| Basic Information | |
|---|---|
| Family ID | F084214 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 112 |
| Average Sequence Length | 42 residues |
| Representative Sequence | RKQSPFGIAGSVELGTVRLNSRLDPDVEMLLKTFRRNFGLAY |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.11 % |
| % of genes from short scaffolds (< 2000 bps) | 79.46 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (74.107 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (32.143 % of family members) |
| Environment Ontology (ENVO) | Unclassified (68.750 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (72.321 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.48% β-sheet: 0.00% Coil/Unstructured: 59.52% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF00691 | OmpA | 0.89 |
| PF01464 | SLT | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001968|GOS2236_1066521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1510 | Open in IMG/M |
| 3300002408|B570J29032_109924550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2801 | Open in IMG/M |
| 3300003277|JGI25908J49247_10048339 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1122 | Open in IMG/M |
| 3300003277|JGI25908J49247_10070798 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 873 | Open in IMG/M |
| 3300003393|JGI25909J50240_1001027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7091 | Open in IMG/M |
| 3300003393|JGI25909J50240_1081856 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 646 | Open in IMG/M |
| 3300003493|JGI25923J51411_1030343 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1046 | Open in IMG/M |
| 3300004096|Ga0066177_10236270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 760 | Open in IMG/M |
| 3300004112|Ga0065166_10346692 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 613 | Open in IMG/M |
| 3300004769|Ga0007748_10098128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1245 | Open in IMG/M |
| 3300004792|Ga0007761_11287804 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1044 | Open in IMG/M |
| 3300005517|Ga0070374_10269747 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 867 | Open in IMG/M |
| 3300005517|Ga0070374_10528596 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 588 | Open in IMG/M |
| 3300005565|Ga0068885_1078746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2055 | Open in IMG/M |
| 3300005581|Ga0049081_10085482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1181 | Open in IMG/M |
| 3300005581|Ga0049081_10348620 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
| 3300005805|Ga0079957_1010784 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6882 | Open in IMG/M |
| 3300006484|Ga0070744_10179247 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 605 | Open in IMG/M |
| 3300006803|Ga0075467_10224275 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Polaribacter | 1032 | Open in IMG/M |
| 3300006805|Ga0075464_10388321 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 847 | Open in IMG/M |
| 3300006805|Ga0075464_10556700 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 704 | Open in IMG/M |
| 3300006917|Ga0075472_10308784 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 780 | Open in IMG/M |
| 3300007363|Ga0075458_10046284 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1371 | Open in IMG/M |
| 3300007534|Ga0102690_1038794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2281 | Open in IMG/M |
