| Basic Information | |
|---|---|
| Family ID | F084275 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 112 |
| Average Sequence Length | 43 residues |
| Representative Sequence | VSQLDKELRERIDEPASEEAEREARLTPAEAVAQMRIKVPAQR |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 45.54 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 91.07 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (77.679 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (20.536 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.893 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.536 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.58% β-sheet: 0.00% Coil/Unstructured: 70.42% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF01638 | HxlR | 36.61 |
| PF00005 | ABC_tran | 10.71 |
| PF06271 | RDD | 4.46 |
| PF00664 | ABC_membrane | 3.57 |
| PF07687 | M20_dimer | 3.57 |
| PF10110 | GPDPase_memb | 2.68 |
| PF01546 | Peptidase_M20 | 2.68 |
| PF04775 | Bile_Hydr_Trans | 2.68 |
| PF04055 | Radical_SAM | 1.79 |
| PF12911 | OppC_N | 0.89 |
| PF04545 | Sigma70_r4 | 0.89 |
| PF14333 | DUF4389 | 0.89 |
| PF00916 | Sulfate_transp | 0.89 |
| PF13365 | Trypsin_2 | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 36.61 |
| COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 4.46 |
| COG0659 | Sulfate permease or related transporter, MFS superfamily | Inorganic ion transport and metabolism [P] | 0.89 |
| COG2233 | Xanthine/uracil permease | Nucleotide transport and metabolism [F] | 0.89 |
| COG2252 | Xanthine/guanine/uracil/vitamin C permease GhxP/GhxQ, nucleobase:cation symporter 2 ( NCS2) family | Nucleotide transport and metabolism [F] | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 77.68 % |
| Unclassified | root | N/A | 22.32 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_112365474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 1025 | Open in IMG/M |
| 3300002568|C688J35102_119225295 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300004157|Ga0062590_101325386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 711 | Open in IMG/M |
| 3300005093|Ga0062594_101230154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 745 | Open in IMG/M |
| 3300005172|Ga0066683_10646142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 635 | Open in IMG/M |
| 3300005175|Ga0066673_10763393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 554 | Open in IMG/M |
| 3300005338|Ga0068868_100909219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 800 | Open in IMG/M |
| 3300005437|Ga0070710_11430629 | Not Available | 518 | Open in IMG/M |
| 3300005447|Ga0066689_10721075 | Not Available | 623 | Open in IMG/M |
| 3300005455|Ga0070663_101882182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 537 | Open in IMG/M |
| 3300005457|Ga0070662_101795969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 530 | Open in IMG/M |
| 3300005530|Ga0070679_100276948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1631 | Open in IMG/M |
| 3300005546|Ga0070696_100735384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 807 | Open in IMG/M |
| 3300005546|Ga0070696_100861639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 749 | Open in IMG/M |
| 3300005561|Ga0066699_10778228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 676 | Open in IMG/M |
| 3300005566|Ga0066693_10067718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1231 | Open in IMG/M |
| 3300005576|Ga0066708_10077705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. | 1926 | Open in IMG/M |
| 3300005618|Ga0068864_100316399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1465 | Open in IMG/M |
| 3300005764|Ga0066903_100288342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2582 | Open in IMG/M |
