| Basic Information | |
|---|---|
| Family ID | F084217 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 112 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MSDYLNYLDEVYTDLVAEYGEGITLAYHEANIKEM |
| Number of Associated Samples | 84 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 80.36 % |
| % of genes near scaffold ends (potentially truncated) | 17.86 % |
| % of genes from short scaffolds (< 2000 bps) | 80.36 % |
| Associated GOLD sequencing projects | 77 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (65.179 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (23.214 % of family members) |
| Environment Ontology (ENVO) | Unclassified (86.607 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (81.250 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 82.86% β-sheet: 0.00% Coil/Unstructured: 17.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF06067 | DUF932 | 6.25 |
| PF03567 | Sulfotransfer_2 | 1.79 |
| PF00590 | TP_methylase | 0.89 |
| PF00255 | GSHPx | 0.89 |
| PF01464 | SLT | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG0386 | Thioredoxin/glutathione peroxidase BtuE, reduces lipid peroxides | Defense mechanisms [V] | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 65.18 % |
| All Organisms | root | All Organisms | 34.82 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352005|2199916473 | Not Available | 25101 | Open in IMG/M |
| 3300002306|B570J29618_1007839 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 671 | Open in IMG/M |
| 3300002363|B570J29624_104383 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 883 | Open in IMG/M |
| 3300002408|B570J29032_108821792 | Not Available | 517 | Open in IMG/M |
| 3300002408|B570J29032_109602751 | Not Available | 924 | Open in IMG/M |
| 3300002835|B570J40625_101183645 | Not Available | 641 | Open in IMG/M |
| 3300003277|JGI25908J49247_10056440 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1012 | Open in IMG/M |
| 3300003277|JGI25908J49247_10101131 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 694 | Open in IMG/M |
| 3300003393|JGI25909J50240_1046985 | Not Available | 905 | Open in IMG/M |
| 3300003394|JGI25907J50239_1118035 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 515 | Open in IMG/M |
| 3300003412|JGI25912J50252_10119176 | Not Available | 623 | Open in IMG/M |
| 3300004792|Ga0007761_11135111 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 815 | Open in IMG/M |
| 3300005517|Ga0070374_10009893 | All Organisms → Viruses → Predicted Viral | 4632 | Open in IMG/M |
| 3300005517|Ga0070374_10154741 | Not Available | 1189 | Open in IMG/M |
| 3300005517|Ga0070374_10326059 | Not Available | 777 | Open in IMG/M |
| 3300005580|Ga0049083_10056301 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1383 | Open in IMG/M |
| 3300005580|Ga0049083_10211506 | Not Available | 657 | Open in IMG/M |
| 3300005581|Ga0049081_10050015 | Not Available | 1583 | Open in IMG/M |
| 3300005581|Ga0049081_10084730 | Not Available | 1187 | Open in IMG/M |
