Metagenome / Metatranscriptome Family F084217

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F084217
Family Type	Metagenome / Metatranscriptome
Number of Sequences	112
Average Sequence Length	39 residues
Representative Sequence	MSDYLNYLDEVYTDLVAEYGEGITLAYHEANIKEM
Number of Associated Samples	84
Number of Associated Scaffolds	112

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	80.36 %
% of genes near scaffold ends (potentially truncated)	17.86 %
% of genes from short scaffolds (< 2000 bps)	80.36 %
Associated GOLD sequencing projects	77
AlphaFold2 3D model prediction	No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (65.179 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (23.214 % of family members)
Environment Ontology (ENVO)	Unclassified (86.607 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (81.250 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 82.86% β-sheet: 0.00% Coil/Unstructured: 17.14%
Feature Viewer

Powered by Feature Viewer

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 112 Family Scaffolds
PF06067	DUF932	6.25
PF03567	Sulfotransfer_2	1.79
PF00590	TP_methylase	0.89
PF00255	GSHPx	0.89
PF01464	SLT	0.89

COG ID	Name	Functional Category	% Frequency in 112 Family Scaffolds
COG0386	Thioredoxin/glutathione peroxidase BtuE, reduces lipid peroxides	Defense mechanisms [V]	0.89

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	65.18 %
All Organisms	root	All Organisms	34.82 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	65.18 %
Viruses	superkingdom	All Organisms → Viruses	34.82 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	65.18 %
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	20.54 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	14.29 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	65.18 %
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	20.54 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	14.29 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	65.18 %
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	20.54 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	14.29 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	65.18 %
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	20.54 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	14.29 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	65.18 %
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	17.86 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	14.29 %
Caudovirales	order	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	0.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	65.18 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	17.86 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	14.29 %
Siphoviridae	family	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae	0.89 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2199352005\|2199916473	Not Available	25101	Open in IMG/M
3300002306\|B570J29618_1007839	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	671	Open in IMG/M
3300002363\|B570J29624_104383	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	883	Open in IMG/M
3300002408\|B570J29032_108821792	Not Available	517	Open in IMG/M
3300002408\|B570J29032_109602751	Not Available	924	Open in IMG/M
3300002835\|B570J40625_101183645	Not Available	641	Open in IMG/M
3300003277\|JGI25908J49247_10056440	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1012	Open in IMG/M
3300003277\|JGI25908J49247_10101131	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	694	Open in IMG/M
3300003393\|JGI25909J50240_1046985	Not Available	905	Open in IMG/M
3300003394\|JGI25907J50239_1118035	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	515	Open in IMG/M
3300003412\|JGI25912J50252_10119176	Not Available	623	Open in IMG/M
3300004792\|Ga0007761_11135111	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	815	Open in IMG/M