| 3300005843|Ga0068860_102048216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 594 | Open in IMG/M |
| 3300005844|Ga0068862_101909718 | Not Available | 604 | Open in IMG/M |
| 3300005937|Ga0081455_10250037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1297 | Open in IMG/M |
| 3300005985|Ga0081539_10469713 | Not Available | 521 | Open in IMG/M |
| 3300006058|Ga0075432_10064021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1313 | Open in IMG/M |
| 3300006358|Ga0068871_102378262 | Not Available | 505 | Open in IMG/M |
| 3300006573|Ga0074055_11797813 | Not Available | 612 | Open in IMG/M |
| 3300006791|Ga0066653_10495585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 619 | Open in IMG/M |
| 3300006903|Ga0075426_10521180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 884 | Open in IMG/M |
| 3300006903|Ga0075426_10868455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 680 | Open in IMG/M |
| 3300009137|Ga0066709_101809862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 856 | Open in IMG/M |
| 3300009662|Ga0105856_1359647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 501 | Open in IMG/M |
| 3300009789|Ga0126307_10150403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1863 | Open in IMG/M |
| 3300009792|Ga0126374_11735145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 520 | Open in IMG/M |
| 3300010038|Ga0126315_10260511 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300010045|Ga0126311_10002831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 8806 | Open in IMG/M |
| 3300010045|Ga0126311_10454476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 995 | Open in IMG/M |
| 3300010325|Ga0134064_10198281 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300010360|Ga0126372_11748236 | Not Available | 664 | Open in IMG/M |
| 3300010366|Ga0126379_10107115 | All Organisms → cellular organisms → Bacteria | 2503 | Open in IMG/M |
| 3300011119|Ga0105246_11883441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 574 | Open in IMG/M |
| 3300012208|Ga0137376_11170449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 657 | Open in IMG/M |
| 3300012358|Ga0137368_10373936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 942 | Open in IMG/M |
| 3300012359|Ga0137385_11465258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Nitriliruptoria → Nitriliruptorales → unclassified Nitriliruptorales → Nitriliruptorales bacterium | 546 | Open in IMG/M |
| 3300012476|Ga0157344_1006050 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300012489|Ga0157349_1029891 | Not Available | 563 | Open in IMG/M |
| 3300012507|Ga0157342_1006720 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300012532|Ga0137373_10769399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 713 | Open in IMG/M |
| 3300012899|Ga0157299_10027743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 1129 | Open in IMG/M |
| 3300012915|Ga0157302_10081130 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300012960|Ga0164301_10435559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 928 | Open in IMG/M |
| 3300013768|Ga0120155_1061813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1090 | Open in IMG/M |
| 3300014157|Ga0134078_10281174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 709 | Open in IMG/M |
| 3300014968|Ga0157379_10044596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3958 | Open in IMG/M |
| 3300015372|Ga0132256_101104303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 907 | Open in IMG/M |
| 3300015372|Ga0132256_101732495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 734 | Open in IMG/M |
| 3300017659|Ga0134083_10386150 | Not Available | 608 | Open in IMG/M |
| 3300017965|Ga0190266_10004922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2984 | Open in IMG/M |
