300005329|Ga0070683_101480475All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300005337|Ga0070682_100107058All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1856Open in IMG/M
3300005339|Ga0070660_100364634All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1191Open in IMG/M
3300005340|Ga0070689_100338532Not Available1260Open in IMG/M
3300005341|Ga0070691_10168934All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium1132Open in IMG/M
3300005365|Ga0070688_101479795All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium552Open in IMG/M
3300005438|Ga0070701_11054166All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300005458|Ga0070681_11881743Not Available526Open in IMG/M
3300005468|Ga0070707_101066634All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia774Open in IMG/M
3300005535|Ga0070684_101832120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium573Open in IMG/M
3300005545|Ga0070695_100837447All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium739Open in IMG/M
3300005553|Ga0066695_10732983All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium576Open in IMG/M
3300005558|Ga0066698_10707009All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300005576|Ga0066708_10654297All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia669Open in IMG/M
3300005578|Ga0068854_100870319Not Available790Open in IMG/M
3300005578|Ga0068854_101996191All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium534Open in IMG/M
3300005618|Ga0068864_101626903All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300005843|Ga0068860_100925014Not Available889Open in IMG/M
3300005985|Ga0081539_10233895All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium827Open in IMG/M
3300006358|Ga0068871_100599083All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1002Open in IMG/M
3300006854|Ga0075425_100079868All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia3696Open in IMG/M
3300006904|Ga0075424_101165653All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium821Open in IMG/M
3300006954|Ga0079219_10078917All Organisms → cellular organisms → Bacteria1538Open in IMG/M
3300006954|Ga0079219_10644935All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300007076|Ga0075435_100147268All Organisms → cellular organisms → Bacteria1978Open in IMG/M
3300009100|Ga0075418_10733362All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1066Open in IMG/M
3300009137|Ga0066709_100665057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1493Open in IMG/M
3300009174|Ga0105241_10812407Not Available862Open in IMG/M
3300009551|Ga0105238_10392066Not Available1381Open in IMG/M
3300010041|Ga0126312_11079965Not Available589Open in IMG/M
3300010321|Ga0134067_10064427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1203Open in IMG/M
3300010321|Ga0134067_10314475All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium607Open in IMG/M
3300010326|Ga0134065_10402404All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium550Open in IMG/M
3300010361|Ga0126378_13104286All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium529Open in IMG/M
3300010371|Ga0134125_11593763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria711Open in IMG/M
3300010373|Ga0134128_12047196All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria630Open in IMG/M
3300010400|Ga0134122_10222920All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1576Open in IMG/M
3300012200|Ga0137382_10236060All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1264Open in IMG/M