3300005517\|Ga0070374_10009893	All Organisms → Viruses → Predicted Viral	4632	Open in IMG/M
3300005517\|Ga0070374_10154741	Not Available	1189	Open in IMG/M
3300005517\|Ga0070374_10326059	Not Available	777	Open in IMG/M
3300005580\|Ga0049083_10056301	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1383	Open in IMG/M
3300005580\|Ga0049083_10211506	Not Available	657	Open in IMG/M
3300005581\|Ga0049081_10050015	Not Available	1583	Open in IMG/M
3300005581\|Ga0049081_10084730	Not Available	1187	Open in IMG/M
3300005581\|Ga0049081_10235027	Not Available	647	Open in IMG/M
3300005582\|Ga0049080_10018358	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2438	Open in IMG/M
3300005582\|Ga0049080_10224747	Not Available	617	Open in IMG/M
3300005582\|Ga0049080_10239095	Not Available	594	Open in IMG/M
3300005583\|Ga0049085_10013671	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3132	Open in IMG/M
3300005583\|Ga0049085_10133813	Not Available	842	Open in IMG/M
3300005583\|Ga0049085_10137041	Not Available	830	Open in IMG/M
3300005584\|Ga0049082_10028713	All Organisms → Viruses → Predicted Viral	1940	Open in IMG/M
3300005584\|Ga0049082_10154482	Not Available	795	Open in IMG/M
3300005584\|Ga0049082_10173026	Not Available	744	Open in IMG/M
3300005585\|Ga0049084_10193416	Not Available	697	Open in IMG/M
3300005805\|Ga0079957_1005681	Not Available	10112	Open in IMG/M
3300005940\|Ga0073913_10002788	All Organisms → Viruses → Predicted Viral	2321	Open in IMG/M
3300006484\|Ga0070744_10151692	Not Available	665	Open in IMG/M
3300006484\|Ga0070744_10154923	Not Available	657	Open in IMG/M
3300006805\|Ga0075464_10972013	Not Available	532	Open in IMG/M
3300007544\|Ga0102861_1102001	Not Available	767	Open in IMG/M
3300007559\|Ga0102828_1080633	Not Available	780	Open in IMG/M
3300007973\|Ga0105746_1102900	Not Available	939	Open in IMG/M
3300008120\|Ga0114355_1199891	Not Available	645	Open in IMG/M
3300009026\|Ga0102829_1056546	All Organisms → Viruses → Predicted Viral	1183	Open in IMG/M
3300009155\|Ga0114968_10000324	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	35272	Open in IMG/M
3300009155\|Ga0114968_10512043	Not Available	643	Open in IMG/M
3300009160\|Ga0114981_10391633	Not Available	749	Open in IMG/M
3300009163\|Ga0114970_10665065	Not Available	556	Open in IMG/M
3300009181\|Ga0114969_10700898	Not Available	545	Open in IMG/M
3300010157\|Ga0114964_10010167	Not Available	5746	Open in IMG/M
3300011113\|Ga0151517_1550	Not Available	13133	Open in IMG/M
3300012765\|Ga0138274_1245465	All Organisms → Viruses → Predicted Viral	1042	Open in IMG/M
3300013004\|Ga0164293_10325342	All Organisms → Viruses → Predicted Viral	1057	Open in IMG/M
3300013004\|Ga0164293_11059210	Not Available	503	Open in IMG/M
3300013006\|Ga0164294_10841468	Not Available	618	Open in IMG/M
(restricted) 3300013122\|Ga0172374_1291714	Not Available	578	Open in IMG/M
(restricted) 3300014720\|Ga0172376_10152488	All Organisms → Viruses → Predicted Viral	1538	Open in IMG/M
3300014819\|Ga0119954_1023510	All Organisms → Viruses → Predicted Viral	1212	Open in IMG/M
3300017723\|Ga0181362_1074808	Not Available	686	Open in IMG/M
3300017761\|Ga0181356_1182817	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	631	Open in IMG/M
3300017774\|Ga0181358_1230026	Not Available	592	Open in IMG/M
3300017777\|Ga0181357_1322255	Not Available	519	Open in IMG/M
3300019784\|Ga0181359_1144407	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	823	Open in IMG/M
3300020141\|Ga0211732_1496727	Not Available	2305	Open in IMG/M
3300020151\|Ga0211736_10371107	Not Available	676	Open in IMG/M
3300020172\|Ga0211729_10099371	Not Available	640	Open in IMG/M
3300020205\|Ga0211731_10523693	Not Available	709	Open in IMG/M
3300020506\|Ga0208091_1010248	Not Available	1170	Open in IMG/M
3300020513\|Ga0208090_1001148	Not Available	4904	Open in IMG/M
