NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F084149

Metagenome / Metatranscriptome Family F084149

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F084149
Family Type Metagenome / Metatranscriptome
Number of Sequences 112
Average Sequence Length 105 residues
Representative Sequence MPQARGVAQAAELQKKLNGIMPQPSSGVVKWRHTLGNDWTGDPAIFFWVTLTDEASKKDNLSKATEAFRKVLCERIDFQNDWDLIPYFNFRSESEQAILNDEVYA
Number of Associated Samples 93
Number of Associated Scaffolds 112

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 23.21 %
% of genes near scaffold ends (potentially truncated) 44.64 %
% of genes from short scaffolds (< 2000 bps) 82.14 %
Associated GOLD sequencing projects 86
AlphaFold2 3D model prediction Yes
3D model pTM-score0.69

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.214 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil
(15.179 % of family members)
Environment Ontology (ENVO) Unclassified
(47.321 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(44.643 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 39.85%    β-sheet: 20.30%    Coil/Unstructured: 39.85%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.69
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 112 Family Scaffolds
PF04255DUF433 5.36
PF15919HicB_lk_antitox 1.79
PF12891Glyco_hydro_44 1.79
PF12704MacB_PCD 1.79
PF00141peroxidase 0.89
PF07690MFS_1 0.89
PF04085MreC 0.89
PF03379CcmB 0.89
PF00069Pkinase 0.89
PF03783CsgG 0.89
PF07719TPR_2 0.89
PF01293PEPCK_ATP 0.89
PF12543DUF3738 0.89
PF01011PQQ 0.89
PF13692Glyco_trans_1_4 0.89
PF02522Antibiotic_NAT 0.89
PF13744HTH_37 0.89
PF01566Nramp 0.89
PF13604AAA_30 0.89
PF02463SMC_N 0.89
PF00318Ribosomal_S2 0.89
PF04191PEMT 0.89
PF00583Acetyltransf_1 0.89
PF00196GerE 0.89

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 112 Family Scaffolds
COG2442Predicted antitoxin component of a toxin-antitoxin system, DUF433 familyDefense mechanisms [V] 5.36
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.57
COG0052Ribosomal protein S2Translation, ribosomal structure and biogenesis [J] 0.89
COG0376Catalase (peroxidase I)Inorganic ion transport and metabolism [P] 0.89
COG1462Curli biogenesis system outer membrane secretion channel CsgGCell wall/membrane/envelope biogenesis [M] 0.89
COG1792Cell shape-determining protein MreCCell cycle control, cell division, chromosome partitioning [D] 0.89
COG1866Phosphoenolpyruvate carboxykinase, ATP-dependentEnergy production and conversion [C] 0.89
COG1914Mn2+ or Fe2+ transporter, NRAMP familyInorganic ion transport and metabolism [P] 0.89
COG2386ABC-type transport system involved in cytochrome c biogenesis, permease componentPosttranslational modification, protein turnover, chaperones [O] 0.89
COG2746Aminoglycoside N3'-acetyltransferaseDefense mechanisms [V] 0.89