| 3300007541|Ga0099848_1026778 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2425 | Open in IMG/M |
| 3300008113|Ga0114346_1134761 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1078 | Open in IMG/M |
| 3300008117|Ga0114351_1062072 | All Organisms → Viruses → Predicted Viral | 3026 | Open in IMG/M |
| 3300008120|Ga0114355_1017097 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3904 | Open in IMG/M |
| 3300008120|Ga0114355_1071828 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1465 | Open in IMG/M |
| 3300008448|Ga0114876_1204211 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 663 | Open in IMG/M |
| 3300008450|Ga0114880_1041218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2003 | Open in IMG/M |
| 3300008450|Ga0114880_1167892 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 771 | Open in IMG/M |
| 3300008450|Ga0114880_1220358 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 618 | Open in IMG/M |
| 3300008450|Ga0114880_1248099 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
| 3300009026|Ga0102829_1131648 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 794 | Open in IMG/M |
| 3300009152|Ga0114980_10138016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1449 | Open in IMG/M |
| 3300009152|Ga0114980_10216557 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1124 | Open in IMG/M |
| 3300009160|Ga0114981_10741076 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 519 | Open in IMG/M |
| 3300009181|Ga0114969_10585226 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 613 | Open in IMG/M |
| 3300009183|Ga0114974_10458556 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 721 | Open in IMG/M |
| 3300010354|Ga0129333_10568608 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 987 | Open in IMG/M |
| 3300010885|Ga0133913_10130220 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6735 | Open in IMG/M |
| 3300010885|Ga0133913_11596350 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1646 | Open in IMG/M |
| 3300012000|Ga0119951_1031400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1721 | Open in IMG/M |
| 3300012716|Ga0157605_1241055 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 641 | Open in IMG/M |
| 3300012733|Ga0157606_1206475 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
| 3300012968|Ga0129337_1346650 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 780 | Open in IMG/M |
| 3300013005|Ga0164292_10111497 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2048 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10044810 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3605 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10609071 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 585 | Open in IMG/M |
| (restricted) 3300013129|Ga0172364_10496764 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 773 | Open in IMG/M |
| (restricted) 3300013133|Ga0172362_10539800 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 797 | Open in IMG/M |
| 3300017701|Ga0181364_1012928 | All Organisms → Viruses → Predicted Viral | 1397 | Open in IMG/M |
| 3300017701|Ga0181364_1021369 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1063 | Open in IMG/M |
| 3300017701|Ga0181364_1031350 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 859 | Open in IMG/M |