3300020527\|Ga0208232_1007268	Not Available	1785	Open in IMG/M
3300020530\|Ga0208235_1009880	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1233	Open in IMG/M
3300020536\|Ga0207939_1020454	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	929	Open in IMG/M
3300020549\|Ga0207942_1006420	All Organisms → Viruses → Predicted Viral	1670	Open in IMG/M
3300021963\|Ga0222712_10241847	All Organisms → Viruses → Predicted Viral	1159	Open in IMG/M
3300022752\|Ga0214917_10001130	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	34856	Open in IMG/M
3300023174\|Ga0214921_10007013	Not Available	15164	Open in IMG/M
3300023174\|Ga0214921_10030725	Not Available	5275	Open in IMG/M
3300023174\|Ga0214921_10069087	All Organisms → Viruses → Predicted Viral	2898	Open in IMG/M
3300023174\|Ga0214921_10308506	Not Available	875	Open in IMG/M
3300024346\|Ga0244775_10989146	Not Available	664	Open in IMG/M
3300027563\|Ga0209552_1000307	Not Available	15559	Open in IMG/M
3300027563\|Ga0209552_1068296	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	983	Open in IMG/M
3300027563\|Ga0209552_1136469	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	638	Open in IMG/M
3300027581\|Ga0209651_1036033	Not Available	1512	Open in IMG/M
3300027581\|Ga0209651_1055667	All Organisms → Viruses → Predicted Viral	1169	Open in IMG/M
3300027581\|Ga0209651_1174996	Not Available	570	Open in IMG/M
3300027608\|Ga0208974_1000577	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	14957	Open in IMG/M
3300027608\|Ga0208974_1062542	Not Available	1046	Open in IMG/M
3300027642\|Ga0209135_1122486	Not Available	858	Open in IMG/M
3300027644\|Ga0209356_1133967	Not Available	702	Open in IMG/M
3300027649\|Ga0208960_1054188	Not Available	1261	Open in IMG/M
3300027689\|Ga0209551_1187098	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	638	Open in IMG/M
3300027707\|Ga0209443_1150310	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	848	Open in IMG/M
(restricted) 3300027728\|Ga0247836_1076379	Not Available	1736	Open in IMG/M
3300027732\|Ga0209442_1086114	All Organisms → Viruses → Predicted Viral	1287	Open in IMG/M
3300027741\|Ga0209085_1000015	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae	115655	Open in IMG/M
3300027746\|Ga0209597_1034625	All Organisms → Viruses → Predicted Viral	2629	Open in IMG/M
3300027754\|Ga0209596_1092980	Not Available	1440	Open in IMG/M
3300027770\|Ga0209086_10001048	Not Available	22779	Open in IMG/M
3300027770\|Ga0209086_10186232	Not Available	969	Open in IMG/M
3300027770\|Ga0209086_10277765	Not Available	726	Open in IMG/M
3300027808\|Ga0209354_10245760	Not Available	719	Open in IMG/M
3300027963\|Ga0209400_1102286	Not Available	1331	Open in IMG/M
(restricted) 3300027977\|Ga0247834_1095965	Not Available	1341	Open in IMG/M
(restricted) 3300028569\|Ga0247843_1057581	Not Available	2088	Open in IMG/M
3300032092\|Ga0315905_11602206	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	505	Open in IMG/M
3300033816\|Ga0334980_0001533	Not Available	10645	Open in IMG/M
3300033979\|Ga0334978_0070682	All Organisms → Viruses → Predicted Viral	1790	Open in IMG/M
3300033979\|Ga0334978_0076226	All Organisms → Viruses → Predicted Viral	1717	Open in IMG/M
3300033980\|Ga0334981_0314005	Not Available	691	Open in IMG/M
3300033981\|Ga0334982_0083180	Not Available	1711	Open in IMG/M
3300033995\|Ga0335003_0297454	Not Available	726	Open in IMG/M
3300034106\|Ga0335036_0221552	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1298	Open in IMG/M
3300034122\|Ga0335060_0307958	Not Available	864	Open in IMG/M
3300034122\|Ga0335060_0557170	Not Available	582	Open in IMG/M
3300034284\|Ga0335013_0471625	Not Available	757	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	99.11%
Terrestrial	Environmental → Terrestrial	0.89%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	91.07%
Marine	Environmental → Aquatic → Marine	8.04%