3300012200|Ga0137382_10286715All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1147Open in IMG/M
3300012207|Ga0137381_11037216All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia707Open in IMG/M
3300012208|Ga0137376_10642234All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium917Open in IMG/M
3300012285|Ga0137370_10252329All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1045Open in IMG/M
3300012499|Ga0157350_1029468All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium601Open in IMG/M
3300012882|Ga0157304_1116066Not Available506Open in IMG/M
3300012893|Ga0157284_10296741Not Available528Open in IMG/M
3300012896|Ga0157303_10181984Not Available591Open in IMG/M
3300012899|Ga0157299_10150613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria657Open in IMG/M
3300012902|Ga0157291_10198423All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium634Open in IMG/M
3300012913|Ga0157298_10204701All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium636Open in IMG/M
3300012916|Ga0157310_10095327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium948Open in IMG/M
3300012957|Ga0164303_10361135All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium882Open in IMG/M
3300012971|Ga0126369_13673551Not Available503Open in IMG/M
3300012984|Ga0164309_10171209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1466Open in IMG/M
3300012986|Ga0164304_10739938All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium752Open in IMG/M
3300012989|Ga0164305_10708184All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium824Open in IMG/M
3300015372|Ga0132256_101318089All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium835Open in IMG/M
3300015373|Ga0132257_100729684All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1233Open in IMG/M
3300018032|Ga0187788_10234740All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia722Open in IMG/M
3300018482|Ga0066669_11797482All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium566Open in IMG/M
3300019361|Ga0173482_10140425All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium929Open in IMG/M
3300022694|Ga0222623_10408189Not Available516Open in IMG/M
3300022889|Ga0247785_1015504All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium816Open in IMG/M
3300022893|Ga0247787_1060325All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium569Open in IMG/M
3300022899|Ga0247795_1049023All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium708Open in IMG/M
3300024182|Ga0247669_1074325All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria568Open in IMG/M
3300024224|Ga0247673_1008009All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1338Open in IMG/M
3300025885|Ga0207653_10033522All Organisms → cellular organisms → Bacteria1666Open in IMG/M
3300025900|Ga0207710_10491050All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium636Open in IMG/M
3300025912|Ga0207707_11475392Not Available540Open in IMG/M
3300025914|Ga0207671_10720499Not Available793Open in IMG/M
3300025917|Ga0207660_10136388All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1873Open in IMG/M
3300025927|Ga0207687_10325399Not Available1246Open in IMG/M
3300025931|Ga0207644_11569744Not Available552Open in IMG/M
3300025934|Ga0207686_11203266Not Available620Open in IMG/M
3300025936|Ga0207670_11563265Not Available561Open in IMG/M
3300025938|Ga0207704_10534112All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium951Open in IMG/M