| 3300017701|Ga0181364_1064748 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
| 3300017716|Ga0181350_1152091 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
| 3300017722|Ga0181347_1123334 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 723 | Open in IMG/M |
| 3300017736|Ga0181365_1039888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1181 | Open in IMG/M |
| 3300017774|Ga0181358_1273953 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 523 | Open in IMG/M |
| 3300017780|Ga0181346_1335748 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
| 3300020159|Ga0211734_10919801 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 875 | Open in IMG/M |
| 3300020172|Ga0211729_11425925 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 631 | Open in IMG/M |
| 3300020179|Ga0194134_10219357 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 802 | Open in IMG/M |
| 3300020196|Ga0194124_10303061 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 771 | Open in IMG/M |
| 3300021093|Ga0194123_10172500 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1138 | Open in IMG/M |
| 3300022190|Ga0181354_1018729 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2172 | Open in IMG/M |
| 3300022190|Ga0181354_1127286 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 814 | Open in IMG/M |
| 3300022752|Ga0214917_10408457 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
| 3300024505|Ga0255150_1002608 | All Organisms → Viruses → Predicted Viral | 3399 | Open in IMG/M |
| 3300024558|Ga0255232_1006860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2056 | Open in IMG/M |
| 3300024566|Ga0256309_1043258 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1196 | Open in IMG/M |
| 3300025445|Ga0208424_1026270 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 692 | Open in IMG/M |
| 3300025896|Ga0208916_10046283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1779 | Open in IMG/M |
| 3300027079|Ga0255188_1063760 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 670 | Open in IMG/M |
| 3300027193|Ga0208800_1019526 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 892 | Open in IMG/M |
| 3300027563|Ga0209552_1174746 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
| 3300027581|Ga0209651_1033719 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1570 | Open in IMG/M |
| 3300027631|Ga0208133_1005889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3590 | Open in IMG/M |
| 3300027631|Ga0208133_1087280 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 732 | Open in IMG/M |
| 3300027656|Ga0209357_1041671 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1481 | Open in IMG/M |
| 3300027656|Ga0209357_1128808 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 690 | Open in IMG/M |
| 3300027656|Ga0209357_1150289 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 621 | Open in IMG/M |
| 3300027733|Ga0209297_1346291 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
| 3300027744|Ga0209355_1234726 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 729 | Open in IMG/M |
| 3300027763|Ga0209088_10018327 | All Organisms → Viruses → Predicted Viral | 3657 | Open in IMG/M |
| 3300027785|Ga0209246_10375794 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
| 3300027785|Ga0209246_10399133 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
| 3300027798|Ga0209353_10295718 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 687 | Open in IMG/M |