Soil	Environmental → Terrestrial → Soil	0.89%

Habitat	Taxonomy	Distribution
Lentic	Environmental → Aquatic → Freshwater → Lentic	50.00%
Lake	Environmental → Aquatic → Freshwater → Lake	40.18%
Unclassified	Environmental → Aquatic → Marine → Unclassified	3.57%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	2.68%
Coastal	Environmental → Aquatic → Marine → Coastal	1.79%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	0.89%
Sand	Environmental → Terrestrial → Soil → Sand	0.89%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	41.96%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	40.18%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	8.04%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	3.57%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	2.68%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	1.79%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	0.89%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.89%

Habitat	Taxonomy	Distribution
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	23.21%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	20.54%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	16.07%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	12.50%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	8.04%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	5.36%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	2.68%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	2.68%
Estuarine	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine	2.68%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	0.89%
Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake	0.89%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	0.89%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	0.89%
Estuary Water	Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water	0.89%
Estuarine Water	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water	0.89%
Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Sand	0.89%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2199352005	Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion	Environmental	Open in IMG/M
3300002306	Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnion	Environmental	Open in IMG/M
3300002363	Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion	Environmental	Open in IMG/M
3300002408	Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)	Environmental	Open in IMG/M
3300002835	Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)	Environmental	Open in IMG/M
3300003277	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD	Environmental	Open in IMG/M
3300003393	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD	Environmental	Open in IMG/M
3300003394	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN	Environmental	Open in IMG/M
3300003412	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD	Environmental	Open in IMG/M
3300004792	Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005517	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)	Environmental	Open in IMG/M
3300005580	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF	Environmental	Open in IMG/M
3300005581	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF	Environmental	Open in IMG/M
3300005582	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF	Environmental	Open in IMG/M
3300005583	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF	Environmental	Open in IMG/M
3300005584	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF	Environmental	Open in IMG/M
3300005585	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF	Environmental	Open in IMG/M
3300005805	Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA	Environmental	Open in IMG/M
3300005940	Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14	Environmental	Open in IMG/M
3300006484	Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535	Environmental	Open in IMG/M