| 3300005581|Ga0049081_10235027 | Not Available | 647 | Open in IMG/M |
| 3300005582|Ga0049080_10018358 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2438 | Open in IMG/M |
| 3300005582|Ga0049080_10224747 | Not Available | 617 | Open in IMG/M |
| 3300005582|Ga0049080_10239095 | Not Available | 594 | Open in IMG/M |
| 3300005583|Ga0049085_10013671 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3132 | Open in IMG/M |
| 3300005583|Ga0049085_10133813 | Not Available | 842 | Open in IMG/M |
| 3300005583|Ga0049085_10137041 | Not Available | 830 | Open in IMG/M |
| 3300005584|Ga0049082_10028713 | All Organisms → Viruses → Predicted Viral | 1940 | Open in IMG/M |
| 3300005584|Ga0049082_10154482 | Not Available | 795 | Open in IMG/M |
| 3300005584|Ga0049082_10173026 | Not Available | 744 | Open in IMG/M |
| 3300005585|Ga0049084_10193416 | Not Available | 697 | Open in IMG/M |
| 3300005805|Ga0079957_1005681 | Not Available | 10112 | Open in IMG/M |
| 3300005940|Ga0073913_10002788 | All Organisms → Viruses → Predicted Viral | 2321 | Open in IMG/M |
| 3300006484|Ga0070744_10151692 | Not Available | 665 | Open in IMG/M |
| 3300006484|Ga0070744_10154923 | Not Available | 657 | Open in IMG/M |
| 3300006805|Ga0075464_10972013 | Not Available | 532 | Open in IMG/M |
| 3300007544|Ga0102861_1102001 | Not Available | 767 | Open in IMG/M |
| 3300007559|Ga0102828_1080633 | Not Available | 780 | Open in IMG/M |
| 3300007973|Ga0105746_1102900 | Not Available | 939 | Open in IMG/M |
| 3300008120|Ga0114355_1199891 | Not Available | 645 | Open in IMG/M |
| 3300009026|Ga0102829_1056546 | All Organisms → Viruses → Predicted Viral | 1183 | Open in IMG/M |
| 3300009155|Ga0114968_10000324 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 35272 | Open in IMG/M |
| 3300009155|Ga0114968_10512043 | Not Available | 643 | Open in IMG/M |
| 3300009160|Ga0114981_10391633 | Not Available | 749 | Open in IMG/M |
| 3300009163|Ga0114970_10665065 | Not Available | 556 | Open in IMG/M |
| 3300009181|Ga0114969_10700898 | Not Available | 545 | Open in IMG/M |
| 3300010157|Ga0114964_10010167 | Not Available | 5746 | Open in IMG/M |
| 3300011113|Ga0151517_1550 | Not Available | 13133 | Open in IMG/M |
| 3300012765|Ga0138274_1245465 | All Organisms → Viruses → Predicted Viral | 1042 | Open in IMG/M |
| 3300013004|Ga0164293_10325342 | All Organisms → Viruses → Predicted Viral | 1057 | Open in IMG/M |
| 3300013004|Ga0164293_11059210 | Not Available | 503 | Open in IMG/M |
| 3300013006|Ga0164294_10841468 | Not Available | 618 | Open in IMG/M |
| (restricted) 3300013122|Ga0172374_1291714 | Not Available | 578 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10152488 | All Organisms → Viruses → Predicted Viral | 1538 | Open in IMG/M |
| 3300014819|Ga0119954_1023510 | All Organisms → Viruses → Predicted Viral | 1212 | Open in IMG/M |
| 3300017723|Ga0181362_1074808 | Not Available | 686 | Open in IMG/M |
| 3300017761|Ga0181356_1182817 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 631 | Open in IMG/M |