| 3300027805|Ga0209229_10278226 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 741 | Open in IMG/M |
| 3300027808|Ga0209354_10002435 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7904 | Open in IMG/M |
| 3300027808|Ga0209354_10192406 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 828 | Open in IMG/M |
| 3300027808|Ga0209354_10389052 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
| 3300027973|Ga0209298_10231309 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 743 | Open in IMG/M |
| (restricted) 3300028044|Ga0247838_1048443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2162 | Open in IMG/M |
| (restricted) 3300028553|Ga0247839_1050436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2379 | Open in IMG/M |
| (restricted) 3300028559|Ga0247831_1127228 | All Organisms → Viruses → Predicted Viral | 1053 | Open in IMG/M |
| 3300031673|Ga0307377_10666905 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 735 | Open in IMG/M |
| 3300031758|Ga0315907_10038153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4289 | Open in IMG/M |
| 3300031758|Ga0315907_10689660 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 778 | Open in IMG/M |
| 3300032050|Ga0315906_10402045 | All Organisms → Viruses → Predicted Viral | 1192 | Open in IMG/M |
| 3300032092|Ga0315905_10064184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3722 | Open in IMG/M |
| 3300032116|Ga0315903_10213577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1701 | Open in IMG/M |
| 3300033980|Ga0334981_0080687 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1636 | Open in IMG/M |
| 3300034061|Ga0334987_0649421 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 614 | Open in IMG/M |
| 3300034062|Ga0334995_0771951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 530 | Open in IMG/M |
| 3300034093|Ga0335012_0000357 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 31636 | Open in IMG/M |
| 3300034105|Ga0335035_0469136 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 696 | Open in IMG/M |
| 3300034109|Ga0335051_0427820 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 624 | Open in IMG/M |
| 3300034116|Ga0335068_0456127 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 600 | Open in IMG/M |
| 3300034284|Ga0335013_0103591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1990 | Open in IMG/M |
| 3300034356|Ga0335048_0271527 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 894 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 32.14% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 16.07% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 8.93% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 8.04% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 7.14% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 4.46% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.57% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 3.57% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.68% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.68% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.79% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.79% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.79% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.89% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.89% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.89% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.89% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001968 | Marine microbial communities from Lake Gatun, Panama - GS020 | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300003493 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