3300006805	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA	Environmental	Open in IMG/M
3300007544	Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3	Environmental	Open in IMG/M
3300007559	Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541	Environmental	Open in IMG/M
3300007973	Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um	Environmental	Open in IMG/M
3300008120	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA	Environmental	Open in IMG/M
3300009026	Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575	Environmental	Open in IMG/M
3300009155	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG	Environmental	Open in IMG/M
3300009160	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG	Environmental	Open in IMG/M
3300009163	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG	Environmental	Open in IMG/M
3300009181	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG	Environmental	Open in IMG/M
3300010157	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG	Environmental	Open in IMG/M
3300011113	Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Sep	Environmental	Open in IMG/M
3300012765	Freshwater microbial communities from Lake Croche, Canada - C_131016_E_mt (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300013004	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG	Environmental	Open in IMG/M
3300013006	Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG	Environmental	Open in IMG/M
3300013122 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3m	Environmental	Open in IMG/M
3300014720 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m	Environmental	Open in IMG/M
3300014819	Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011A	Environmental	Open in IMG/M
3300017723	Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N	Environmental	Open in IMG/M
3300017761	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N	Environmental	Open in IMG/M
3300017774	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D	Environmental	Open in IMG/M
3300017777	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N	Environmental	Open in IMG/M
3300019784	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D	Environmental	Open in IMG/M
3300020141	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1	Environmental	Open in IMG/M
3300020151	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1	Environmental	Open in IMG/M
3300020172	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1	Environmental	Open in IMG/M
3300020205	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1	Environmental	Open in IMG/M
3300020506	Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020513	Freshwater microbial communities from Lake Mendota, WI - 20JUL2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020527	Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020530	Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020536	Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020549	Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300021963	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D	Environmental	Open in IMG/M
3300022752	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB	Environmental	Open in IMG/M
3300023174	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505	Environmental	Open in IMG/M
3300024346	Whole water sample coassembly	Environmental	Open in IMG/M
3300027563	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes)	Environmental	Open in IMG/M
3300027581	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes)	Environmental	Open in IMG/M
3300027608	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)	Environmental	Open in IMG/M
3300027642	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (SPAdes)	Environmental	Open in IMG/M
3300027644	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes)	Environmental	Open in IMG/M