| 3300017997|Ga0184610_1056332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1173 | Open in IMG/M |
| 3300018000|Ga0184604_10320857 | Not Available | 549 | Open in IMG/M |
| 3300018029|Ga0187787_10178483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 737 | Open in IMG/M |
| 3300018072|Ga0184635_10315547 | Not Available | 608 | Open in IMG/M |
| 3300018433|Ga0066667_10068810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2228 | Open in IMG/M |
| 3300018433|Ga0066667_10795930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 803 | Open in IMG/M |
| 3300019869|Ga0193705_1077906 | Not Available | 643 | Open in IMG/M |
| 3300019873|Ga0193700_1022015 | Not Available | 1052 | Open in IMG/M |
| 3300021073|Ga0210378_10149094 | Not Available | 903 | Open in IMG/M |
| 3300021418|Ga0193695_1063700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 801 | Open in IMG/M |
| 3300022694|Ga0222623_10047745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1646 | Open in IMG/M |
| 3300024177|Ga0247686_1009207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1042 | Open in IMG/M |
| 3300024325|Ga0247678_1049888 | Not Available | 676 | Open in IMG/M |
| 3300025916|Ga0207663_11590984 | Not Available | 526 | Open in IMG/M |
| 3300025921|Ga0207652_10306811 | Not Available | 1433 | Open in IMG/M |
| 3300025921|Ga0207652_11705213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 535 | Open in IMG/M |
| 3300025929|Ga0207664_11635786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 566 | Open in IMG/M |
| 3300025972|Ga0207668_10498748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1047 | Open in IMG/M |
| 3300026023|Ga0207677_10400418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 1164 | Open in IMG/M |
| 3300026035|Ga0207703_11508685 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 647 | Open in IMG/M |
| 3300026078|Ga0207702_10967462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 844 | Open in IMG/M |
| 3300026089|Ga0207648_10856326 | Not Available | 848 | Open in IMG/M |
| 3300026315|Ga0209686_1158373 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300026542|Ga0209805_1241611 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300027056|Ga0209879_1002820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2505 | Open in IMG/M |
| 3300028381|Ga0268264_10809524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 936 | Open in IMG/M |
| 3300028589|Ga0247818_11227130 | Not Available | 536 | Open in IMG/M |
| 3300028707|Ga0307291_1010459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2015 | Open in IMG/M |
| 3300028707|Ga0307291_1082009 | Not Available | 795 | Open in IMG/M |
| 3300028707|Ga0307291_1100660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 720 | Open in IMG/M |
| 3300028708|Ga0307295_10028390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1395 | Open in IMG/M |
| 3300028711|Ga0307293_10157970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 721 | Open in IMG/M |
| 3300028719|Ga0307301_10036058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 1497 | Open in IMG/M |
| 3300028719|Ga0307301_10097524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 930 | Open in IMG/M |
| 3300028778|Ga0307288_10135283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 919 | Open in IMG/M |
| 3300028796|Ga0307287_10033455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1843 | Open in IMG/M |
| 3300028819|Ga0307296_10335722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 825 | Open in IMG/M |
| 3300028819|Ga0307296_10463212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 693 | Open in IMG/M |
| 3300028824|Ga0307310_10334249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 742 | Open in IMG/M |
| 3300028881|Ga0307277_10164110 | Not Available | 966 | Open in IMG/M |
| 3300028884|Ga0307308_10519159 | Not Available | 571 | Open in IMG/M |
| 3300030336|Ga0247826_11421171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 561 | Open in IMG/M |
| 3300031421|Ga0308194_10099172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 835 | Open in IMG/M |
| 3300031525|Ga0302326_11190267 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → unclassified Planctomycetia → Planctomycetia bacterium 21-64-5 | 1050 | Open in IMG/M |
| 3300031720|Ga0307469_12487204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 506 | Open in IMG/M |
| 3300031731|Ga0307405_11768692 | Not Available | 549 | Open in IMG/M |
| 3300031938|Ga0308175_100102670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2637 | Open in IMG/M |
| 3300031938|Ga0308175_100185248 | All Organisms → cellular organisms → Bacteria | 2035 | Open in IMG/M |
| 3300031938|Ga0308175_102604788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 566 | Open in IMG/M |
| 3300031962|Ga0307479_10290025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1618 | Open in IMG/M |
| 3300032205|Ga0307472_101247088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 713 | Open in IMG/M |
| 3300032828|Ga0335080_11996150 | Not Available | 562 | Open in IMG/M |
| 3300033158|Ga0335077_11313639 | Not Available | 702 | Open in IMG/M |
| 3300033475|Ga0310811_10639318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1053 | Open in IMG/M |
| 3300034678|Ga0314803_084931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 600 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 20.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.36% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.46% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.57% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.57% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.57% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.68% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.68% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.68% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.68% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.68% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.79% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.79% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.79% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.79% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.79% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.79% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.89% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.89% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.89% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.89% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.89% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.89% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.89% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009662 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060 | Environmental | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012489 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.5.yng.040610 | Environmental | Open in IMG/M |
| 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300013768 | Permafrost microbial communities from Nunavut, Canada - A35_65cm_0M | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019869 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2 | Environmental | Open in IMG/M |
| 3300019873 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s1 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021418 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300024177 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK27 | Environmental | Open in IMG/M |
| 3300024325 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19 | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300027056 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300034678 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1123654743 | 3300000956 | Soil | VSELDSETQERIEDPVSEQAEEETRLTPAEAVAQMRIKVP |
| C688J35102_1192252953 | 3300002568 | Soil | VSELDKELQERIDEPASEEAEREARLAPADAVAQMRIKVPAQRSRKL |
| Ga0062590_1013253863 | 3300004157 | Soil | VSQLDKELRERIDEPASEEAEREARLSPAEAVAQMRIKVPAQRSRK |
| Ga0062594_1012301542 | 3300005093 | Soil | VAPLDKELRERIDEPASEEAEREARLSPQDAVAKMRIKVP |
| Ga0066683_106461421 | 3300005172 | Soil | VSELDKELQERIDEPASPEAERDARLSPREATAQMRINVPAQRNAKL |
| Ga0066673_107633931 | 3300005175 | Soil | VSEIDNELRERIDEPASKEAEREAQLSPAEAVAQMRINVP |
| Ga0068868_1009092191 | 3300005338 | Miscanthus Rhizosphere | VSELDKETQERIEDPVSEQAEEETRLTPAEAVAQMRIKVPTR |
| Ga0070710_114306291 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VSQLDKELRERIDEPASEEAEREARLSAAEAVAQMRIKVPAQRSKKLR |
| Ga0066689_107210751 | 3300005447 | Soil | VSQIDKELRERIDEPASEEAEREARLTPAEATAQMRINVPAQRSRKLR |
| Ga0070663_1018821821 | 3300005455 | Corn Rhizosphere | MSDDESELDPETRGRIDGPISAEAERETRLTPAEAVKQMRIRVP |
| Ga0070662_1017959692 | 3300005457 | Corn Rhizosphere | VSELDKETQERIEDPVSEQAEEETHLTPAEAVAQMRIKVPTRANRKLATLV |
| Ga0070679_1002769481 | 3300005530 | Corn Rhizosphere | VSQLDKELRERIDEPVSPEAEREARLSPEEAVAQMRIKVPAQRSRKLR |
| Ga0070696_1007353841 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VAPLDKELRERIDEPASEEAEREARLSPQDAVAKMRIKVPAQ |
| Ga0070696_1008616391 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VSRLDKELRERIDEPASQEAEREARLTPAEATAQMRIKVPAQRNAKLRT |
| Ga0066699_107782283 | 3300005561 | Soil | VSQLDKELRARIEEPASEEAEREARLSPTEATAQMRINVPAQRNRKL |
| Ga0066693_100677181 | 3300005566 | Soil | VSQLDKSQLDKELRDRIDEPASEEAEREARLTPAEAVAQMRINVP |
| Ga0066708_100777051 | 3300005576 | Soil | VSEIDKELRERIDEPASKEAEREAQLSPAEAVAQMRINV |
| Ga0068864_1003163993 | 3300005618 | Switchgrass Rhizosphere | VSQLDKELRERIDEPASDEAEREARLSPAEAVAQMRIKVPAQRNRK |
| Ga0066903_1002883421 | 3300005764 | Tropical Forest Soil | VSQLDKELRERIEEPASGEAEREARLTPKEAVAKMRIKVP |
| Ga0068860_1020482163 | 3300005843 | Switchgrass Rhizosphere | VSQLDKELRERIDEPASDEAEREARLSPAEAVAQM |
| Ga0068862_1019097181 | 3300005844 | Switchgrass Rhizosphere | VSQLDKELRERIEEPASGEAEREARLTPRDAVAQMRIK |
| Ga0081455_102500372 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MSEVDPEAEARIEDPVSKEAEREVLLTPQEAVSRMRIKVPPRANRKLRELLERVN |
| Ga0081539_104697131 | 3300005985 | Tabebuia Heterophylla Rhizosphere | VSQVDKELRERIDEPASREAEREARLSPADATAQMRINVPAQRSRK |
| Ga0075432_100640213 | 3300006058 | Populus Rhizosphere | VSELDKETRERIEDPVSEQAEEETRLTPAEAVAQM |
| Ga0068871_1023782622 | 3300006358 | Miscanthus Rhizosphere | VSDPDPESGLDSRTQERIDEPVSAEAARETRLTPKEAVAQMRIRVP |
| Ga0074055_117978131 | 3300006573 | Soil | VSQLDKELQERIDEPASAQAVKETRLTPAEATAQMRINV |
| Ga0066653_104955851 | 3300006791 | Soil | VSEIDKELRQRIDEPASEEAEREAQLSPAEAIAQMRINVPAQRSRKLR |
| Ga0075426_105211802 | 3300006903 | Populus Rhizosphere | VAPLDKELRERIDEPASEEAEREARLSPQDAVAKMRI |
| Ga0075426_108684551 | 3300006903 | Populus Rhizosphere | VSELDPKTQERIDEPVSAEAERETRLTPSEAVKQMRIRVP |
| Ga0066709_1018098621 | 3300009137 | Grasslands Soil | VSELDPKTQERIDEPVSAEAERETRLTPEQAVKQMRIRVPD |
| Ga0105856_13596472 | 3300009662 | Permafrost Soil | VTLDKKTQQRIDNPVPDEAQREARLTPTAAVAQMRIRLPE |
| Ga0126307_101504031 | 3300009789 | Serpentine Soil | MALDKETEARIEQPVSDEAERETRLTPAQAVGAMRINVPPRANRKLR |
| Ga0126374_117351451 | 3300009792 | Tropical Forest Soil | MSELGKELRERIDEPVSREAEREAQLSPDEAVAQMRIKVPA |
| Ga0126315_102605113 | 3300010038 | Serpentine Soil | VSQLDKELRERIDEPASGEAEREARLAPADATAQMRIKVPAQRNRKLR |
| Ga0126311_1000283111 | 3300010045 | Serpentine Soil | VSQLDKELRERIDEPASEEAEREARLAPGDAVAQMRIKVPAQRSRKLRTLLERVNGDDGL |
| Ga0126311_104544763 | 3300010045 | Serpentine Soil | MSELDKETQERIEDPVSEQAEEETHLTPAEAVAQMRIKVP |
| Ga0134064_101982811 | 3300010325 | Grasslands Soil | VSQLDKGLRERIDEPASEEAEREALLSPAEATAQMRINVPAQRSRKLRAIRERVNA |
| Ga0126372_117482363 | 3300010360 | Tropical Forest Soil | VARLDKELRERIDEPVSEEAERDALLTPAEATAQMRINVPAQ |
| Ga0126379_101071154 | 3300010366 | Tropical Forest Soil | VSQLDPELRERIDEPVSREAEREAQLSPDDAVAQMRIKVPAERSRKLRTIVERV |
| Ga0105246_118834411 | 3300011119 | Miscanthus Rhizosphere | VSELDKETQERIEDPVSEQAEEETRLTPAEAVAQMRIK |
| Ga0137376_111704493 | 3300012208 | Vadose Zone Soil | VSELDKELQERIDEPASPEAEREARLSPREATAQMRINVPAQRN |
| Ga0137368_103739363 | 3300012358 | Vadose Zone Soil | MAELDKETQERIDEPVSEQAEEETRLTPAEAVAQMRIRVPPR |
| Ga0137385_114652581 | 3300012359 | Vadose Zone Soil | MTDDQTELDEETRELITGPVSAEAERETRLTPTEAVAQMRIRVPV |
| Ga0157344_10060501 | 3300012476 | Arabidopsis Rhizosphere | VARLDKELRERIDDPVSAEAERETLLTPAEATAQMRIKVPAQRNA |
| Ga0157349_10298912 | 3300012489 | Unplanted Soil | VARLDKELRERIDDPVSAEAERETLLTPAEATAQMRIKVPAQRNAKLRTVL |
| Ga0157342_10067201 | 3300012507 | Arabidopsis Rhizosphere | VARLDKELRERIDDPVSAEAERETLLTPAEATAQMRIKVPAQRNAKLRTVLER |
| Ga0137373_107693992 | 3300012532 | Vadose Zone Soil | MALDPETRERIESPTSAEAEREARLTPAQAVSQMRIRVPERAN |
| Ga0157299_100277433 | 3300012899 | Soil | VSELDKETRDRIEDPVSEQAEEETRLTPAEAVAQMRIKVPTRG |
| Ga0157302_100811303 | 3300012915 | Soil | VSELDKETQERIEDPVSEQAEEETHLTPAEAVAQMRIKVPPRANR |
| Ga0164301_104355593 | 3300012960 | Soil | MSLDPETEKRIEQPASDEAERETRLTPAEAVKQMRIRVPVRAN |
| Ga0120155_10618133 | 3300013768 | Permafrost | VSQLDKELRERIDEPVSEEAERETRLTPADATAQMRI |
| Ga0134078_102811743 | 3300014157 | Grasslands Soil | VSQLDKGLRERIDEPASEEAEREALLSPAEATAQMRINVPAQRSRKL |
| Ga0157379_100445964 | 3300014968 | Switchgrass Rhizosphere | VSELDKETQERIDDPVSEQAEEETRLTPAEAVAQMRIKVP |
| Ga0132256_1011043032 | 3300015372 | Arabidopsis Rhizosphere | VSQLDKELRERIDEPVSPEAEREARLSPEEAVAQMRIKV |
| Ga0132256_1017324952 | 3300015372 | Arabidopsis Rhizosphere | MALDPETQEIIDDPVPAEAERETRLRPKEAVALMRIRVPERG |
| Ga0134083_103861502 | 3300017659 | Grasslands Soil | VSQLDKELRERIDEPASPEAEREARLSPREAAAQMRINVPAQRNAK |
| Ga0190266_100049224 | 3300017965 | Soil | VSDLDKETQERIQDPVSEQAEEETHLTPAEAVAQMRIKVPPRAN |
| Ga0184610_10563323 | 3300017997 | Groundwater Sediment | MAELDKETQERIDEPVSEQAEEETRLTPAEAVAQMRIRVPPRANRKLA |
| Ga0184604_103208571 | 3300018000 | Groundwater Sediment | VSQLDKELQERIDEPASEEAERETRLTPGEATAQM |
| Ga0187787_101784832 | 3300018029 | Tropical Peatland | MSELDPETRERITEPISAEAARETRLTPSQAVAQMRIRVPERG |
| Ga0184635_103155471 | 3300018072 | Groundwater Sediment | VSQLDKELRERIEEPASDEAEREARLTPRDAVAQMRIKVPA |
| Ga0066667_100688101 | 3300018433 | Grasslands Soil | VSEIDKELRERIDEPASKEAEREAQLSPVEAVAQMRINVPAQRSRKLR |
| Ga0066667_107959301 | 3300018433 | Grasslands Soil | VSQLDKSQLDKELRERIDEPVSEEAEREARLTPAEATAQM |
| Ga0193705_10779063 | 3300019869 | Soil | VSQLDKELQERIDEPASEEAERETRLTPAEATAQMRIKVPAQRNA |
| Ga0193700_10220151 | 3300019873 | Soil | VSQLDKELQERIDEPASEEAERETRLTPAEATAQMRIKVPAQR |
| Ga0210378_101490943 | 3300021073 | Groundwater Sediment | VSQLDKELQERIDEPASEEAERETRLTPAEATAQMRIKVPAQRNAKL |
| Ga0193695_10637001 | 3300021418 | Soil | VSELDPKTQERIDEPVSAEAERETRLTPAQAVKQMRIRVPDRGHQK |
| Ga0222623_100477451 | 3300022694 | Groundwater Sediment | MAELDKETQERIDEPVSEQAEEETRLTPAEAVAQMRIRVPPRANRKL |
| Ga0247686_10092071 | 3300024177 | Soil | VSQLDKELRERIDEPVSPEAEREARLSPEEAVAQMRIKVPAQRS |
| Ga0247678_10498883 | 3300024325 | Soil | VSQLDREIRERIDEPASKEAEREARLSPADAVAQMRIKVPAQRS |
| Ga0207663_115909842 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MLDPETEKRIDQPVSAEAEREVRLTPAEAVAQMRIRVPVRA |
| Ga0207652_103068112 | 3300025921 | Corn Rhizosphere | MSEIDPELRERIDEPASEEAERDARLTPAEAVGQMRINVPAQ |
| Ga0207652_117052131 | 3300025921 | Corn Rhizosphere | VSRLDKELRERIDEPASQEAEREARLTPAEATAQM |
| Ga0207664_116357862 | 3300025929 | Agricultural Soil | MGLDPQTEKRIEQPASDEAERETRLTPAEAVQQMRIRVPVRA |
| Ga0207668_104987481 | 3300025972 | Switchgrass Rhizosphere | VSELDKETQERIEDPVSEQAEEETHLTPAEAVAQMRIKVP |
| Ga0207677_104004183 | 3300026023 | Miscanthus Rhizosphere | VSELDKETQERIEDPVSEQAEEETRLTPAEAVAQMRIKV |
| Ga0207703_115086851 | 3300026035 | Switchgrass Rhizosphere | VALDEETQQLDAETQQGIDEPVPEEAKRETRLTPAEAVAQMRIRV |
| Ga0207702_109674622 | 3300026078 | Corn Rhizosphere | MTEIDPASEIDQELRERIDEPASEEAERDARLTPAEAVGQMRINVPA |
| Ga0207648_108563261 | 3300026089 | Miscanthus Rhizosphere | VSELDKETQERIEDPVSEQAEEETRLTPAEAVAQMRIKVPTRAN |
| Ga0209686_11583733 | 3300026315 | Soil | VSQLDKELRERIEEPASEEAEREARLSPTEATAQMR |
| Ga0209805_12416113 | 3300026542 | Soil | VSQLDKELRARIEEPASEEAEREARLSPTEATAQMRINVPAQRNRK |
| Ga0209879_10028201 | 3300027056 | Groundwater Sand | MAELDKETQERIDEPVSEQAEEETRLTPAEAVAQMRIRVP |
| Ga0268264_108095243 | 3300028381 | Switchgrass Rhizosphere | VSQLDKELRERIDEPASDEAEREARLSPAEAVAQMR |
| Ga0247818_112271302 | 3300028589 | Soil | VALDEETQQLDAETQQRIDEPVPEEAKRETRLTPAEAVAQM |
| Ga0307291_10104591 | 3300028707 | Soil | VSELDKETRDRIEDPVSEQAEEETRLTPAEAVAQMRIKV |
| Ga0307291_10820091 | 3300028707 | Soil | VSQLDKELQERIDEPVAEEAERETRLTPAEATSQMRI |
| Ga0307291_11006601 | 3300028707 | Soil | VSQLDKELRERIDEPASEEAEREARLAPADATAQMRI |
| Ga0307295_100283901 | 3300028708 | Soil | VSQLDKELQERIDEPASEEAERETRLTPAEATAQMRIK |
| Ga0307293_101579703 | 3300028711 | Soil | VSGAVSQLDKELRERIDEPASEEAEREARLSPADATAQMRIKVPAQRNRKL |
| Ga0307301_100360581 | 3300028719 | Soil | VSELDKETQERIQDPVSEQAEEETRLTPAEAVAQMRIKVPTRANRKL |
| Ga0307301_100975241 | 3300028719 | Soil | MAELDKETQERIDEPVSEQAEEETRLTPAEAVAQMRIRVPPRANRKLAA |
| Ga0307288_101352832 | 3300028778 | Soil | VSELDKETRDRIEDPVSEQAEEETRLTPAEAVAQMRIKVPTRANRKLAM |
| Ga0307287_100334551 | 3300028796 | Soil | VSRLDKELRERIDEPASQEAEREARLTPVEATAQMR |
| Ga0307296_103357221 | 3300028819 | Soil | MAELDKETQERIDEPVSEQAEEETRLTPAQAVAQMRIRVPPRANRKL |
| Ga0307296_104632122 | 3300028819 | Soil | VSRLDKELRERIDEPASQEAEREARLTPVEATAQMRIKVPAQR |
| Ga0307310_103342491 | 3300028824 | Soil | VSQLDKELRERIDEPASEEAEREARLTPAEAVAQMRIKVPAQR |
| Ga0307277_101641101 | 3300028881 | Soil | VSAAVSQLDKELRERIDEPASKEAEREARLAPAEATAQMRIKLPAQRNAKLRNVVER |
| Ga0307308_105191591 | 3300028884 | Soil | VSGAVSQLDKELRERIDEPASEEAERDARLSPADATAQMRIRVPAQRNRK |
| Ga0247826_114211711 | 3300030336 | Soil | VARLDKELRERIDEPASQEAEREARLTPAEATAQMRIKVPAQRN |
| Ga0308194_100991721 | 3300031421 | Soil | MAELDKETQERIDEPVSEQAEEEARLTPAEAVAQMRI |
| Ga0302326_111902672 | 3300031525 | Palsa | VELDKETQDRIDSPTSEEAKREARLTPAEAVGQIRIRLPER |
| Ga0307469_124872041 | 3300031720 | Hardwood Forest Soil | VSELDKETQERIEDPVSEQAEEETHLTPAEAVAQM |
| Ga0307405_117686921 | 3300031731 | Rhizosphere | VFVSELDKETQERIEDPVSEQAEEETRLTPAEAVAQMRIKVPT |
| Ga0308175_1001026704 | 3300031938 | Soil | MSDDETQLDPETRERIAAPASAEAERETRLTPAEAVKQMRIRVPV |
| Ga0308175_1001852481 | 3300031938 | Soil | VARLDKELRERIDEPASQEAEREVRLTPAEATAQMRI |
| Ga0308175_1026047881 | 3300031938 | Soil | VSPLDKELRERIDEPASEEAEREARLSPGEAVAKMR |
| Ga0307479_102900251 | 3300031962 | Hardwood Forest Soil | VSELDSKTQGRIDDPVSAEAERETRLAPAEAIKQMRIRV |
| Ga0307472_1012470882 | 3300032205 | Hardwood Forest Soil | VSELDKETQERIEDPVSEQAEEETHLTPAEAVAQMRIKVPTRANRKLA |
| Ga0335080_119961501 | 3300032828 | Soil | VTELDRELQERIDEPASAEAVQETRLTPAEATAQMRINVPAQRNR |
| Ga0335077_113136393 | 3300033158 | Soil | VTELDRELQERIDEPASAEAVQETRLTPAEATAQMRINVPAQRN |
| Ga0310811_106393183 | 3300033475 | Soil | VSQLDKELRERIEEPASGEAEREARLTPRDAVAQM |
| Ga0314803_084931_462_599 | 3300034678 | Soil | MSELDRETQERIEDPVSEQAEEETRLTPAEAVTQMRIKVPTRANRK |
| ⦗Top⦘ |