| 3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
| 3300004769 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004792 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005565 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007534 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel4S_1600h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
| 3300012716 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES130 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012733 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES131 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012968 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013129 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cm | Environmental | Open in IMG/M |
| 3300013133 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2 | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020179 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m | Environmental | Open in IMG/M |
| 3300020196 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0m | Environmental | Open in IMG/M |
| 3300021093 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015023 Mahale A surface | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300024505 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8h | Environmental | Open in IMG/M |
| 3300024558 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024566 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025445 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027079 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepB_8h | Environmental | Open in IMG/M |
| 3300027193 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes) | Environmental | Open in IMG/M |
| 3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028044 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_15m | Environmental | Open in IMG/M |
| 3300028553 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_16m | Environmental | Open in IMG/M |
| 3300028559 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1m | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| 3300034109 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GOS2236_10665211 | 3300001968 | Marine | RKQSPFGVAGSVDMGTVRLTSRLDPDVEALIPPMRKMNGLAY* |
| B570J29032_1099245508 | 3300002408 | Freshwater | SRLFIRKQSPFGIAGTPELGTVRLSSRLDPDVEALLRPIKRNNGLAV* |
| JGI25908J49247_100483391 | 3300003277 | Freshwater Lake | RLFVRKQSPFGIAGSVELGTVRLNSRLDPDVEMLLKTFRRNFGLAF* |
| JGI25908J49247_100707983 | 3300003277 | Freshwater Lake | FVRKQSPFGIAGSVELGTVRLNSRLDPDVEMLLKTFRRNFGLAY* |
| JGI25909J50240_10010271 | 3300003393 | Freshwater Lake | RLFVRKQSPFGIAGSVELGTVRLNSRLDPDVEMLLKTFRRNFGLAY* |
| JGI25909J50240_10818562 | 3300003393 | Freshwater Lake | RLFVRKQSPFGIAGSVELGTVRLNSRLDPDVEMXLKTFRRNFGLAY* |
| JGI25923J51411_10303434 | 3300003493 | Freshwater Lake | SPFGIAGSVELGTVRLNSRLDPDVEMLLKTFRRNFGLAF* |
| Ga0066177_102362701 | 3300004096 | Freshwater Lake | SPFGIAGSPDLGTVRLTAKLDADVEALLRPFRKNNGLAK* |
| Ga0065166_103466922 | 3300004112 | Freshwater Lake | RKQSPFGIAGSVELGTVRLSSRLDPDVEILLKPFRRNFGLAF* |