3300027649	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF (SPAdes)	Environmental	Open in IMG/M
3300027689	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes)	Environmental	Open in IMG/M
3300027707	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes)	Environmental	Open in IMG/M
3300027728 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m	Environmental	Open in IMG/M
3300027732	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes)	Environmental	Open in IMG/M
3300027741	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027746	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027754	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027770	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027808	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)	Environmental	Open in IMG/M
3300027963	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027977 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m	Environmental	Open in IMG/M
3300028569 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m	Environmental	Open in IMG/M
3300032092	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121	Environmental	Open in IMG/M
3300033816	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005	Environmental	Open in IMG/M
3300033979	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003	Environmental	Open in IMG/M
3300033980	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007	Environmental	Open in IMG/M
3300033981	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011	Environmental	Open in IMG/M
3300033995	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056	Environmental	Open in IMG/M
3300034106	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131	Environmental	Open in IMG/M
3300034122	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181	Environmental	Open in IMG/M
3300034284	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
2200104937	2199352005	Freshwater	MSDYLNYLDEVYTDLVAEYGEGITLAYHEANIKEM
B570J29618_10078391	3300002306	Freshwater	MSDYLNYLDEVYNDLVSEYGEGINLAYHEANKSEM*GNSHSNT
B570J29624_1043833	3300002363	Freshwater	MSDYLNYLDEVYTDLVAEYGEGITLAYHETNIKEM*GNSHSNTP
B570J29032_1088217922	3300002408	Freshwater	MSDYLNYLDEVYTDLVAEYGEGITLAYHEANKSEMGNSHSNTPPTIRKCQR
B570J29032_1096027514	3300002408	Freshwater	MSDYLNYLDEVYTDLVAEYGEGITLAYHEANIKEMGNSHPNTPP
B570J40625_1011836453	3300002835	Freshwater	LGDVMSDYLNYLDEVYDDLVSEYGEGITLAYHEANKSEM*
JGI25908J49247_100564401	3300003277	Freshwater Lake	MSDYLNYLDEVYTDLVAEYGEGITLAYHEANIKEMGNSHSNTPP
JGI25908J49247_101011312	3300003277	Freshwater Lake	LGDVMSDYLNYLDEVYDDLVSEYGEGITLAYHEANVSEM*
JGI25909J50240_10469853	3300003393	Freshwater Lake	MNDYLNYLDEVYDDLVSEYGEGITLAYHEANVSEMGNSHSTR
JGI25907J50239_11180351	3300003394	Freshwater Lake	MSDYLNYLDEVYDDLVSEYGEGITLAYHEANIKEMGNSHSNTPP
JGI25912J50252_101191762	3300003412	Freshwater Lake	LGDVMSDYLNYLDEVYDDLVSEYGEGITLAYHEANVAEM*
Ga0007761_111351111	3300004792	Freshwater Lake	KLGDVMSDYLNYLDEVYDDLVSEYGEGITLAYHEANVSEM*
Ga0070374_1000989316	3300005517	Freshwater Lake	MSNYLNYQDEIYSDLVAEYGEDITLAYHNANISDMS*
Ga0070374_101547412	3300005517	Freshwater Lake	MSDYLDYMDEVYNDLVSEFGEEITLAYHEANIAEM*
Ga0070374_103260594	3300005517	Freshwater Lake	MSDYLNYLDEVYDDLVSEYGEGITLAYHEANVSEMGNSHSTR
Ga0049083_100563016	3300005580	Freshwater Lentic	MSDYLNYLDEVYTDLVAEYGEGITLAYHEANVAEM*
Ga0049083_102115061	3300005580	Freshwater Lentic	MSDYLNYLDEVYDDLVSEYGEGITLAYHEANVAEMGNSHPTDSVSA*
Ga0049081_100500153	3300005581	Freshwater Lentic	MSDYLNYQDEIYSDLVSEYGEGITLAYHQVNIADMS*
Ga0049081_100847304	3300005581	Freshwater Lentic	MSDYLNYLDEVYTDLVAEYGEAITLAYHVANEKEM*
Ga0049081_102350273	3300005581	Freshwater Lentic	MSDYLNYQDEVYTDLVAEYGEGITLAYHEANIKEM*GNSHSNTPPTI
Ga0049080_100183585	3300005582	Freshwater Lentic	MNDYLNYMDEVYDELVSEYGEGITLAYHEANVSEM*
Ga0049080_102247472	3300005582	Freshwater Lentic	MSDYLNYLDEVYDDLVSEYGEGITLAYHEANVAEM*