| 3300017774|Ga0181358_1230026 | Not Available | 592 | Open in IMG/M |
| 3300017777|Ga0181357_1322255 | Not Available | 519 | Open in IMG/M |
| 3300019784|Ga0181359_1144407 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 823 | Open in IMG/M |
| 3300020141|Ga0211732_1496727 | Not Available | 2305 | Open in IMG/M |
| 3300020151|Ga0211736_10371107 | Not Available | 676 | Open in IMG/M |
| 3300020172|Ga0211729_10099371 | Not Available | 640 | Open in IMG/M |
| 3300020205|Ga0211731_10523693 | Not Available | 709 | Open in IMG/M |
| 3300020506|Ga0208091_1010248 | Not Available | 1170 | Open in IMG/M |
| 3300020513|Ga0208090_1001148 | Not Available | 4904 | Open in IMG/M |
| 3300020527|Ga0208232_1007268 | Not Available | 1785 | Open in IMG/M |
| 3300020530|Ga0208235_1009880 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1233 | Open in IMG/M |
| 3300020536|Ga0207939_1020454 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 929 | Open in IMG/M |
| 3300020549|Ga0207942_1006420 | All Organisms → Viruses → Predicted Viral | 1670 | Open in IMG/M |
| 3300021963|Ga0222712_10241847 | All Organisms → Viruses → Predicted Viral | 1159 | Open in IMG/M |
| 3300022752|Ga0214917_10001130 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 34856 | Open in IMG/M |
| 3300023174|Ga0214921_10007013 | Not Available | 15164 | Open in IMG/M |
| 3300023174|Ga0214921_10030725 | Not Available | 5275 | Open in IMG/M |
| 3300023174|Ga0214921_10069087 | All Organisms → Viruses → Predicted Viral | 2898 | Open in IMG/M |
| 3300023174|Ga0214921_10308506 | Not Available | 875 | Open in IMG/M |
| 3300024346|Ga0244775_10989146 | Not Available | 664 | Open in IMG/M |
| 3300027563|Ga0209552_1000307 | Not Available | 15559 | Open in IMG/M |
| 3300027563|Ga0209552_1068296 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 983 | Open in IMG/M |
| 3300027563|Ga0209552_1136469 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 638 | Open in IMG/M |
| 3300027581|Ga0209651_1036033 | Not Available | 1512 | Open in IMG/M |
| 3300027581|Ga0209651_1055667 | All Organisms → Viruses → Predicted Viral | 1169 | Open in IMG/M |
| 3300027581|Ga0209651_1174996 | Not Available | 570 | Open in IMG/M |
| 3300027608|Ga0208974_1000577 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 14957 | Open in IMG/M |
| 3300027608|Ga0208974_1062542 | Not Available | 1046 | Open in IMG/M |
| 3300027642|Ga0209135_1122486 | Not Available | 858 | Open in IMG/M |
| 3300027644|Ga0209356_1133967 | Not Available | 702 | Open in IMG/M |
| 3300027649|Ga0208960_1054188 | Not Available | 1261 | Open in IMG/M |
| 3300027689|Ga0209551_1187098 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 638 | Open in IMG/M |
| 3300027707|Ga0209443_1150310 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 848 | Open in IMG/M |
| (restricted) 3300027728|Ga0247836_1076379 | Not Available | 1736 | Open in IMG/M |
| 3300027732|Ga0209442_1086114 | All Organisms → Viruses → Predicted Viral | 1287 | Open in IMG/M |