| Ga0007748_100981281 | 3300004769 | Freshwater Lake | SPFGIAGNTDMGTVRLAAKLDADVEALLRPLRKNNGLAV* |
| Ga0007761_112878044 | 3300004792 | Freshwater Lake | IQAARLFVRKQSPFGIAGSVELGTVRLNSRLDPDVEMLLKTFRRNFGLAF* |
| Ga0070374_102697471 | 3300005517 | Freshwater Lake | LFIRKQSPFGVAGSVDMGTVRLTSRLDPDVEALIRPLKKLNGVAY* |
| Ga0070374_105285961 | 3300005517 | Freshwater Lake | SPFGIAGSVELGTVRLNSRLDPDVEMLLKTFRRNFGLAY* |
| Ga0068885_10787461 | 3300005565 | Freshwater Lake | KQSPFGIAGTPELGTVRLASRLDPDVEALLRPMKRNNGLAV* |
| Ga0049081_100854821 | 3300005581 | Freshwater Lentic | NQSPFGIAGNTDMGTVRLAAKLDADVEALLRPLRKNNGLAV* |
| Ga0049081_103486201 | 3300005581 | Freshwater Lentic | GIAGTPELGTVRLSSRLDPDVEAFLRPMKRNNGLAV* |
| Ga0079957_10107841 | 3300005805 | Lake | ARLFVRKQSPFGIAGSVELGTVRLNSRLDPDVEMLLKTFRRNKGLAY* |
| Ga0070744_101792472 | 3300006484 | Estuarine | FVRKQSPFGIAGSVELGTVRLSSRLDPDVEMLLKTFRRNFGLAY* |
| Ga0075467_102242751 | 3300006803 | Aqueous | LFVRKQSPFGIAGSVELGTVRLNSRLDPDVEMLLKTFRRNFGLAY* |
| Ga0075464_103883211 | 3300006805 | Aqueous | QSPFGIAGTPDLGTVRLSAKLDADVEALARPFRKQNGIAK* |
| Ga0075464_105567001 | 3300006805 | Aqueous | RKQSPFGIAGSVELGTVRLTSRLDPDVEMLLKTYRRNFGLAF* |
| Ga0075472_103087841 | 3300006917 | Aqueous | KQSPFGIAGSVELGTVRLNSRLDPDVEMLLKTYRRNFGLAY* |
| Ga0075458_100462845 | 3300007363 | Aqueous | LFVRKQSPFGIAGTPELGTVRLASKLDPDVEALLRPMKRNNGLAV* |
| Ga0102690_10387941 | 3300007534 | Freshwater Lake | SPFGIAGTPEMGTVRLSAKLDPDVEALIRPFRKLTGLVK* |
| Ga0099848_10267788 | 3300007541 | Aqueous | QAARLFIRKQSPFGIAGSVELGTVRLNSRLDPDVEMLLKTFRRNKGLAY* |
| Ga0114346_11347611 | 3300008113 | Freshwater, Plankton | FGIAGSVELGTVRLNSRLDPDVEMLLKTYRRNFGLAY* |
| Ga0114351_10620721 | 3300008117 | Freshwater, Plankton | FGVAGSPDLGTVRLSSRLDPDVEILVRPFRKVSWMAK* |
| Ga0114355_10170971 | 3300008120 | Freshwater, Plankton | FGIAGSAELGTVRLSSRLDPDVEMLARPFRKLSWMAK* |
| Ga0114355_10718285 | 3300008120 | Freshwater, Plankton | RLFVRKQSPFGIAGSVELGTVRLNSRLDPDVEMLLKTYRRNFGLAY* |
| Ga0114876_12042111 | 3300008448 | Freshwater Lake | RQSPFGIAGSTDIGTVRLAAKLDADVEALLRPLRRNNGLAK* |
| Ga0114880_10412181 | 3300008450 | Freshwater Lake | RLFLRRQSPFGIAGSTDIGTVRLAAKLDADVEALLRPLRRNNGLAK* |
| Ga0114880_11678924 | 3300008450 | Freshwater Lake | PFGIAGTPDLGTVRLSSRLDPDVEALIRPFRKMNGLVA* |
| Ga0114880_12203581 | 3300008450 | Freshwater Lake | VRKQSPFGIAGSVELGTVRLNSRLDPDVEMLLKTYRRNFGLAY* |
| Ga0114880_12480991 | 3300008450 | Freshwater Lake | SPFGIAGTPDLGTVRLSSRLDPDVEALIRPFRKMNGLVA* |
| Ga0102829_11316481 | 3300009026 | Estuarine | KQSPFGIAGTPELGTVRLSSRLDPDVEAFLRPIKRNNGLAV* |
| Ga0114980_101380165 | 3300009152 | Freshwater Lake | SRLFNRRQSPFGIAGSPEMGTVRLYSRLDADVEVLLRPFRKNGGLAK* |
| Ga0114980_102165571 | 3300009152 | Freshwater Lake | QSPFGIAGSVELGTVRLNSRLDPDVEMLLKTYRRNFGLAF* |
| Ga0114981_107410762 | 3300009160 | Freshwater Lake | ASRLFVRKQSPFGIAGSVELGTVRLNSRLDPDVEMLLKTYRRNFGLAF* |
| Ga0114969_105852263 | 3300009181 | Freshwater Lake | RRQSPFGIAGTPELGTVRLTSRLDPDVEALLRPFRKNNGLAK* |
| Ga0114974_104585561 | 3300009183 | Freshwater Lake | IRKQSPFGIAGSVELGTVRLSSRLDPDVEMLLKTFRRNFGLAF* |
| Ga0129333_105686081 | 3300010354 | Freshwater To Marine Saline Gradient | FGVAGSVDTGTVRLSSRLDPDVEALVRPFKKMDGVAV* |
| Ga0133913_101302201 | 3300010885 | Freshwater Lake | KIQAARLFVRKQSPFGIAGSVELGTVRLNSRLDPDVEMLLKTFRRNFGLAY* |
| Ga0133913_115963506 | 3300010885 | Freshwater Lake | FGIAGTPDLGTVRLSAKLDADVEALTRPFRKQNGVAK* |