Ga0049080_102390952	3300005582	Freshwater Lentic	MSDYLNYQDEVYADLVAEYGEGITLAYHQANIAEM*
Ga0049085_1001367111	3300005583	Freshwater Lentic	MDYLNYLDEVYTDLVAEYGEGITLAYHEANIKEM*
Ga0049085_101338132	3300005583	Freshwater Lentic	MSDYLNYQDEIYSDLVAEYGEGITLAYHNANISEM*
Ga0049085_101370414	3300005583	Freshwater Lentic	MNDYINYLDEVYDDLVSEYGEGITLAYHEANVAEMGNSHSTPSVSA*
Ga0049082_100287138	3300005584	Freshwater Lentic	MSDYLNYLDEVYSDLVSEYSEGITLAYHQVNIADMS*
Ga0049082_101544821	3300005584	Freshwater Lentic	MNDYLNYLDEVYDDLVSEYGEGITLAYHEANVSEM*GNSHST
Ga0049082_101730262	3300005584	Freshwater Lentic	MSDYLNYQDEIYADLVAEYGEGITLAYHQANIAEM*
Ga0049084_101934162	3300005585	Freshwater Lentic	VVILHSRKLGDVMSDYLNYLDEVYDDLVSEYGEGITLAYHEANVSEM*
Ga0079957_100568117	3300005805	Lake	MSDYLNYLDEIYDELVDEFGSEATLAYHQANEKEM*
Ga0073913_100027885	3300005940	Sand	MSDYLDYLDEVYDDLVSEYGEGITLAYHEANKSEM*
Ga0070744_101516922	3300006484	Estuarine	MSDYLNYLDEVYTDLVAEYGEDITLAYHQANIAEM*
Ga0070744_101549232	3300006484	Estuarine	MSDYLNYLDEVYTDLVAEYGEGITLAYHEANIKEM*
Ga0075464_109720133	3300006805	Aqueous	MSDYLNYLDEVYTDLVAEYGEGITIAYHEANIKEM*
Ga0102861_11020012	3300007544	Estuarine	MSDYLNYLDEVYTDLVAEYGEGITFAYHEANIKEM*
Ga0102828_10806332	3300007559	Estuarine	MSNYLNYQDEIYSDLVAEYGEGITLAYHQANIAEMCGNSHRNTPPIIGKCQ*
Ga0105746_11029003	3300007973	Estuary Water	MDYLNYLDEVYTDLVAEYGEGITLAYHQANIAEM*
Ga0114355_11998914	3300008120	Freshwater, Plankton	MSDYLNYLDEVYTDLVAEYGEGITLAYHETNIKEM*
Ga0102829_10565463	3300009026	Estuarine	MNDYLNYLDEVYTDLVAEYGEDITLAYHIANKSEMGNSHSTDSVSA*
Ga0114968_1000032454	3300009155	Freshwater Lake	MNDYLNYLDEVYDDLVSEYGEGITLAYHVANEKEM*
Ga0114968_105120432	3300009155	Freshwater Lake	MSDYLNYLDEVYDDLVAEFGEGITLAYHEANIKEM*
Ga0114981_103916333	3300009160	Freshwater Lake	MSDYLNYLDEVYTDLVAEYGEGITLAYHEANIKEM*GNSHSN
Ga0114970_106650651	3300009163	Freshwater Lake	GGLMSDYLNYLDEVYTDLVAEYGEGITLAYHQANVAEM*
Ga0114969_107008981	3300009181	Freshwater Lake	RIGGELMSDYLNYLDEDYTDLVAEYGEGITLAYHQANVAEM*
Ga0114964_1001016717	3300010157	Freshwater Lake	MNDYLNYQDEVYNDLVSEFGEEITLAYHEANIAEM*
Ga0151517_15504	3300011113	Freshwater	MSDYLNYLDEVYTDLVAEYGENITLAYHEANIKEM*
Ga0138274_12454654	3300012765	Freshwater Lake	LTKKGGNLMNDYLNYQDEVYNDLVSEFGEEITLAYHEANIAEM*
Ga0164293_103253423	3300013004	Freshwater	MSDYLDYLDEVYEDLVSEYGEGITLAYHEANKSEMGNSHSTDSVSP*
Ga0164293_110592102	3300013004	Freshwater	MSDYLNYLDEVYTDLVAEYGEGITLVYHEANIKEM*
Ga0164294_108414684	3300013006	Freshwater	MSDYLNYLDEVYTDQVAEYGEGITLAYHEANIKEM*
(restricted) Ga0172374_12917142	3300013122	Freshwater	MSDYLNYLDEIYTDLVAEYGEGITAAYHEANIKEM*
(restricted) Ga0172376_101524884	3300014720	Freshwater	MNDYLNYLDEIYTDLVAEYGEGITAAYHEANIKEM*
Ga0119954_10235101	3300014819	Freshwater	MNEYLNYLDEVYDDLVSEYGEGITFAYHVANEKEM*
Ga0181362_10748082	3300017723	Freshwater Lake	MSNYLNYQDEIYSDLVAEYGEDITLAYHEANIKEM
Ga0181356_11828172	3300017761	Freshwater Lake	MSDYLNYLDEVYTDLVAEYGEGITLAYHEANVAEMXGNSHPTDSVSAX
Ga0181358_12300262	3300017774	Freshwater Lake	MSDYLNYLDEVYTDLVAEYGEGITLAYHNANISDMS
Ga0181357_13222551	3300017777	Freshwater Lake	VVILHSGKLGDVMSDYLNYLDEVYDDLVSEYGEGITLAYHEANVSEM
Ga0181359_11444072	3300019784	Freshwater Lake	MSDYLNYLDEVYDDLVSEYGEGITLAYHEANVAEM
Ga0211732_14967275	3300020141	Freshwater	MSDYLNYLDEVYTDLVAEYGEGITLAYHEANVKEM
Ga0211736_103711072	3300020151	Freshwater	MSDYLNYLDEVYTDLVAEYGEGITLAYHEANVAEM
Ga0211729_100993713	3300020172	Freshwater	MSDYLNYLDEVYTDLVAEYGEGITLAYHEANVKEMXGNSHPNTPPTIRK
Ga0211731_105236933	3300020205	Freshwater	MSDYLNYLDEVYTDLVAEYGEGITLAYHEANVKEMXGNSHPNTPPTIKKCQR
Ga0208091_10102482	3300020506	Freshwater	MSDYLNYLDEVYTDLVAEYGEGITLAYHEANKSEM
Ga0208090_10011484	3300020513	Freshwater	MSDYLNYLDEVYNDLVSEYGEGINLAYHEANKSEM
Ga0208232_10072683	3300020527	Freshwater	MSDYLNYLDEVYTDLVAEYGEGITLAYREANIKEM
Ga0208235_10098802	3300020530	Freshwater	MSDYLNYLDEVYTDLVAEYGEGMTLAYHVANEKEM
Ga0207939_10204544	3300020536	Freshwater	MSDYLNYLDEVYTDLVAEYGDGITLAYHVANEKEM