3300025941|Ga0207711_10750013Not Available910Open in IMG/M
3300025981|Ga0207640_10580402Not Available946Open in IMG/M
3300026023|Ga0207677_11722352Not Available581Open in IMG/M
3300026301|Ga0209238_1279127All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium503Open in IMG/M
3300026323|Ga0209472_1235102All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium591Open in IMG/M
3300027424|Ga0209984_1075482Not Available505Open in IMG/M
3300027717|Ga0209998_10077801All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium800Open in IMG/M
3300027775|Ga0209177_10069634All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1048Open in IMG/M
3300028716|Ga0307311_10117678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia751Open in IMG/M
3300028718|Ga0307307_10035793All Organisms → cellular organisms → Bacteria1424Open in IMG/M
3300028719|Ga0307301_10129134All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium809Open in IMG/M
3300028768|Ga0307280_10258148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia628Open in IMG/M
3300028771|Ga0307320_10133311All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium956Open in IMG/M
3300028787|Ga0307323_10179698All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia764Open in IMG/M
3300028812|Ga0247825_10729849All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium713Open in IMG/M
3300028819|Ga0307296_10135979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1324Open in IMG/M
3300028824|Ga0307310_10040938Not Available1903Open in IMG/M
3300028824|Ga0307310_10400187All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium681Open in IMG/M
3300028876|Ga0307286_10119378All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium934Open in IMG/M
3300028878|Ga0307278_10423646All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium584Open in IMG/M
3300028878|Ga0307278_10486846All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia539Open in IMG/M
3300028881|Ga0307277_10541138All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium523Open in IMG/M
3300031858|Ga0310892_10315927All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium991Open in IMG/M
3300032002|Ga0307416_103429235Not Available530Open in IMG/M
3300032003|Ga0310897_10233717All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium816Open in IMG/M
3300032205|Ga0307472_100259926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1368Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil22.32%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.93%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere5.36%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.46%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.46%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.57%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.68%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.68%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.68%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.68%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.68%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.68%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.68%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.79%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.79%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.79%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.79%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.79%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.89%