| Ga0119951_10314001 | 3300012000 | Freshwater | SRLFVRRQSPFGIAGTPDLGTVRLSAKLDADVEALARPFRKKNGVAK* |
| Ga0157605_12410553 | 3300012716 | Freshwater | SRIFVRRQSPFGIAGTPELGTVRLTSRLDPDVEALLRPFRKNNGLAK* |
| Ga0157606_12064753 | 3300012733 | Freshwater | IAGTPELGTVRLTSRLDPDVEALLRPFRKNNGLAK* |
| Ga0129337_13466501 | 3300012968 | Aqueous | RKQSPFGIAGSVELGTVRLNSRLDPDVEMLLKTFRRNKGLAY* |
| Ga0164292_101114976 | 3300013005 | Freshwater | FVRKQSPFGIAGSVELGTVRLNSRLDPDVEMLLKTYRRNFGLAF* |
| (restricted) Ga0172367_100448101 | 3300013126 | Freshwater | SPFGIAGSVELGTVRLNSRLDPDVEMLLKTFRRNQGLAY* |
| (restricted) Ga0172367_106090711 | 3300013126 | Freshwater | PFGIAGSVELGTVRLNSRLDPDVEMLLKTFRRNQGLAY* |
| (restricted) Ga0172364_104967643 | 3300013129 | Sediment | AGSVELGTVRLNSRLDPDVEMLLKTFRRNQGLAY* |
| (restricted) Ga0172362_105398001 | 3300013133 | Sediment | RKQSPFGIAGSVELGTVRLSSRLDPDVEMLLKTFRRNQGLAY* |
| Ga0181364_10129285 | 3300017701 | Freshwater Lake | RKQSPFGIAGSVELGTVRLNSRLDPDVEMLLKTFRRNFGLAY |
| Ga0181364_10213691 | 3300017701 | Freshwater Lake | QSPFGIAGNTDLGTVRLAAKLDADVEALLRPLRKNNGLAK |
| Ga0181364_10313504 | 3300017701 | Freshwater Lake | LFIRKQSPFGVAGSVDMGTVRLTSRLDPDVEALIRPLKKLNGVAY |
| Ga0181364_10647481 | 3300017701 | Freshwater Lake | CIIQSSRIFVRKQSPFGIAGTPELGTVRLSSRLDPDVEAFLRPIKRNNGLAV |
| Ga0181350_11520912 | 3300017716 | Freshwater Lake | SPFGIAGSVELGTVRLNSRLDPDVEMLLKTFRRNFGLAY |
| Ga0181347_11233341 | 3300017722 | Freshwater Lake | SPFGIAGSPEMGTVRLYSRLDADVEVLLRPFRKNGGLAK |
| Ga0181365_10398881 | 3300017736 | Freshwater Lake | FTRRQSPFGIAGSPDLGTVRLTAKLDADVEALLRPFRKNNGLAK |
| Ga0181358_12739531 | 3300017774 | Freshwater Lake | FGIAGSVELGTVRLNSRLDPDVEMLLKTFRRNFGLAF |
| Ga0181346_13357482 | 3300017780 | Freshwater Lake | QSPFGIAGSPEMGTVRLYSRLDADVEVLLRPFRKNGGLAK |
| Ga0211734_109198011 | 3300020159 | Freshwater | RLFVRKQSPFGIAGSVELGTVRLNSRLDPDVEMLLKTYRRNFGLAF |
| Ga0211729_114259253 | 3300020172 | Freshwater | GIAGSVELGTVRLNSRLDPDVEMLLKTYRRNFGLAF |
| Ga0194134_102193574 | 3300020179 | Freshwater Lake | FGIAGTPELGTVRLSSRLDPDVEAFLRPMKRNNGLAV |
| Ga0194124_103030614 | 3300020196 | Freshwater Lake | GIARTPELGTVRLSSRLDPDVEAFLRPMKRNNGLAV |
| Ga0194123_101725004 | 3300021093 | Freshwater Lake | GIAGTPELGTVRLSSRLDPDVEAFLRPMKRNNGLAV |
| Ga0181354_10187297 | 3300022190 | Freshwater Lake | AARLFVRKQSPFGIAGSVELGTVRLNSRLDPDVEMLLKTFRRNFGLAY |
| Ga0181354_11272864 | 3300022190 | Freshwater Lake | RLFIRRQSPFGIAGTPELGTVRLTSRLDPDVEALIRPFKKMNGLVA |
| Ga0214917_104084572 | 3300022752 | Freshwater | PFGIAGSPEMGTVRLYSRLDADVEVLLRPFRKNGGLAK |
| Ga0255150_10026081 | 3300024505 | Freshwater | IQAARLFIRKQSPFGIAGSVELGTVRLNSRLDPDVEMLLKTFRRNKGLAY |
| Ga0255232_10068601 | 3300024558 | Freshwater | IQSSRIFLRKQSPFGIAGTPELGTVRLSSRLDPDVEAFLRPMKRNNGLAV |
| Ga0256309_10432581 | 3300024566 | Freshwater | QSSRIFVRKQSPFGIAGTPELGTVRLSSRLDPDVEAFLRPIKRNNGLAV |
| Ga0208424_10262703 | 3300025445 | Aqueous | LIQSSRLFIRKQSPFGIAGTPELGTVRLSSRLDPDVEALLRPIKRNNGLAV |
| Ga0208916_100462831 | 3300025896 | Aqueous | PFGIAGAPDLGVVRLSSRLDADVEVLCRPFRRRKGVAY |
| Ga0255188_10637603 | 3300027079 | Freshwater | IAGTPELGTVRLSSRLDPDVEALLRPIKRNNGLAV |
| Ga0208800_10195261 | 3300027193 | Estuarine | GIAGSPELGTVRLTSRLDADVEALLRPFRKNNGLAK |
| Ga0209552_11747461 | 3300027563 | Freshwater Lake | LFVRKQSPFGIAGSVELGTVRLNSRLDPDVEMLLKTFRRNFGLAY |
| Ga0209651_10337195 | 3300027581 | Freshwater Lake | RKQSPFGIAGSVELGTVRLNSRLDPDVEMLLKTFRRNFGLAF |
| Ga0208133_10058891 | 3300027631 | Estuarine | EVKTAAKIQAARLFLRNQSPFGIAGNTDLGTVRLAAKLDADVEALLRPLRKNNGLAV |
| Ga0208133_10872803 | 3300027631 | Estuarine | IQAARLFVRKQSPFGIAGSVELGTVRLNSRLDPDVEMLLKTFRRNFGLAY |
| Ga0209357_10416715 | 3300027656 | Freshwater Lake | GIAGSVELGTVRLNSRLDPDVEMLLKTFRRNFGLAF |
| Ga0209357_11288083 | 3300027656 | Freshwater Lake | GIAGSVELGTVRLNSRLDPDVEMLLKTFRRNFGLAY |
| Ga0209357_11502893 | 3300027656 | Freshwater Lake | PFGIAGSVELGTVRLNSRLDPDVEMLLKTFRRNFGLAY |
| Ga0209297_13462911 | 3300027733 | Freshwater Lake | FGIAGTPELGTVRLTSRLDPDVEALLRPLRKNNGLAK |
| Ga0209355_12347261 | 3300027744 | Freshwater Lake | GRRQSPFGIAGSPEMGTVRLYSRLDADVEVLLRPFRKNGGLAK |
| Ga0209088_100183279 | 3300027763 | Freshwater Lake | KQSPFGIAGSVELGTVRLNSRLDPDVEMLLKTYRRNFGLAF |
| Ga0209246_103757942 | 3300027785 | Freshwater Lake | RRQSPFGIAGSPDLGTVRLSSRVDADVEALLRPFRKNNGLAK |
| Ga0209246_103991332 | 3300027785 | Freshwater Lake | PFGIAGSVELGTVRLNSRLDPDVEMLLKTFRRNFGLAF |
| Ga0209353_102957181 | 3300027798 | Freshwater Lake | SSRLFGRRQSPFGIAGSPEMGTVRLYSRLDADVEVLLRPFRKNGGLAK |
| Ga0209229_102782263 | 3300027805 | Freshwater And Sediment | FGIAGSVELGTVRLNSRLDPDVEMLLKTFRRNFGLAY |
| Ga0209354_100024351 | 3300027808 | Freshwater Lake | VRKQSPFGIAGSVELGTVRLNSRLDPDVEMLLKTFRRNFGLAY |
| Ga0209354_101924063 | 3300027808 | Freshwater Lake | RLFVRKQSPFGIAGSVELGTVRLNSRLDPDVEMLLKTFRRNFGLAY |
| Ga0209354_103890521 | 3300027808 | Freshwater Lake | FLRRQSPFGIAGSTDIGTVRLAAKLDADVEALLRPLRRNNGLAK |
| Ga0209298_102313093 | 3300027973 | Freshwater Lake | SRLFNRRQSPFGIAGSPEMGTVRLYSRLDADVEVLLRPFRKNGGLAK |
| (restricted) Ga0247838_10484438 | 3300028044 | Freshwater | GIAGSPDLGTVRLTAKLDADVEALLRPFRKNNGLAK |
| (restricted) Ga0247839_10504368 | 3300028553 | Freshwater | FGIAGSPDLGTVRLTAKLDADVEALLRPFRKNNGLAK |
| (restricted) Ga0247831_11272284 | 3300028559 | Freshwater | IFVRRQSPFGIAGTPELGTVRLTSRLDPDVEALLRPFRKNNGLAK |
| Ga0307377_106669053 | 3300031673 | Soil | SRIFVRKQSPFGIAGTPELGTVRLSSRLDPDVQAFLRPINRNNGLAV |
| Ga0315907_100381539 | 3300031758 | Freshwater | PFGIAGSADLGTVRLSSRLDPDVEILARPFRKVSWMAK |
| Ga0315907_106896601 | 3300031758 | Freshwater | VRKQSPFGIAGTPELGTVRLSSRLDPDVEALLRPIKRNNGLAV |
| Ga0315906_104020451 | 3300032050 | Freshwater | IAGTPELGTVRLTSRLDPDVEALLRPFRKNNGLAK |
| Ga0315905_100641848 | 3300032092 | Freshwater | LRRQSPFGIAGSTDIGTVRLAAKLDADVEALLRPLRRNNGLAK |
| Ga0315903_102135771 | 3300032116 | Freshwater | PFGIAGTPELGTVRLTSRLDPDVEALIRPFRKMSGLVA |
| Ga0334981_0080687_3_122 | 3300033980 | Freshwater | SPFGIAGSVELGTVRLNSRLDPDVEMLLKTYRRNFGLAF |
| Ga0334987_0649421_495_614 | 3300034061 | Freshwater | SPFGIAGSPDLGTVRLTAKLDADVEALLRPFRKNNGLAK |
| Ga0334995_0771951_391_528 | 3300034062 | Freshwater | LFTRRQSPFGIAGSPDLGTVRLTAKLDADVEALLRPFRKNNGLAK |
| Ga0335012_0000357_1_123 | 3300034093 | Freshwater | QSPFGIAGSVELGTVRLNSRLDPDVEMLLKTYRRNFGLAF |
| Ga0335035_0469136_558_695 | 3300034105 | Freshwater | LFLRNQSPFGIAGNTDLGTVRLAAKLDADVEALLRPLRKNNGLAV |
| Ga0335051_0427820_1_144 | 3300034109 | Freshwater | SRLFIRRQSPFGIAGTPDLGTVRLSSRLDPDVEALIRPFRKMNGLVA |
| Ga0335068_0456127_2_136 | 3300034116 | Freshwater | FVRKQSPFGIAGSVELGTVRLNSRLDPDVEMLLKTFRRNFGLAF |
| Ga0335013_0103591_1825_1956 | 3300034284 | Freshwater | LRNQSPFGIAGNTDLGTVRLAAKLDADVEAVLRPLRKNNGLAK |
| Ga0335048_0271527_3_122 | 3300034356 | Freshwater | SPFGIAGSVELGTVRLTSRLDPDVEMLLKTFRRNFGLAY |
| ⦗Top⦘ |