Ga0207942_10064206	3300020549	Freshwater	MSDYLNYLDEVYTDLVAEYGEGITLAYHETNIKEM
Ga0222712_102418476	3300021963	Estuarine Water	VILHSRKLGDVIMDYLDYLDEVYDDLVSEFGEGITVAHHEANISEM
Ga0214917_1000113031	3300022752	Freshwater	MNEYLNYLDEVYDDLVSEYGEGITFAYHVANEKEM
Ga0214921_100070132	3300023174	Freshwater	MSDYLNYLDEVYDDLVAEYGEGITLAYHEANIKEM
Ga0214921_1003072516	3300023174	Freshwater	MSDYLNYLDEVYDDLVAEFGEGITLAYHEANIKEM
Ga0214921_100690876	3300023174	Freshwater	MSDYLNYLDEIYDELVDEFGSEATLAYHQANEKEM
Ga0214921_103085064	3300023174	Freshwater	MSDYLNYLDGIYDELVDEFGSEATLAYHQANEKEMXGISHSNTPLAGRKCQGYLIG
Ga0244775_109891462	3300024346	Estuarine	MSNYLNYQDEIYSDLVAEYGEGITLAYHNANISEM
Ga0209552_100030712	3300027563	Freshwater Lake	MSDYLDYMDEVYNDLVSEFGEEITLAYHEANIAEM
Ga0209552_10682962	3300027563	Freshwater Lake	MSDYLNYLDEVYDDLVSEYGEGITLAYHEANVSEM
Ga0209552_11364691	3300027563	Freshwater Lake	MSDYLNYLDEVYTDLVAEYGEGITLAYHEANIKEMXGNSHSNTPPTIRKCQR
Ga0209651_10360336	3300027581	Freshwater Lake	MSDYLNYQDEIYSDLVSEYGEGITLAYHQVNIADMS
Ga0209651_10556671	3300027581	Freshwater Lake	MNDYLNYLDEVYDDLVSEYGEGITLAYHEANVSEM
Ga0209651_11749962	3300027581	Freshwater Lake	MSNYLNYQDEIYSDLVAEYGEGITLAYHNANISDMS
Ga0208974_100057711	3300027608	Freshwater Lentic	MSDYLNYLDEVYTDLVAEYGEAITLAYHVANEKEM
Ga0208974_10625422	3300027608	Freshwater Lentic	MSDYLNYQDEVYADLVAEYGEGITLAYHQANIAEM
Ga0209135_11224861	3300027642	Freshwater Lake	SNYLNYQDEIYSDLVAEYGEDITLAYHNANISDMS
Ga0209356_11339672	3300027644	Freshwater Lake	MSNYLNYQDEIYSDLVAEYGEDITLAYHNANISDMS
Ga0208960_10541884	3300027649	Freshwater Lentic	MDYLNYLDEVYTDLVAEYGEGITLAYHQANIAEMXGNS
Ga0209551_11870984	3300027689	Freshwater Lake	DVMSDYLNYLDEVYDDLVSEYGEGITLAYHEANVSEM
Ga0209443_11503101	3300027707	Freshwater Lake	VVILHSRKLGDVMSDYLNYLDEVYDDLVSEYGEGITLAYHEANVSEM
(restricted) Ga0247836_10763795	3300027728	Freshwater	MSDYLNYQDEIYSDLVAEYGEGITLAYHQANIAEM
Ga0209442_10861143	3300027732	Freshwater Lake	MSDYLNYLDEVYDDLVSEYGEGITLAYHEANVAEMXGNSHPTDSVSAX
Ga0209085_100001579	3300027741	Freshwater Lake	MNDYLNYQDEVYNDLVSEFGEEITLAYHEANIAEM
Ga0209597_10346253	3300027746	Freshwater Lake	MSDYLNYLDEVYTDLVAEYGEDITLAYHQANIAEM
Ga0209596_10929801	3300027754	Freshwater Lake	MSDYLNYLDEVYTDLVAEYGEGITLAYHQANIAEM
Ga0209086_1000104844	3300027770	Freshwater Lake	MNDYLNYLDEVYDDLVSEYGEGITLAYHVANEKEM
Ga0209086_101862321	3300027770	Freshwater Lake	GDVMSDYLNYLDEVYDDLVAEYGEDITLAYHIANKSEMXGNSHSTDSVSAX
Ga0209086_102777654	3300027770	Freshwater Lake	LMSDYLNYLDEVYTDLVAEYGEGITLAYHQANVAEM
Ga0209354_102457602	3300027808	Freshwater Lake	MSDYLNYLDEVYDDLVSEYGEGITLAYHEANIKEMXGNSHSNTPP
Ga0209400_11022863	3300027963	Freshwater Lake	MSNYLNYQDEIYSDLVSEYGEGITLAYHQVNIADMS
(restricted) Ga0247834_10959652	3300027977	Freshwater	MSDYLNYLDEVYTDLVAEYGEGITLAYHEANVKEMXGNSHPNTPPIIRKCQR
(restricted) Ga0247843_10575815	3300028569	Freshwater	MSDYLNYQDEIYSDLVAEYGEDITLAYHQANIAEM
Ga0315905_116022061	3300032092	Freshwater	MSDYLNYLDEVYTDLVAEYGEGITLAYHEANIKEMXGNSHSNTPP
Ga0334980_0001533_3637_3744	3300033816	Freshwater	MSDYLNYQDEVYTDLVAEYGEGITLAYREANIKEM
Ga0334978_0070682_601_708	3300033979	Freshwater	MSDYLNYLDEVYNDLVAEFGEGITLAYHEANIKEM
Ga0334978_0076226_334_441	3300033979	Freshwater	MSDYLNYLDEVYDELVSEYGEGITLAYHEANKSEM
Ga0334981_0314005_547_654	3300033980	Freshwater	MSDYLNYQDEVYTDLVAEYGEGITLVYHEANIKEM
Ga0334982_0083180_1412_1519	3300033981	Freshwater	MSDYLNYLDEVYTDLVAEYGEAITLAYHVANEREM
Ga0335003_0297454_187_294	3300033995	Freshwater	MSDYLNYQDEVYTDLVAEYGEGITLAYHEANIKEM
Ga0335036_0221552_752_859	3300034106	Freshwater	MSDYLNYLDEVYTDLVAEYGEEITLAYHQANIKEM
Ga0335060_0307958_78_185	3300034122	Freshwater	MSDYLNYLDEVYTDLVAEYGEGITLAYHVANEKEM
Ga0335060_0557170_226_333	3300034122	Freshwater	MSDYLNYQDEVYTDLVSEFGEGITLAYHEANIKEM
Ga0335013_0471625_152_259	3300034284	Freshwater	MSDYLNYLDEVYTDLVAEYGEGITLVYHEANIKEM

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters