| Basic Information | |
|---|---|
| Family ID | F084220 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 112 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MDYLSRELEDYQYYVDTTCEKCGESTDPDYYDCRCSDEEE |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 12.50 % |
| % of genes near scaffold ends (potentially truncated) | 21.43 % |
| % of genes from short scaffolds (< 2000 bps) | 66.07 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (71.429 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (19.643 % of family members) |
| Environment Ontology (ENVO) | Unclassified (75.893 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (83.929 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.00% β-sheet: 5.00% Coil/Unstructured: 80.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF04466 | Terminase_3 | 9.82 |
| PF09250 | Prim-Pol | 7.14 |
| PF11645 | PDDEXK_5 | 6.25 |
| PF13481 | AAA_25 | 5.36 |
| PF12684 | DUF3799 | 3.57 |
| PF08291 | Peptidase_M15_3 | 2.68 |
| PF04860 | Phage_portal | 2.68 |
| PF02195 | ParBc | 1.79 |
| PF00145 | DNA_methylase | 0.89 |
| PF01555 | N6_N4_Mtase | 0.89 |
| PF01844 | HNH | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG1783 | Phage terminase large subunit | Mobilome: prophages, transposons [X] | 9.82 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.89 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.89 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.89 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 71.43 % |
| All Organisms | root | All Organisms | 28.57 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 19.64% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 10.71% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 7.14% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 6.25% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 5.36% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 5.36% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 5.36% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 4.46% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 3.57% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 3.57% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 3.57% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.68% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.68% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 2.68% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.79% |
| Estuary Water | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuary Water | 1.79% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.79% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 1.79% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.89% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.89% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.89% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.89% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.89% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.89% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine | 0.89% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.89% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.89% |
| Enviromental | Environmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental | 0.89% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573027 | Estuarine microbial communities from Columbia River, sample from CR-7km from mouth, GS312-FOS-0p8-CR7-chlmax | Environmental | Open in IMG/M |
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000418 | Marine microbial community from Union City, CA, USA - Pond 2C Liquid 1 | Environmental | Open in IMG/M |
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300001348 | Pelagic Microbial community sample from North Sea - COGITO 998_met_04 | Environmental | Open in IMG/M |
| 3300001352 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 | Environmental | Open in IMG/M |
| 3300002930 | Estuary water microbial communities from Pearl Estuary, Zhujiang, China | Environmental | Open in IMG/M |
| 3300003427 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300005732 | Seawater microbial communities from Vineyard Sound, MA, USA - Succinate ammended T7 | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
| 3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
| 3300007778 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG | Environmental | Open in IMG/M |
| 3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
| 3300009074 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
| 3300009467 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 | Environmental | Open in IMG/M |
| 3300009472 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300011253 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeate | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300018682 | Metatranscriptome of marine microbial communities from Baltic Sea - GS680_0p1 | Environmental | Open in IMG/M |
| 3300019938 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW8Nov16_MG | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020166 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1 | Environmental | Open in IMG/M |
| 3300020169 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1 | Environmental | Open in IMG/M |
| 3300020187 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1 | Environmental | Open in IMG/M |
| 3300020388 | Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064) | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
| 3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
| 3300021371 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497 | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022169 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300024255 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MG | Environmental | Open in IMG/M |
| 3300024518 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2 | Environmental | Open in IMG/M |
| 3300025483 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025608 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_161SG_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025620 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 (SPAdes) | Environmental | Open in IMG/M |
| 3300025626 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes) | Environmental | Open in IMG/M |
| 3300025640 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025704 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 (SPAdes) | Environmental | Open in IMG/M |
| 3300025767 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025809 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025860 | Pelagic Microbial community sample from North Sea - COGITO 998_met_03 (SPAdes) | Environmental | Open in IMG/M |
| 3300025874 | Pelagic Microbial community sample from North Sea - COGITO 998_met_04 (SPAdes) | Environmental | Open in IMG/M |
| 3300025880 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025890 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027833 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027861 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG | Environmental | Open in IMG/M |
| 3300027996 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MG | Environmental | Open in IMG/M |
| 3300028127 | Seawater microbial communities from Monterey Bay, California, United States - 49D | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031766 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515 | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GS312G0146KB_00444200 | 2189573027 | Marine Estuarine | MDYLSRELEDYQYYVDTTCEKCGESTDPNYLDCNCEEEDEEE |
| DelMOSum2010_1000213721 | 3300000101 | Marine | MDYLSRELEEYQYRIDTTCEKCGESTDPDYYDCKCSDEEE* |
| DelMOSum2010_101013582 | 3300000101 | Marine | MGYLDWELESYQNYHDSTCSVCGESKDPDYYDCRCEDEEDEHLGI* |
| DelMOSpr2010_100075257 | 3300000116 | Marine | MDYLSRELEDYQYYIDTTCEKCGECTDPDYYDCRCEDEXXEE* |
| DelMOWin2010_100075756 | 3300000117 | Marine | MGYLDWELESHQYYQDTTCGVCGECTDPDYYDCRCEEEEDEIHLGI* |
| DelMOWin2010_100088755 | 3300000117 | Marine | MDYLSRELEEYQYRIDTTCEKCGESTDPDYYDCNCSDEEE* |
| DelMOWin2010_102262661 | 3300000117 | Marine | MDYLSRELEDYQYYIDTTCEKCGECTDPDYYDCRCEDEEE |
| P_2C_Liq_1_UnCtyDRAFT_10107626 | 3300000418 | Enviromental | MDYLSRELEEYQYRIDTTCDKCGESTDPDYYDCRCSDEEE* |
| BBAY92_1000071615 | 3300000947 | Macroalgal Surface | MGYLDWELESYQYYHDSTCSVCGESQDPDYYDCRCEEEEDEHLGI* |
| JGI20154J14316_100180694 | 3300001348 | Pelagic Marine | MDYLSRELEDYQYYVDTTCEKCGESTDPDYYDCNCSDEEE* |
| JGI20157J14317_100195009 | 3300001352 | Pelagic Marine | MDYLSRELEEYQYRIDTTCDKCGESTDPDYYDCSCSDEEE* |
| JGI20157J14317_100264334 | 3300001352 | Pelagic Marine | MDYLSRELEEYQYRIDTTCEKCGESTDPDYYDCRCEDEEEEE* |
| Water_1003057 | 3300002930 | Estuary Water | MSYLDWELESHQYYQDTTCGVCGECTDPDYFDCRCEEEEDEIHLGI* |
| Water_1004418 | 3300002930 | Estuary Water | MDYLSRELEDYQYYIDTTCEKCGECTDPDYYDCRCEDEDEEEEE* |
| JGI26084J50262_10297104 | 3300003427 | Marine | LMDYLSRELEEYQYRIDTTCEKCGESTDPDYYDCNCSDEEE* |
| Ga0055584_1016403951 | 3300004097 | Pelagic Marine | MSYLDWELESYQNYHDSTCSVCGESKDPDYYDCRCRDEDDDEHLGI* |
| Ga0076920_1329631 | 3300005732 | Marine | MGYLDWELESYQNYHDSTCSVCGESQDPDYYDCRCEDEEDEHLGI* |
| Ga0078893_122700002 | 3300005837 | Marine Surface Water | MGYLDWELESHQYYQDTTCGVCGECTDPDYYDCRCEEEEEIHLGI* |
| Ga0075466_11694803 | 3300006029 | Aqueous | YLSRELEEYQYRIDTTCEKCGESTDPDYYDCNCSDEEE* |
| Ga0070744_101083461 | 3300006484 | Estuarine | MGYLDWELESYQNYHDSTCSVCGESKDPDYYDCSCKDEDDDVHLGI* |
| Ga0098054_13668292 | 3300006789 | Marine | MGYLDWELESHQYYQDTTCGVCGGCTDPDYYDCRCEDEEDDIHLGI* |
| Ga0098055_10033768 | 3300006793 | Marine | MGYLDWELESHQYYQDTTCGVCGECTDPDYYDCRCEDEEDEIHLGI* |
| Ga0098055_100792610 | 3300006793 | Marine | MDYLSRELEDYQYYVDTTCEKCGECTDPEYYDCRCEDEEEEE* |
| Ga0070749_106455803 | 3300006802 | Aqueous | MGYLDWELESYQNYHDSTCSVCGESQDPDYYDCRCEEEEDEHLGI* |
| Ga0070754_101193834 | 3300006810 | Aqueous | MDYLSRELEDYQYYVDTTCDKCGESTDPDYYDCRCSDEEE* |
| Ga0070754_103041141 | 3300006810 | Aqueous | MSYLDWELESYQNYHDSTCSVCGESKDPDYYDCRCEDEEDEHLGI* |
| Ga0075476_101283142 | 3300006867 | Aqueous | MGYLDWELESYQNYHDSTCSVCGESRDPDYYDCRCEDEEDEHLGI* |
| Ga0070750_102955161 | 3300006916 | Aqueous | MGYLDWELESYQNYHDSTCSVCGESQDPDYYDCRCE |
| Ga0098045_11153143 | 3300006922 | Marine | MGYLDWELESHQYYQDTTCGVCGECTDPDYYDCRCED |
| Ga0070752_12027363 | 3300007345 | Aqueous | MDYLSRELEDYQYYIDTTCEKCGESTDPDYYDCNCEDEEEEE* |
| Ga0070752_12764124 | 3300007345 | Aqueous | MSYLDWELESYQNYHDSTCSVCGESKDPDYYDCRCEDEEDEHLG |
| Ga0070753_13535021 | 3300007346 | Aqueous | MDYLSRELEDYQYYLDTTCEKCGESTDPDYYDCNCSDEEE* |
| Ga0102861_10429411 | 3300007544 | Estuarine | LEDYQYYVDTTCEKCGECTDPDYYDCRCEDEDEEEEE* |
| Ga0102817_10795382 | 3300007555 | Estuarine | MDYLSRELEDYQYYVDTTCEKCGESKDPEYYDCRCEDEEEEE* |
| Ga0102954_10113162 | 3300007778 | Water | MDYLSRELEEYQYRIDTTCYKCGESTDPDYYDCRCSDEEE* |
| Ga0102954_12525652 | 3300007778 | Water | MGYLDWELESYQNYHDSTCSVCGESKDPDYYDCRCRDEDDDEHLGI* |
| Ga0105745_10531452 | 3300007972 | Estuary Water | MDYLSRELEDYQYYVDTTCEKCGECTDPDYYDCRCEDEDEEEEE* |
| Ga0115549_10822292 | 3300009074 | Pelagic Marine | MDYLSRELEEYQYRIDTTCEKCGESTDPDYYDCRCSDEEE* |
| Ga0115549_12101782 | 3300009074 | Pelagic Marine | MDYLSRELEDYQYYVDTTCEKCGESTDPNYLDCNCEEEEEEE* |
| Ga0115545_11970702 | 3300009433 | Pelagic Marine | MDYLSRELEDYQYYIDTTCEKCGESTDPNYLDCNCEEEEEEE* |
| Ga0115008_1000194215 | 3300009436 | Marine | MGYLDWELESYQNYHDSTCSVCGESQDPDYYDCRCEDEDDIHLGI* |
| Ga0115565_102820532 | 3300009467 | Pelagic Marine | MDYLSRELEEYQYYVDTTCEKCGESTDPDYYDCNCSDEEE* |
| Ga0115554_12529871 | 3300009472 | Pelagic Marine | MDYLSRELEDYQYYVDTTCEKCGESTDPDYYDCNCSEEEE* |
| Ga0115571_11217212 | 3300009495 | Pelagic Marine | MGYLDWELESYQYYQDTTCGVCGECTDPDYYDCRCEEEEDEIHLGI* |
| Ga0098056_11171313 | 3300010150 | Marine | MGYLDWELESHQYYQDTTCGVCGECTDPDYYDCRCEDEEDDIHLGI* |
| Ga0136655_11589383 | 3300010316 | Freshwater To Marine Saline Gradient | MGYLDWELESYQNYHDSTCSVCGESKDPDYYDCRC |
| Ga0136655_11904501 | 3300010316 | Freshwater To Marine Saline Gradient | MGYLDWELESYQNYHDSTCSVCGESKDPDYYDCRCKDEEDEHLGI* |
| Ga0151671_10319913 | 3300011253 | Marine | MGYLDWELESYQYYQDSTCSVCGESQDPDYYDCRCEEEEDEHLGI* |
| Ga0180120_103187882 | 3300017697 | Freshwater To Marine Saline Gradient | MDYLDWELESYQNYHDSTCSVCGESQDPDYYDCRCEEEEEEHLGI |
| Ga0181398_10789413 | 3300017725 | Seawater | MDYLSRELEDYQYYVDTTCEKCGESTDPNYLDCNCEEEEE |
| Ga0181401_10381602 | 3300017727 | Seawater | MDYLSRELEDYQYYVDTTCDKCGESTDPDYYDCNCSDEEE |
| Ga0181410_10555874 | 3300017763 | Seawater | MDYLSRELEDYQYYVDTTCEKCGECTDPDYYDCRCEDEEEEE |
| Ga0181380_100018115 | 3300017782 | Seawater | MGYLDWELESHQYYQDTTCGVCGECTDPDYYDCRCEDEEDDIHLGI |
| Ga0188851_10011063 | 3300018682 | Freshwater Lake | MSYLDWELESYQNYHDSTCSVCGESKDPDYYDCRCRDEDDDEHLGI |
| Ga0194032_10113263 | 3300019938 | Freshwater | MDYLSRELEDYQYYVDTTCEKCGESTDPDYYDCNCSDEEE |
| Ga0206125_100111822 | 3300020165 | Seawater | MDYLSRELEEYQYRIDTTCEKCGESTDPDYYDCNCSDEEE |
| Ga0206128_10613634 | 3300020166 | Seawater | MDYLSRELEEYQYRIDTTCEKCGESTDPDYYDCNDEEEEE |
| Ga0206128_13435022 | 3300020166 | Seawater | MDYLSRELEDYQYYVDTTCEKCGESTDPDYYDCRCEDEEEEE |
| Ga0206127_100108932 | 3300020169 | Seawater | MSYLDWELESYQNYHDSTCSICGESKDPDYYDCRCRDEDDDEHLGI |
| Ga0206130_100632163 | 3300020187 | Seawater | MDYLSRELEEYQYRIDTTCEKCGESTDPDYYDCRCSDEEE |
| Ga0206130_102286952 | 3300020187 | Seawater | MGYLDWELESYQNYHDSTCSVCGESRDPDYYDCRCEDEEDEHLGI |
| Ga0211678_101533103 | 3300020388 | Marine | MGYLDWELESHQYYQDTTCGVCGECTDPDYYDCRCEDEEDEIHLGI |
| Ga0206677_100255624 | 3300021085 | Seawater | MDYLSRELEDYQYYVDTTCEKCGESKDPEYYDCRCEDEEEEE |
| Ga0206682_100677056 | 3300021185 | Seawater | MGYLDWELESHQYYQDTTCGVCGECTDPDYYDCRCEDEEDEIHL |
| Ga0206682_101871162 | 3300021185 | Seawater | MGYLDWELESYQNYHDSTCSVCGESKDPDYYDCSCKDEDDDVHLGI |
| Ga0206682_103086634 | 3300021185 | Seawater | MDYLSRELEDYQYYVDTTCEKCGECTDPEYYDCRCEDEEEEE |
| Ga0213862_100149151 | 3300021347 | Seawater | YQNYHDSTCSVCGESKDPDYYDCRCEDEEDEHLGI |
| Ga0213863_101211742 | 3300021371 | Seawater | MGYLDWELESYQNYHDSTCSVCGESKDPDYYDCRCEDEEDEHLGI |
| Ga0213868_106498482 | 3300021389 | Seawater | MGYLDWELESYQYYQDSTCSVCGESKDPDYYDCRCEEEEDEHLGI |
| Ga0222718_100537574 | 3300021958 | Estuarine Water | MDYLSRELEEYQYRIDTTCDKCGESTDPDYYDCRCSDEEE |
| Ga0222716_100390407 | 3300021959 | Estuarine Water | MGYLDWELESYQNYHDSTCSVCGESKDPDYYDCRCEDEEDEIHLGI |
| Ga0222719_107187152 | 3300021964 | Estuarine Water | MGYLDWELESYQNYHDSTCSVCGESKDPDYYDCRCRDEDDDEHLGI |
| Ga0212030_10682612 | 3300022053 | Aqueous | MGYLDWELESYQNYHDSTCSVCGESKDPDYYDCRCKDEEDEHLGI |
| Ga0212024_10157992 | 3300022065 | Aqueous | MGYLDWELESYQNYHDSTCSVCGESQDPDYYDCRCEEEEDEHLGI |
| Ga0196903_10197602 | 3300022169 | Aqueous | MDYLSRELEEYQYRIDTTCEKCGESTDPDYYDCKCSDEEE |
| Ga0196887_10796333 | 3300022178 | Aqueous | LMDYLSRELEEYQYRIDTTCEKCGESTDPDYYDCNCSDEEE |
| Ga0196901_12253481 | 3300022200 | Aqueous | MDYLSRELEEYQYRIDTTCEKCGESTDPDYYDCNC |
| (restricted) Ga0233438_1000545512 | 3300024255 | Seawater | MDYLSRELEDYQYYVDTTCEKCGESTDPDYYDCRCSDEEE |
| (restricted) Ga0255048_100110241 | 3300024518 | Seawater | MGYLDWELESYQNYHDSTCSVCGESQDPDYYDCRCEE |
| Ga0209557_11075451 | 3300025483 | Marine | MGYLDWELESYQNYHDSTCSVCGESKDPDYYDCRCEEEEDEHLGI |
| Ga0208303_10127645 | 3300025543 | Aqueous | LESYQNYHDSTCSVCGESKDPDYYDCRCKDEEDEHLGI |
| Ga0209654_11350223 | 3300025608 | Marine | MDYLSRELEEYQYRIDTTCDKCGESTDPDYYDCSCSDEEE |
| Ga0209405_10674464 | 3300025620 | Pelagic Marine | YLSRELEEYQYRIDTTCEKCGESTDPDYYDCNCSDEEE |
| Ga0209716_10018135 | 3300025626 | Pelagic Marine | MGYLDWELESHQYYQDTTCGVCGECTDPDYYDCRCEEEEDEIHLGI |
| Ga0209716_10616231 | 3300025626 | Pelagic Marine | MSYLDWELESHQYYQDTTCGVCGECTDPDYFDCRCEE |
| Ga0209198_10762811 | 3300025640 | Pelagic Marine | LSRELEDYQYYVDTTCEKCGESTDPDYYDCNCSDEEE |
| Ga0208643_10285691 | 3300025645 | Aqueous | KTKAMDYLSRELEEYQYRIDTTCEKCGESTDPDYYDCNCSDEEE |
| Ga0208134_10620714 | 3300025652 | Aqueous | AMDYLSRELEEYQYRIDTTCEKCGESTDPDYYDCNCSDEEE |
| Ga0208898_10627714 | 3300025671 | Aqueous | MGYLDWELESYQNYHDSTCSVCGESQDPDYYDCRCEDEEDEHLGI |
| Ga0209602_10030004 | 3300025704 | Pelagic Marine | MGYLDWELESYQYYQDTTCGVCGECTDPDYYDCRCEEEEDEIHLGI |
| Ga0209137_10124386 | 3300025767 | Marine | MGYLDWELESHQYYQDTTCGVCGECTDPDYYDCRCEEEEDEHLGI |
| Ga0209199_12082521 | 3300025809 | Pelagic Marine | MDYLSRELEEYQYYVDTTCEKCGESTDPDYYDCNCSDEEE |
| Ga0208645_12538192 | 3300025853 | Aqueous | MDYLSRELEDYQYYVDTTCDKCGESTDPDYYDCRCSDEEE |
| Ga0209119_11531032 | 3300025860 | Pelagic Marine | MSYLDWELESYQNYHDSTCSICGESKDPDYYDCRCEDDDEHLGI |
| Ga0209533_100079454 | 3300025874 | Pelagic Marine | MGYLDWELESYQYYHDSTCSVCGESQDPDYYDCRCEEEEDEHLGI |
| Ga0209534_103700432 | 3300025880 | Pelagic Marine | MDYLSRELEEYQYRIDTTCEKCGESTDPDYYDCRCEDEEEEE |
| Ga0209631_103675442 | 3300025890 | Pelagic Marine | MDYLSRELEDYQYYVDTTCEKCGESTDPDYYDCNCEDEEEEE |
| Ga0208133_10051167 | 3300027631 | Estuarine | MDYLSRELEDYQYYVDTTCDKCGESTDPDYYDCSCSDEEE |
| Ga0209092_1000088346 | 3300027833 | Marine | MGYLDWELESYQNYHDSTCSVCGESQDPDYYDCRCEDEDDIHLGI |
| (restricted) Ga0233415_101170253 | 3300027861 | Seawater | MGYLDWELESYQNYHDSTCSVCGECTDPDYYDCRCEEEEDEHLGI |
| (restricted) Ga0233413_101225241 | 3300027996 | Seawater | VMGYLDWELESYQNYHDSTCSVCGESKDPDYYDCRCEEEEDEHLGI |
| (restricted) Ga0233413_103802711 | 3300027996 | Seawater | MDYLSRELEEYQYRIDTTCDKCGESTDPDYYDCNCSDEE |
| Ga0233401_10285644 | 3300028127 | Seawater | MGYLDWELESYQNYHDRTCSVCGESKDPDYYDCRCEDEEDEIHLGI |
| Ga0307376_100606974 | 3300031578 | Soil | MGYLDWELESYQNYHDSTCSVCGESKDPDYYDCRCSDEDDDEHLGI |
| Ga0307377_100516435 | 3300031673 | Soil | MDYLDRELMEYQSYQDTTCKVCGECTHPLYYDCNCSEEDEHLGI |
| Ga0307377_102160714 | 3300031673 | Soil | YLDWELESYQNYHDSTCSVCGESKDPDYYDCRCRDEDDDEHLGI |
| Ga0315322_100288041 | 3300031766 | Seawater | MDYLSRELEDYQYYVDTTCEKCGECTDPDYYDCRCEDEDEEEEE |
| Ga0315322_101358344 | 3300031766 | Seawater | MDYLSRELEDYQYYVDTTCEKCGECTDPDYYDCRCEDEDEDEEE |
| Ga0316202_101630131 | 3300032277 | Microbial Mat | MDYLSRELEEYQYRIDTTCEKCGESTDPDYYDCRCSDEE |
| Ga0348335_079155_287_424 | 3300034374 | Aqueous | MSYLDWELESYQNYHDSTCSVCGESKDPDYYDCRCEDEEDEHLGI |
| Ga0348335_079780_17_154 | 3300034374 | Aqueous | MGYLDWELESYQNYHDSTCSICGESKDPDYYDCRCEDEEDEHLGI |
| Ga0348337_128505_57_179 | 3300034418 | Aqueous | MDYLSRELEDYQYYLDTTCEKCGESTDPDYYDCNCSDEEE |
| ⦗Top⦘ |