| 3300027741|Ga0209085_1000015 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 115655 | Open in IMG/M |
| 3300027746|Ga0209597_1034625 | All Organisms → Viruses → Predicted Viral | 2629 | Open in IMG/M |
| 3300027754|Ga0209596_1092980 | Not Available | 1440 | Open in IMG/M |
| 3300027770|Ga0209086_10001048 | Not Available | 22779 | Open in IMG/M |
| 3300027770|Ga0209086_10186232 | Not Available | 969 | Open in IMG/M |
| 3300027770|Ga0209086_10277765 | Not Available | 726 | Open in IMG/M |
| 3300027808|Ga0209354_10245760 | Not Available | 719 | Open in IMG/M |
| 3300027963|Ga0209400_1102286 | Not Available | 1331 | Open in IMG/M |
| (restricted) 3300027977|Ga0247834_1095965 | Not Available | 1341 | Open in IMG/M |
| (restricted) 3300028569|Ga0247843_1057581 | Not Available | 2088 | Open in IMG/M |
| 3300032092|Ga0315905_11602206 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
| 3300033816|Ga0334980_0001533 | Not Available | 10645 | Open in IMG/M |
| 3300033979|Ga0334978_0070682 | All Organisms → Viruses → Predicted Viral | 1790 | Open in IMG/M |
| 3300033979|Ga0334978_0076226 | All Organisms → Viruses → Predicted Viral | 1717 | Open in IMG/M |
| 3300033980|Ga0334981_0314005 | Not Available | 691 | Open in IMG/M |
| 3300033981|Ga0334982_0083180 | Not Available | 1711 | Open in IMG/M |
| 3300033995|Ga0335003_0297454 | Not Available | 726 | Open in IMG/M |
| 3300034106|Ga0335036_0221552 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1298 | Open in IMG/M |
| 3300034122|Ga0335060_0307958 | Not Available | 864 | Open in IMG/M |
| 3300034122|Ga0335060_0557170 | Not Available | 582 | Open in IMG/M |
| 3300034284|Ga0335013_0471625 | Not Available | 757 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 23.21% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 20.54% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 16.07% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 12.50% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 8.04% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.36% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 2.68% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.68% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.68% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.89% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.89% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.89% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.89% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.89% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.89% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352005 | Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion | Environmental | Open in IMG/M |
| 3300002306 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002363 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003412 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD | Environmental | Open in IMG/M |
| 3300004792 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300011113 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Sep | Environmental | Open in IMG/M |
| 3300012765 | Freshwater microbial communities from Lake Croche, Canada - C_131016_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300013122 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3m | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300014819 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011A | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020513 | Freshwater microbial communities from Lake Mendota, WI - 20JUL2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020530 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020536 | Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027642 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027649 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027689 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
| 3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027977 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m | Environmental | Open in IMG/M |
| 3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
| 3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2200104937 | 2199352005 | Freshwater | MSDYLNYLDEVYTDLVAEYGEGITLAYHEANIKEM |
| B570J29618_10078391 | 3300002306 | Freshwater | MSDYLNYLDEVYNDLVSEYGEGINLAYHEANKSEM*GNSHSNT |
| B570J29624_1043833 | 3300002363 | Freshwater | MSDYLNYLDEVYTDLVAEYGEGITLAYHETNIKEM*GNSHSNTP |
| B570J29032_1088217922 | 3300002408 | Freshwater | MSDYLNYLDEVYTDLVAEYGEGITLAYHEANKSEM*GNSHSNTPPTIRKCQR* |
| B570J29032_1096027514 | 3300002408 | Freshwater | MSDYLNYLDEVYTDLVAEYGEGITLAYHEANIKEM*GNSHPNTPP* |
| B570J40625_1011836453 | 3300002835 | Freshwater | LGDVMSDYLNYLDEVYDDLVSEYGEGITLAYHEANKSEM* |
| JGI25908J49247_100564401 | 3300003277 | Freshwater Lake | MSDYLNYLDEVYTDLVAEYGEGITLAYHEANIKEM*GNSHSNTPP* |
| JGI25908J49247_101011312 | 3300003277 | Freshwater Lake | LGDVMSDYLNYLDEVYDDLVSEYGEGITLAYHEANVSEM* |
| JGI25909J50240_10469853 | 3300003393 | Freshwater Lake | MNDYLNYLDEVYDDLVSEYGEGITLAYHEANVSEM*GNSHSTR* |
| JGI25907J50239_11180351 | 3300003394 | Freshwater Lake | MSDYLNYLDEVYDDLVSEYGEGITLAYHEANIKEM*GNSHSNTPP* |
| JGI25912J50252_101191762 | 3300003412 | Freshwater Lake | LGDVMSDYLNYLDEVYDDLVSEYGEGITLAYHEANVAEM* |
| Ga0007761_111351111 | 3300004792 | Freshwater Lake | KLGDVMSDYLNYLDEVYDDLVSEYGEGITLAYHEANVSEM* |
| Ga0070374_1000989316 | 3300005517 | Freshwater Lake | MSNYLNYQDEIYSDLVAEYGEDITLAYHNANISDMS* |
| Ga0070374_101547412 | 3300005517 | Freshwater Lake | MSDYLDYMDEVYNDLVSEFGEEITLAYHEANIAEM* |
| Ga0070374_103260594 | 3300005517 | Freshwater Lake | MSDYLNYLDEVYDDLVSEYGEGITLAYHEANVSEM*GNSHSTR* |
| Ga0049083_100563016 | 3300005580 | Freshwater Lentic | MSDYLNYLDEVYTDLVAEYGEGITLAYHEANVAEM* |
| Ga0049083_102115061 | 3300005580 | Freshwater Lentic | MSDYLNYLDEVYDDLVSEYGEGITLAYHEANVAEM*GNSHPTDSVSA** |
| Ga0049081_100500153 | 3300005581 | Freshwater Lentic | MSDYLNYQDEIYSDLVSEYGEGITLAYHQVNIADMS* |
| Ga0049081_100847304 | 3300005581 | Freshwater Lentic | MSDYLNYLDEVYTDLVAEYGEAITLAYHVANEKEM* |
| Ga0049081_102350273 | 3300005581 | Freshwater Lentic | MSDYLNYQDEVYTDLVAEYGEGITLAYHEANIKEM*GNSHSNTPPTI |
| Ga0049080_100183585 | 3300005582 | Freshwater Lentic | MNDYLNYMDEVYDELVSEYGEGITLAYHEANVSEM* |
| Ga0049080_102247472 | 3300005582 | Freshwater Lentic | MSDYLNYLDEVYDDLVSEYGEGITLAYHEANVAEM* |
| Ga0049080_102390952 | 3300005582 | Freshwater Lentic | MSDYLNYQDEVYADLVAEYGEGITLAYHQANIAEM* |
| Ga0049085_1001367111 | 3300005583 | Freshwater Lentic | MDYLNYLDEVYTDLVAEYGEGITLAYHEANIKEM* |
| Ga0049085_101338132 | 3300005583 | Freshwater Lentic | MSDYLNYQDEIYSDLVAEYGEGITLAYHNANISEM* |
| Ga0049085_101370414 | 3300005583 | Freshwater Lentic | MNDYINYLDEVYDDLVSEYGEGITLAYHEANVAEM*GNSHSTPSVSA** |
| Ga0049082_100287138 | 3300005584 | Freshwater Lentic | MSDYLNYLDEVYSDLVSEYSEGITLAYHQVNIADMS* |
| Ga0049082_101544821 | 3300005584 | Freshwater Lentic | MNDYLNYLDEVYDDLVSEYGEGITLAYHEANVSEM*GNSHST |
| Ga0049082_101730262 | 3300005584 | Freshwater Lentic | MSDYLNYQDEIYADLVAEYGEGITLAYHQANIAEM* |
| Ga0049084_101934162 | 3300005585 | Freshwater Lentic | VVILHSRKLGDVMSDYLNYLDEVYDDLVSEYGEGITLAYHEANVSEM* |
| Ga0079957_100568117 | 3300005805 | Lake | MSDYLNYLDEIYDELVDEFGSEATLAYHQANEKEM* |
| Ga0073913_100027885 | 3300005940 | Sand | MSDYLDYLDEVYDDLVSEYGEGITLAYHEANKSEM* |
| Ga0070744_101516922 | 3300006484 | Estuarine | MSDYLNYLDEVYTDLVAEYGEDITLAYHQANIAEM* |
| Ga0070744_101549232 | 3300006484 | Estuarine | MSDYLNYLDEVYTDLVAEYGEGITLAYHEANIKEM* |
| Ga0075464_109720133 | 3300006805 | Aqueous | MSDYLNYLDEVYTDLVAEYGEGITIAYHEANIKEM* |
| Ga0102861_11020012 | 3300007544 | Estuarine | MSDYLNYLDEVYTDLVAEYGEGITFAYHEANIKEM* |
| Ga0102828_10806332 | 3300007559 | Estuarine | MSNYLNYQDEIYSDLVAEYGEGITLAYHQANIAEMCGNSHRNTPPIIGKCQ* |
| Ga0105746_11029003 | 3300007973 | Estuary Water | MDYLNYLDEVYTDLVAEYGEGITLAYHQANIAEM* |
| Ga0114355_11998914 | 3300008120 | Freshwater, Plankton | MSDYLNYLDEVYTDLVAEYGEGITLAYHETNIKEM* |
| Ga0102829_10565463 | 3300009026 | Estuarine | MNDYLNYLDEVYTDLVAEYGEDITLAYHIANKSEM*GNSHSTDSVSA** |
| Ga0114968_1000032454 | 3300009155 | Freshwater Lake | MNDYLNYLDEVYDDLVSEYGEGITLAYHVANEKEM* |
| Ga0114968_105120432 | 3300009155 | Freshwater Lake | MSDYLNYLDEVYDDLVAEFGEGITLAYHEANIKEM* |
| Ga0114981_103916333 | 3300009160 | Freshwater Lake | MSDYLNYLDEVYTDLVAEYGEGITLAYHEANIKEM*GNSHSN |
| Ga0114970_106650651 | 3300009163 | Freshwater Lake | GGLMSDYLNYLDEVYTDLVAEYGEGITLAYHQANVAEM* |
| Ga0114969_107008981 | 3300009181 | Freshwater Lake | RIGGELMSDYLNYLDEDYTDLVAEYGEGITLAYHQANVAEM* |
| Ga0114964_1001016717 | 3300010157 | Freshwater Lake | MNDYLNYQDEVYNDLVSEFGEEITLAYHEANIAEM* |
| Ga0151517_15504 | 3300011113 | Freshwater | MSDYLNYLDEVYTDLVAEYGENITLAYHEANIKEM* |
| Ga0138274_12454654 | 3300012765 | Freshwater Lake | LTKKGGNLMNDYLNYQDEVYNDLVSEFGEEITLAYHEANIAEM* |
| Ga0164293_103253423 | 3300013004 | Freshwater | MSDYLDYLDEVYEDLVSEYGEGITLAYHEANKSEM*GNSHSTDSVSP** |
| Ga0164293_110592102 | 3300013004 | Freshwater | MSDYLNYLDEVYTDLVAEYGEGITLVYHEANIKEM* |
| Ga0164294_108414684 | 3300013006 | Freshwater | MSDYLNYLDEVYTDQVAEYGEGITLAYHEANIKEM* |
| (restricted) Ga0172374_12917142 | 3300013122 | Freshwater | MSDYLNYLDEIYTDLVAEYGEGITAAYHEANIKEM* |
| (restricted) Ga0172376_101524884 | 3300014720 | Freshwater | MNDYLNYLDEIYTDLVAEYGEGITAAYHEANIKEM* |
| Ga0119954_10235101 | 3300014819 | Freshwater | MNEYLNYLDEVYDDLVSEYGEGITFAYHVANEKEM* |
| Ga0181362_10748082 | 3300017723 | Freshwater Lake | MSNYLNYQDEIYSDLVAEYGEDITLAYHEANIKEM |
| Ga0181356_11828172 | 3300017761 | Freshwater Lake | MSDYLNYLDEVYTDLVAEYGEGITLAYHEANVAEMXGNSHPTDSVSAX |
| Ga0181358_12300262 | 3300017774 | Freshwater Lake | MSDYLNYLDEVYTDLVAEYGEGITLAYHNANISDMS |
| Ga0181357_13222551 | 3300017777 | Freshwater Lake | VVILHSGKLGDVMSDYLNYLDEVYDDLVSEYGEGITLAYHEANVSEM |
| Ga0181359_11444072 | 3300019784 | Freshwater Lake | MSDYLNYLDEVYDDLVSEYGEGITLAYHEANVAEM |
| Ga0211732_14967275 | 3300020141 | Freshwater | MSDYLNYLDEVYTDLVAEYGEGITLAYHEANVKEM |
| Ga0211736_103711072 | 3300020151 | Freshwater | MSDYLNYLDEVYTDLVAEYGEGITLAYHEANVAEM |
| Ga0211729_100993713 | 3300020172 | Freshwater | MSDYLNYLDEVYTDLVAEYGEGITLAYHEANVKEMXGNSHPNTPPTIRK |
| Ga0211731_105236933 | 3300020205 | Freshwater | MSDYLNYLDEVYTDLVAEYGEGITLAYHEANVKEMXGNSHPNTPPTIKKCQR |
| Ga0208091_10102482 | 3300020506 | Freshwater | MSDYLNYLDEVYTDLVAEYGEGITLAYHEANKSEM |
| Ga0208090_10011484 | 3300020513 | Freshwater | MSDYLNYLDEVYNDLVSEYGEGINLAYHEANKSEM |
| Ga0208232_10072683 | 3300020527 | Freshwater | MSDYLNYLDEVYTDLVAEYGEGITLAYREANIKEM |
| Ga0208235_10098802 | 3300020530 | Freshwater | MSDYLNYLDEVYTDLVAEYGEGMTLAYHVANEKEM |
| Ga0207939_10204544 | 3300020536 | Freshwater | MSDYLNYLDEVYTDLVAEYGDGITLAYHVANEKEM |
| Ga0207942_10064206 | 3300020549 | Freshwater | MSDYLNYLDEVYTDLVAEYGEGITLAYHETNIKEM |
| Ga0222712_102418476 | 3300021963 | Estuarine Water | VILHSRKLGDVIMDYLDYLDEVYDDLVSEFGEGITVAHHEANISEM |
| Ga0214917_1000113031 | 3300022752 | Freshwater | MNEYLNYLDEVYDDLVSEYGEGITFAYHVANEKEM |
| Ga0214921_100070132 | 3300023174 | Freshwater | MSDYLNYLDEVYDDLVAEYGEGITLAYHEANIKEM |
| Ga0214921_1003072516 | 3300023174 | Freshwater | MSDYLNYLDEVYDDLVAEFGEGITLAYHEANIKEM |
| Ga0214921_100690876 | 3300023174 | Freshwater | MSDYLNYLDEIYDELVDEFGSEATLAYHQANEKEM |
| Ga0214921_103085064 | 3300023174 | Freshwater | MSDYLNYLDGIYDELVDEFGSEATLAYHQANEKEMXGISHSNTPLAGRKCQGYLIG |
| Ga0244775_109891462 | 3300024346 | Estuarine | MSNYLNYQDEIYSDLVAEYGEGITLAYHNANISEM |
| Ga0209552_100030712 | 3300027563 | Freshwater Lake | MSDYLDYMDEVYNDLVSEFGEEITLAYHEANIAEM |
| Ga0209552_10682962 | 3300027563 | Freshwater Lake | MSDYLNYLDEVYDDLVSEYGEGITLAYHEANVSEM |
| Ga0209552_11364691 | 3300027563 | Freshwater Lake | MSDYLNYLDEVYTDLVAEYGEGITLAYHEANIKEMXGNSHSNTPPTIRKCQR |
| Ga0209651_10360336 | 3300027581 | Freshwater Lake | MSDYLNYQDEIYSDLVSEYGEGITLAYHQVNIADMS |
| Ga0209651_10556671 | 3300027581 | Freshwater Lake | MNDYLNYLDEVYDDLVSEYGEGITLAYHEANVSEM |
| Ga0209651_11749962 | 3300027581 | Freshwater Lake | MSNYLNYQDEIYSDLVAEYGEGITLAYHNANISDMS |
| Ga0208974_100057711 | 3300027608 | Freshwater Lentic | MSDYLNYLDEVYTDLVAEYGEAITLAYHVANEKEM |
| Ga0208974_10625422 | 3300027608 | Freshwater Lentic | MSDYLNYQDEVYADLVAEYGEGITLAYHQANIAEM |
| Ga0209135_11224861 | 3300027642 | Freshwater Lake | SNYLNYQDEIYSDLVAEYGEDITLAYHNANISDMS |
| Ga0209356_11339672 | 3300027644 | Freshwater Lake | MSNYLNYQDEIYSDLVAEYGEDITLAYHNANISDMS |
| Ga0208960_10541884 | 3300027649 | Freshwater Lentic | MDYLNYLDEVYTDLVAEYGEGITLAYHQANIAEMXGNS |
| Ga0209551_11870984 | 3300027689 | Freshwater Lake | DVMSDYLNYLDEVYDDLVSEYGEGITLAYHEANVSEM |
| Ga0209443_11503101 | 3300027707 | Freshwater Lake | VVILHSRKLGDVMSDYLNYLDEVYDDLVSEYGEGITLAYHEANVSEM |
| (restricted) Ga0247836_10763795 | 3300027728 | Freshwater | MSDYLNYQDEIYSDLVAEYGEGITLAYHQANIAEM |
| Ga0209442_10861143 | 3300027732 | Freshwater Lake | MSDYLNYLDEVYDDLVSEYGEGITLAYHEANVAEMXGNSHPTDSVSAX |
| Ga0209085_100001579 | 3300027741 | Freshwater Lake | MNDYLNYQDEVYNDLVSEFGEEITLAYHEANIAEM |
| Ga0209597_10346253 | 3300027746 | Freshwater Lake | MSDYLNYLDEVYTDLVAEYGEDITLAYHQANIAEM |
| Ga0209596_10929801 | 3300027754 | Freshwater Lake | MSDYLNYLDEVYTDLVAEYGEGITLAYHQANIAEM |
| Ga0209086_1000104844 | 3300027770 | Freshwater Lake | MNDYLNYLDEVYDDLVSEYGEGITLAYHVANEKEM |
| Ga0209086_101862321 | 3300027770 | Freshwater Lake | GDVMSDYLNYLDEVYDDLVAEYGEDITLAYHIANKSEMXGNSHSTDSVSAX |
| Ga0209086_102777654 | 3300027770 | Freshwater Lake | LMSDYLNYLDEVYTDLVAEYGEGITLAYHQANVAEM |
| Ga0209354_102457602 | 3300027808 | Freshwater Lake | MSDYLNYLDEVYDDLVSEYGEGITLAYHEANIKEMXGNSHSNTPP |
| Ga0209400_11022863 | 3300027963 | Freshwater Lake | MSNYLNYQDEIYSDLVSEYGEGITLAYHQVNIADMS |
| (restricted) Ga0247834_10959652 | 3300027977 | Freshwater | MSDYLNYLDEVYTDLVAEYGEGITLAYHEANVKEMXGNSHPNTPPIIRKCQR |
| (restricted) Ga0247843_10575815 | 3300028569 | Freshwater | MSDYLNYQDEIYSDLVAEYGEDITLAYHQANIAEM |
| Ga0315905_116022061 | 3300032092 | Freshwater | MSDYLNYLDEVYTDLVAEYGEGITLAYHEANIKEMXGNSHSNTPP |
| Ga0334980_0001533_3637_3744 | 3300033816 | Freshwater | MSDYLNYQDEVYTDLVAEYGEGITLAYREANIKEM |
| Ga0334978_0070682_601_708 | 3300033979 | Freshwater | MSDYLNYLDEVYNDLVAEFGEGITLAYHEANIKEM |
| Ga0334978_0076226_334_441 | 3300033979 | Freshwater | MSDYLNYLDEVYDELVSEYGEGITLAYHEANKSEM |
| Ga0334981_0314005_547_654 | 3300033980 | Freshwater | MSDYLNYQDEVYTDLVAEYGEGITLVYHEANIKEM |
| Ga0334982_0083180_1412_1519 | 3300033981 | Freshwater | MSDYLNYLDEVYTDLVAEYGEAITLAYHVANEREM |
| Ga0335003_0297454_187_294 | 3300033995 | Freshwater | MSDYLNYQDEVYTDLVAEYGEGITLAYHEANIKEM |
| Ga0335036_0221552_752_859 | 3300034106 | Freshwater | MSDYLNYLDEVYTDLVAEYGEEITLAYHQANIKEM |
| Ga0335060_0307958_78_185 | 3300034122 | Freshwater | MSDYLNYLDEVYTDLVAEYGEGITLAYHVANEKEM |
| Ga0335060_0557170_226_333 | 3300034122 | Freshwater | MSDYLNYQDEVYTDLVSEFGEGITLAYHEANIKEM |
| Ga0335013_0471625_152_259 | 3300034284 | Freshwater | MSDYLNYLDEVYTDLVAEYGEGITLVYHEANIKEM |
| ⦗Top⦘ |