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.89%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.89%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.89%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.89%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.89%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.89%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.89%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.89%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.89%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000881Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soilEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001205Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005985Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012499Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.yng.030610EnvironmentalOpen in IMG/M
3300012882Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2EnvironmentalOpen in IMG/M
3300012893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1EnvironmentalOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012902Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1EnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012916Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300018032Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MGEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300022889Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S096-311B-4EnvironmentalOpen in IMG/M
3300022893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S126-311R-4EnvironmentalOpen in IMG/M
3300022899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6EnvironmentalOpen in IMG/M
3300024182Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10EnvironmentalOpen in IMG/M
3300024224Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK14EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)EnvironmentalOpen in IMG/M
3300027424Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027717Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10215J12807_113754613300000881SoilWLGLASVLMLSGIKLIDFSGADYVIAGGAIIAALAFAAWGLVARVGRRRSAESPA*
JGI10214J12806_1147899113300000891SoilSQFTPRVPDRVLRLGLASVLMLSGIKLIDFSGADYVIAGGAIIAALAFAAWGLVARVGRRRSAESPA*
JGI10216J12902_11125082823300000956SoilRRVPDRLLRLGLASVLMLSGVKLIDFAGADYAIAAGAIAAALGLAIWGLVARTGRRSSRPETSFSSD*
JGI10216J12902_11727906023300000956SoilSHFTLRVPDRALRLGLACVLMLSGVKLVDFPGADWVIAAGAIGAGVAFGAWGLVARIGRREPHPEAAS*
C688J13580_103558813300001205SoilSQFTPHVPDRVLRLGLASVLMLSGIKLIDFAGADYVIAGGAVVAALAFTAWGLVARAGRRRRRSVETPA*
Ga0062591_10177028013300004643SoilTSQFTLKVPDRTLRLGLASVLMLSGVKLIAFSGADWVIAGGAIAAGIGLAAWSLVARLGRRPRPEAAS*
Ga0062594_10218999423300005093SoilLASVLMLSGIKLIDFSGADYVIAAGVVIAGLAFAGWGFVARLGRRPRPETATSSD*
Ga0066684_1071888523300005179SoilPGILLTSQFTLKVPDRTLRLGLASVLMLSGVKLIDFAGADWVIAGGAVAAAIGLAAWSLVARIGRRRPLALDSQVREGS*
Ga0066675_1012806133300005187SoilASVLMLSGIKLIDFPGADWVIAGGAVAAALGISVWALMTRPARRPQAETVS*
Ga0070683_10148047513300005329Corn RhizosphereLISSQFTQVVPDRVLRLGLASVLVLSGIKLIDFAGSDYVIASGAVIAALGFAIWAFIARLGRRRPRPEPAPTSD*
Ga0070682_10010705813300005337Corn RhizosphereHFTLRVPDRALRLGLASVLMLSGIKLIDFAGADYVIAAAAIAAGVGFAAWGLVARLGRRPRPEAAPSSD*
Ga0070660_10036463413300005339Corn RhizosphereVLSGIKLVDFAGADYVIASGAVIAAIGFAIWAFVARLGRRRPRPEPAPTSD*
Ga0070689_10033853233300005340Switchgrass RhizosphereGLASVLMLSGIKLIDFSGADYVIAGGAIVAALAFATWGLIARAGRRRSVESPA*
Ga0070691_1016893423300005341Corn, Switchgrass And Miscanthus RhizosphereASVLMLSGIKLIDFSGADWVIAGGAIAAALGLASWHLVARLGRRPRPEAAS*
Ga0070688_10147979513300005365Switchgrass RhizosphereGIKLIDFAGSDYVIASGAVIAALGFAIWAFIARLGRRRPRPEPAPTSD*
Ga0070701_1105416623300005438Corn, Switchgrass And Miscanthus RhizosphereVLRLGLASVLVLSGIKLVDFAGADYVIASGAVIAAIGFAIWAFVARLGRRRPRPEPAPTSD*
Ga0070681_1188174323300005458Corn RhizosphereHFTLKVPDRALRLGLASVLMLSGIKLIDFAGADYVIAAAAIAAGLGFAAWGLVARLGRRPRPEAAPSSD*
Ga0070707_10106663423300005468Corn, Switchgrass And Miscanthus RhizosphereSVLMLSGIKLIDFPGADWAIAGGAIAAALGIPAWALMTRPARRPQAETAS*
Ga0070684_10183212023300005535Corn RhizosphereVLMLSGIKLIDFAGADYVIAAAAIAAGVGFAAWGLVARLGRRPRPEAAPSSD*
Ga0070695_10083744713300005545Corn, Switchgrass And Miscanthus RhizosphereIDFAGADYVIAAGVVIAGLAFAGWGFVARLGRRPRPETATSSD*
Ga0066695_1073298313300005553SoilVLMLSGIKLIDFAGADWVIAGGAVAAGLGISAWALVTRLGRRALPETVS*
Ga0066698_1070700923300005558SoilGLASVLMLSGIKLIDFPGADWVIAGGAVAAALGISAWALLTRTGRRPQAETVS*
Ga0066708_1065429713300005576SoilSVLMLSGIKLIDFPGADWVIAGGAIAAALGISAWALFDRLGRRPSPEVVS*
Ga0068854_10087031913300005578Corn RhizosphereSGIKLIDFAGSDYVIASGAVIAALGFAIWAFIARLGRRRPRPEPAPTSD*
Ga0068854_10199619113300005578Corn RhizosphereKLPDRALRLGLAAVLMLSGIKLVDPPNSDWVIAVGAVVAALAFATWAFTTRLGRRPRPEIAS*
Ga0068864_10162690323300005618Switchgrass RhizosphereVLISSQFTRVVPDRVLRLGLASVLVLSGIKLVDFAGADYVIASGAVIAAIGFAIWAFVARLGRRRPRPEPAPTSD*
Ga0068860_10092501423300005843Switchgrass RhizosphereVLRLGLASVLMLSGIKLIDFSGADYVIAGGAIVAALAFATWGLIARAGRRRSVESPA*
Ga0081539_1023389513300005985Tabebuia Heterophylla RhizosphereLSGIKLIDFAGADYVIAAGAMVAALALATWGLVARLGRRPRAERAPRSA*
Ga0068871_10059908323300006358Miscanthus RhizosphereVLRLGLASVLVLSGIKLIDFAGADYVVASGAVIAALGFAIWAFIARLGRRRPRPEPAPTSD*
Ga0075425_10007986843300006854Populus RhizosphereRLGLASVLVLSGIKLVDFAGADYVIASGAVIAAIGFAIWAFVARLGRRRPRPEPAPTSD*
Ga0075424_10116565313300006904Populus RhizosphereGLASVLVLSGIKLVDFAGADYVIAVGAVLAALGFAIWAFVARLGRRRPRAEPAPTSD*
Ga0079219_1007891733300006954Agricultural SoilPGILLTSQFALKIPERALRLALASVLMLSGIKLVDFPGADWVIAGGAIAAALGISAWAVLTRPARRPQAETVS*
Ga0079219_1064493513300006954Agricultural SoilGIKLIDFAGADYAIAAGAIAAGIGFATWGVVARLGRRPRPEAATSSD*
Ga0075435_10014726833300007076Populus RhizosphereGLASVLVLSGIKLVDFAGADYVIASGAVIAAIGFAIWAFVARLGRRRPRPEPAPTSD*
Ga0075418_1073336213300009100Populus RhizosphereALRLGLASVLMLSGIKLIDFAGADYVIAAGVVIAGLAFAGWGFVARLGRRPRPETATSSD
Ga0066709_10066505733300009137Grasslands SoilLLTGSIPGILLTSHFTLRLPDRTLRLGLASVLMLSGVKLIDFAGATYVIAVGAVVAALALAGWTLLGRRAARARDPRPEAVS*
Ga0105241_1081240713300009174Corn RhizosphereDFAGSDYVIASGAVIAALGFAIWAFIARLGRRRPRPEPAPTSD*
Ga0105238_1039206613300009551Corn RhizosphereTPRIPDRVLRLGLASVLMLSGVKLLDFSGADYVIAGGAIIAALAFATWGLIARAGRRRSVESPA*
Ga0126312_1107996523300010041Serpentine SoilGLAAVLMLSGIKLIDFPGTDWVIAAGAVAAGIAVAVWGLLQRLGRRPPAETAINKPF*
Ga0134067_1006442713300010321Grasslands SoilTGSIPGILLTSQFTLKLPDRTLRLGLASVLMLSGIKLIDFAGADWVIAGGAIVAALSLAGWTLLGRRAARQPRPEAGVS*
Ga0134067_1031447523300010321Grasslands SoilGILLTSNFTLRIPDRALRLGLASVLMLSGIKLIDFPHADWAIAAGAIAAGICFAVWGLVLHLARKPRAEAVS*
Ga0134065_1040240423300010326Grasslands SoilVPGILLTSQFTLKVPDRTLRLGLASVLMLSGVKLIDFAGADWVIAGGAVAAAIGLAAWSLVARIGRRRPLALDSQVREGS*
Ga0126378_1310428623300010361Tropical Forest SoilASVLMLSGIKLIDFAGADYVIAAGAAAATLGIGGWTLVGRLGRRPRPETVS*
Ga0134125_1159376313300010371Terrestrial SoilLLTSQFTLKVPDRVLRLGLASVLMLSGIKLIDFSGADWVIAGGAIAAGIGFTAWSLVARLGRRPRPEAAS*
Ga0134128_1204719633300010373Terrestrial SoilASVLMLSGIKLIDFAGADYVIAAAAIAAGVGFAAWGLVARLGRRPRPEVAPSSD*
Ga0134122_1022292033300010400Terrestrial SoilGVLISSQFTRVVPDRVLRLGLASVLVLSGIKLVDFAGADYVIASGAVIAAIGFAIWAFVARLGRRRPRPEPAPTSD*
Ga0137382_1023606023300012200Vadose Zone SoilLLSSQFTPRVPDKALRLGLASVLTLSGIKLLDFSGADYVIAGGAIIAAIAFATWGLVARAGRRRSVESPA*
Ga0137382_1028671523300012200Vadose Zone SoilGSIPGILLTSHFTLRLPDRTLRLGLASVLMLSGIKLIDFAGADYVIAVGAVVAALALAGWTLLGRRAARRLQPLAVDGQVGEGR*
Ga0137381_1103721613300012207Vadose Zone SoilPDRALRLGLASVLMLSGIKLIDFPGADWVIAGGAVAAALGISVWALMTRPARRPQAETAS
Ga0137376_1064223423300012208Vadose Zone SoilSIPGILLTSHFTLRLPDRTLRLGLASVLMLSGIKLIDFAGADYVIAVGAVVAALALAGWTLLGRRAARRLQPLAVDGQVGERG*
Ga0137370_1025232923300012285Vadose Zone SoilLASVLMLSGIKLIDFAGADYVIAAGAVVAALSLAGWTLVGRRAARQPRPEAGVS*
Ga0157350_102946823300012499Unplanted SoilMLSGLKLIDFAGVDYVIAAGAITAALAFAGWGLVARLGRRPRPEAATTSD*
Ga0157304_111606623300012882SoilVLMLSGIKLIDFAGADYVIAAGVLIAGLAFAGWGFVARLGRRPRPETATSSD*
Ga0157284_1029674123300012893SoilFTLKVPDRALRLGLASVLMLSGIKLIDFAGADYVIAAGVVIAGLAFAGWGFVARLGRRPRPETATSSD*
Ga0157303_1018198423300012896SoilGLASVLVLSGMKLIDFAGADYVIASGAVIAALGFAIWAFVARLGRRRPRPEPAPTSD*
Ga0157299_1015061313300012899SoilGILLTSQFTLKVPDRTLRLGLASVLMLSGLKLIDFSGADWVIAGGAIAAAIGLAAWSLVARLGRRPRPEAAS*
Ga0157291_1019842323300012902SoilLGLASVLMLSGIKLIDFAGADYVIAAGVVIAGLAFAGWGFVARLGRRPRPETATSSD*
Ga0157298_1020470113300012913SoilKLIDFAGADYVIAAGVVIAGLAFAGWGFVARLGRRPRPETATSSD*
Ga0157310_1009532723300012916SoilSVLMLSGIKLIDFAGADYVIAAGVVIAGLAFAGWGFVARLGRRPRPETAQSSD*
Ga0164303_1036113523300012957SoilQFTPRIPDRVLRLGLASVLMLSGIKLIDFSGADYVIAGGAIVAALGFATWGLIARAGRRRSAESPA*
Ga0126369_1367355123300012971Tropical Forest SoilGLASVLMLSGLKLIDFAGADYVIAAGVVIAALAFAGWGFVARLGRRPRPKTVTSSD*
Ga0164309_1017120913300012984SoilSQFTPRIPDRVLRLGLASVLMLSGIKLIDFSGADYVIAGGAIVAALAFATWGLIARAGRRRSVESPA*
Ga0164304_1073993813300012986SoilDKALRLGLASVLMLSGLKLIDFSGADYVIAGGAIIAALAFATWGLIARAGRRRSVESPA*
Ga0164305_1070818423300012989SoilRLGLASVLMLSGIKLIDFAGADYVIAAAAIAAGVGFAAWGLVARLGRRPRPEAAPSSD*
Ga0132256_10131808923300015372Arabidopsis RhizosphereLSGLKLIDFAGVDYVIAAGAITAALAFAGWALVARLGRRPRPEAATTSD*
Ga0132257_10072968413300015373Arabidopsis RhizosphereSVLMLSGVKLIDFAGVDYVIAAGAITAGLGFAAWGFVARLGRRPRPETAR*
Ga0187788_1023474023300018032Tropical PeatlandLMLSGIKLIDFAGATYVIGVGAVVAAIGFALWGLVARLGRRPRGEVAPRTGS
Ga0066669_1179748223300018482Grasslands SoilPGRLLTSQFTLKVPDRTLRLGLASVLMLSGVKLIDFAGADWVIAGGAVAAAIGLAAWSLVARIGRRRPLALDSHVREGS
Ga0173482_1014042513300019361SoilLKVPDRALRLGLASVLMLSGIKLIDFAGADYVIAAGVVIAGLAFAGWGFVARLGRRPRPETATSSD
Ga0222623_1040818923300022694Groundwater SedimentTSQFALKIPDRALRLGLASVLMLSGIKLIAFPGADWVIAGGAIVAALGISVWAFVTRTGRRPQPETAS
Ga0247785_101550423300022889SoilLMLSGIKLIDFAGADYVIAAGVLIAGLAFAGWGFVARLGRRPRPETATSSD
Ga0247787_106032513300022893SoilLRLGLASVLMLSGIKLIDFAGADYVIAAGVVIAGLAFAGWGFVARLGRRPRPETATSSD
Ga0247795_104902313300022899SoilFTLKVPDRALRLGLASVLMLSGIKLIDFAGADYVIAAGVVIAGLAFAGWGFVARLGRRPRPETATSSD
Ga0247669_107432523300024182SoilRALRLGLASVLMLSGIKLIDFAGADYVIAAAAIAAGVGFAAWGLVARLGRRPRPEAAPSS
Ga0247673_100800933300024224SoilRALRFGLASVLMLSGIKLIDFAGADYVIAAAAIAAGVGFAAWGLVARLGRRPRPEAAPSS
Ga0207653_1003352253300025885Corn, Switchgrass And Miscanthus RhizosphereVLRLGLASVLMLSGIKLIDFPGADWAIAGGAIAAALGISAWALMTRPARRPQAETAS
Ga0207710_1049105023300025900Switchgrass RhizospherePDRVLRLGLASVLMLSGIKLIDFSGADYVIAGGAVVAACAFAAWGLVARAGRRRRSVETP
Ga0207707_1147539213300025912Corn RhizosphereLISSHFTLKVPDRALRLGLASVLMLSGIKLIDFAGADYVIAAAAIAAGLGFAAWGLVARLGRRPRPEAAPSSD
Ga0207671_1072049913300025914Corn RhizospherePRIPDRVLRLGLASVLMLSGIKLIDFSGADYVIAGGAIVAALAFATWGLIARAGRRRSVESPA
Ga0207660_1013638833300025917Corn RhizosphereIPGVLISSQFTPRIPDRVLRLGLASVLMLSGIKLIDFSGADYVIAGGAIVAALAFATWGLIARAGRRRSVESPA
Ga0207687_1032539913300025927Miscanthus RhizosphereRVLRLGLASVLMLSGIKLIDFSGADYVIAGGAIVAALAFATWGLIARAGRRRSVESPA
Ga0207644_1156974423300025931Switchgrass RhizosphereVLISSQFTLKVPERALRLGLASVLMLSGIKLIDFAGADYVIAAAAIAAGVGFAAWGLVARLGRRPRPEAAPSSD
Ga0207686_1120326613300025934Miscanthus RhizosphereLVLSGIKLVDFAGADYVIASGAVIAAIGFAIWAFVARLGRRRPRPEPAPTSD
Ga0207670_1156326513300025936Switchgrass RhizosphereLRLGLASVLVLSGIKLVDFAGADYVIASGAVIAAIGFAIWAFVARLGRRRPRPEPAPTSD
Ga0207704_1053411223300025938Miscanthus RhizosphereRALRLGLAAVLMLSGIKLVDPPNSDWVIAVGAVVAALAFATWAFTTRLGRGPRPEIAS
Ga0207711_1075001313300025941Switchgrass RhizospherePDRVLRLGLASVLMLSGIKLIDFSGADYVIAGGAIVAALAFATWGLIARAGRRRSVESPA
Ga0207640_1058040213300025981Corn RhizosphereVLSGIKLIDFAGSDYVIASGAVIAALGFAIWAFIARLGRRRPRPEPAPTSD
Ga0207677_1172235213300026023Miscanthus RhizospherePGVLISSQFTPRIPDRVLRLGLASVLMLSGIKLIDFSGADYVIAGGAIVAALAFATWGLIARAGRRRSVESPA
Ga0209238_127912713300026301Grasslands SoilSQFTLKVPDRTLRLGLASVLMLSGVKLIDFAGADWVIAGGAVAAAIGLAAWSLVARIGRRRPLALDSQVREGS
Ga0209472_123510223300026323SoilVPGILLTSQFTLKVPDRTLRLGLASVLMLSGVKLIDFAGADWVIAGGAVAAAIGLAAWSLVARIGRRRPLALDSQVREGS
Ga0209984_107548213300027424Arabidopsis Thaliana RhizosphereLGLASVLMLSGIKLIDFAGADYVIAAGVVIAGLAFAGWGFVARLGRRPRPETATSSD
Ga0209998_1007780113300027717Arabidopsis Thaliana RhizosphereASVLMLSGIKLIDFAGADYVIAAGVVIAGLAFAGWGFVARLGRRPRPETATSSD
Ga0209177_1006963423300027775Agricultural SoilLLTGSVPGILLSSQFALKIPERALRLALASVLMLSGIKLIDFAGADYVIAAAAIAAGVGFAAWGLVARLGRRPRPEAAPSSD
Ga0268264_1253562023300028381Switchgrass RhizosphereALRLGLAAVLMLSGIKLVDPPNSDWVIAVGAVVAALAFATWAFTTRLGRRPRPEIAS
Ga0307311_1011767813300028716SoilGLASVLMLSGIKLIDFPGADWVIAGGALAAGLGISAWALFGRLGRRPRPEVVS
Ga0307307_1003579313300028718SoilPDRALRLGLASVLMLSGIKLIAFPGADWVIAGGAIVAALGISVWAFVTRTGRRPQPETAS
Ga0307301_1012913423300028719SoilLMLSGVKLIDFPGADYAIAAGAIAAGLCFAVWGLVSRSGRRPRPETAA
Ga0307280_1025814823300028768SoilLASVLMLSGIKLIDFPGADWVIAGGALAAGLGISAWALFGRLGRRPRPEVVS
Ga0307320_1013331113300028771SoilTSQFTLKLPDRALRLGLAAVLMLSGIKLVDPPNSDWVIAVGAVVAGLAFATWAFSTRLGRRPRPEIAS
Ga0307323_1017969813300028787SoilLSGIKLIDFPGADWVIAGGALAAGLGISAWALFGRLGRRPRPEVVS
Ga0247825_1072984923300028812SoilSSQFTPHVPDKVLRLGLASVLTLSGIKLLDFSGADYVIAGGAIIAALAFATWGLIARAGRRRSVESPA
Ga0307296_1013597933300028819SoilTLKVPDRALRLGLATVLMLSGIKLIDFPGADWIIAAGAIAAGFAFALWGLSQRLGRRPPAETATKLY
Ga0307310_1004093813300028824SoilTLRLGLASVLMLSGIKLIDFAGATYVIAVGAVVAVLALTGWTLLGRLAARRPKPLAVDGQVGKGS
Ga0307310_1040018723300028824SoilTLKVPERALRLGLATVLMLSGIKLVDPPGVDWVIAAGIITAGIAFAVWGFLHRLGRRPPAETATKPF
Ga0307286_1011937813300028876SoilAPDRALRLGLATVLMLSGIKLIDFPGADWIIAAGAIAAGFAFALWGLSQRLGRRPPAETATKLY
Ga0307278_1042364623300028878SoilLKLPDRALRLGLAAVLMLSGIKLVDPPNADWVIAVGAVVVGLAFATWAFTTRLGRRPRPEIAS
Ga0307278_1048684623300028878SoilLTLRIPDRALRLGLASVLMLSGIKLIDFPGADWVIAGGALAAGLGISAWALFGRLGRRPRPEVVS
Ga0307277_1054113813300028881SoilRLALASVLMLSGIKLIDFPGADWVIAAGAIAAGLAIGTWAFATRTARRPEAETVS
Ga0310892_1031592713300031858SoilTQRVPDRALRLGLASVLMLSGIKLIDFAGADYVIAAAAIAAGVGFAAWGLVARLGRRPRPEAAPSSD
Ga0307416_10342923513300032002RhizosphereLAAVLMLSGIKLIDFAGADYVIAAGAIAAGLGFAIWGFVARLGRRPRPETVT
Ga0310897_1023371713300032003SoilIKLIDFAGADYVIAAAAIAAGVGFAAWGLVARLGRRPRPEAAPSSD
Ga0307472_10025992613300032205Hardwood Forest SoilLLTSKLTLRIPDRALRLGLASVLMLSGIKLIDFSGADWVIAGGAVAAGLGISGWALVARLGRRPRPETAS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.