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.21 %
UnclassifiedrootN/A1.79 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000567|JGI12270J11330_10011067All Organisms → cellular organisms → Bacteria5984Open in IMG/M
3300001870|JGI24129J20441_1053600All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4873Open in IMG/M
3300004092|Ga0062389_100969444All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41034Open in IMG/M
3300004092|Ga0062389_100994754All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41023Open in IMG/M
3300004466|Ga0068982_1080950All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4503Open in IMG/M
3300004470|Ga0068967_1246815All Organisms → cellular organisms → Bacteria1101Open in IMG/M
3300004603|Ga0068918_1240003All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4525Open in IMG/M
3300004605|Ga0068952_1241330All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4679Open in IMG/M
3300004615|Ga0068926_1084754All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4640Open in IMG/M
3300004965|Ga0072321_1104640All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4526Open in IMG/M
3300004973|Ga0072322_1138005All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4959Open in IMG/M
3300005944|Ga0066788_10010799All Organisms → cellular organisms → Bacteria1920Open in IMG/M
3300006640|Ga0075527_10045697All Organisms → cellular organisms → Bacteria1179Open in IMG/M
3300009029|Ga0066793_10190494All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41194Open in IMG/M
3300009623|Ga0116133_1069496All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4879Open in IMG/M
3300009628|Ga0116125_1076784All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4874Open in IMG/M
3300009628|Ga0116125_1187309All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4585Open in IMG/M
3300009661|Ga0105858_1255489All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4535Open in IMG/M
3300009662|Ga0105856_1054022All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41129Open in IMG/M
3300010341|Ga0074045_10195496All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41357Open in IMG/M
3300010379|Ga0136449_100398752All Organisms → cellular organisms → Bacteria2443Open in IMG/M
3300011054|Ga0138523_1104838All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4753Open in IMG/M
3300011066|Ga0138524_1056294All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4537Open in IMG/M
3300011069|Ga0138592_1022130All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4967Open in IMG/M
3300011083|Ga0138560_1106717All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4555Open in IMG/M
3300012350|Ga0137372_10575145All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4829Open in IMG/M
3300014152|Ga0181533_1243815All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4672Open in IMG/M
3300014155|Ga0181524_10019692All Organisms → cellular organisms → Bacteria4993Open in IMG/M
3300014159|Ga0181530_10014887All Organisms → cellular organisms → Bacteria6363Open in IMG/M
3300014169|Ga0181531_10200820All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41211Open in IMG/M
3300014200|Ga0181526_10554998All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4726Open in IMG/M
3300014200|Ga0181526_10948413All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4541Open in IMG/M
3300014491|Ga0182014_10234498All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4972Open in IMG/M
3300014492|Ga0182013_10077493All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae2345Open in IMG/M
3300014492|Ga0182013_10119719All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41727Open in IMG/M
3300014492|Ga0182013_10251548Not Available1022Open in IMG/M
3300014493|Ga0182016_10109209All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41940Open in IMG/M
3300014498|Ga0182019_11164658All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4565Open in IMG/M
3300014499|Ga0182012_10098218All Organisms → cellular organisms → Bacteria → Acidobacteria2205Open in IMG/M
3300014501|Ga0182024_10206939All Organisms → cellular organisms → Bacteria2675Open in IMG/M
3300014655|Ga0181516_10174839All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41089Open in IMG/M
3300014655|Ga0181516_10577105All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4579Open in IMG/M
3300014839|Ga0182027_10137677All Organisms → cellular organisms → Bacteria2890Open in IMG/M
3300017946|Ga0187879_10330208All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4846Open in IMG/M
3300017948|Ga0187847_10749163All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4551Open in IMG/M
3300017955|Ga0187817_10788418All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4607Open in IMG/M
3300017988|Ga0181520_10309020All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41180Open in IMG/M
3300018033|Ga0187867_10262178All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4972Open in IMG/M
3300018034|Ga0187863_10088052All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41744Open in IMG/M
3300018034|Ga0187863_10323057All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4858Open in IMG/M
3300018035|Ga0187875_10326937All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4827Open in IMG/M
3300018037|Ga0187883_10293258All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4831Open in IMG/M
3300018038|Ga0187855_10224643All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41105Open in IMG/M
3300018042|Ga0187871_10006002All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus8822Open in IMG/M
3300018042|Ga0187871_10606976All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4607Open in IMG/M
3300018043|Ga0187887_10131153All Organisms → cellular organisms → Bacteria → Proteobacteria1504Open in IMG/M
3300018043|Ga0187887_10736517All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4582Open in IMG/M
3300018044|Ga0187890_10321809All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4868Open in IMG/M
3300018046|Ga0187851_10349655All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4850Open in IMG/M
3300018047|Ga0187859_10424623All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4732Open in IMG/M
3300019242|Ga0181502_1181564All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4575Open in IMG/M
3300019275|Ga0187798_1893634All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4524Open in IMG/M
3300023088|Ga0224555_1174617All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4606Open in IMG/M
3300025725|Ga0209638_1060170All Organisms → cellular organisms → Bacteria1498Open in IMG/M
3300025878|Ga0209584_10442791All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4502Open in IMG/M
3300026215|Ga0209849_1007282All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41789Open in IMG/M
3300026221|Ga0209848_1088986All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4539Open in IMG/M
3300027497|Ga0208199_1000424All Organisms → cellular organisms → Bacteria → Acidobacteria17297Open in IMG/M
3300027667|Ga0209009_1142300All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4610Open in IMG/M
3300027854|Ga0209517_10589080All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4591Open in IMG/M
3300027898|Ga0209067_10911239All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4517Open in IMG/M
3300028445|Ga0189899_104242All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4676Open in IMG/M
3300029911|Ga0311361_11370210All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4546Open in IMG/M
3300029915|Ga0311358_10510704All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4934Open in IMG/M
3300029943|Ga0311340_10003305All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus22125Open in IMG/M
3300029945|Ga0311330_11158213Not Available562Open in IMG/M
3300029951|Ga0311371_11603525All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter717Open in IMG/M
3300029953|Ga0311343_11345986All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4535Open in IMG/M
3300029954|Ga0311331_10911377All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4775Open in IMG/M
3300029999|Ga0311339_10186347All Organisms → cellular organisms → Bacteria2372Open in IMG/M
3300029999|Ga0311339_10414489All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41400Open in IMG/M
3300030000|Ga0311337_11506174All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4590Open in IMG/M
3300030519|Ga0302193_10451136All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4643Open in IMG/M
3300031090|Ga0265760_10174525All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4715Open in IMG/M
3300031232|Ga0302323_102384636All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4603Open in IMG/M
3300031234|Ga0302325_11088366All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41079Open in IMG/M
3300031234|Ga0302325_11161552All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41032Open in IMG/M
3300031234|Ga0302325_12432180All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4628Open in IMG/M
3300031238|Ga0265332_10283094All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium685Open in IMG/M
3300031524|Ga0302320_12162191All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4515Open in IMG/M
3300031525|Ga0302326_10026857All Organisms → cellular organisms → Bacteria11622Open in IMG/M
3300031525|Ga0302326_13058863All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4569Open in IMG/M
3300031708|Ga0310686_107978416All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus7253Open in IMG/M
3300031708|Ga0310686_113954913All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales590Open in IMG/M
3300031708|Ga0310686_118159984All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA42971Open in IMG/M
3300031711|Ga0265314_10057867All Organisms → cellular organisms → Bacteria2659Open in IMG/M
3300031726|Ga0302321_103439617All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4515Open in IMG/M
3300031788|Ga0302319_10733710All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4994Open in IMG/M
3300032160|Ga0311301_10616423All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41558Open in IMG/M
3300032515|Ga0348332_14508586All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4866Open in IMG/M
3300032783|Ga0335079_10129686All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA42843Open in IMG/M
3300032805|Ga0335078_10281994All Organisms → cellular organisms → Bacteria2245Open in IMG/M
3300032805|Ga0335078_10583725All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41414Open in IMG/M
3300032805|Ga0335078_12718691All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4504Open in IMG/M
3300032828|Ga0335080_10622439All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41133Open in IMG/M
3300032828|Ga0335080_10989516All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4857Open in IMG/M
3300032892|Ga0335081_10475610All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41580Open in IMG/M
3300032895|Ga0335074_10041993All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales6352Open in IMG/M
3300033158|Ga0335077_10325213All Organisms → cellular organisms → Bacteria1674Open in IMG/M
3300033158|Ga0335077_10603552All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41145Open in IMG/M
3300034065|Ga0334827_122311All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4835Open in IMG/M
3300034282|Ga0370492_0029762All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella arctica2246Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil15.18%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland14.29%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil8.93%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog8.04%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa8.04%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog7.14%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog5.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.57%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil3.57%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.68%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil2.68%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen2.68%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.79%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen1.79%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil1.79%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.79%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.79%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.89%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.89%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.89%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.89%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.89%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.89%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.89%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.89%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.89%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000567Peat soil microbial communities from Weissenstadt, Germany - SII-2010EnvironmentalOpen in IMG/M
3300001870Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-211EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004466Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 80 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004470Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 59 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004603Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004605Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 40 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004615Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 11 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004965Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 17 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004973Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 19 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005944Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048EnvironmentalOpen in IMG/M
3300006640Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11BEnvironmentalOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300009628Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10EnvironmentalOpen in IMG/M
3300009661Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062EnvironmentalOpen in IMG/M
3300009662Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011054Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 1 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011066Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 3 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011069Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 19 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011083Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 45 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300014152Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaGEnvironmentalOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014159Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014499Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014655Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaGEnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300019242Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019275Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023088Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 30-34EnvironmentalOpen in IMG/M
3300025725Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-211 (SPAdes)EnvironmentalOpen in IMG/M
3300025878Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes)EnvironmentalOpen in IMG/M
3300026215Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes)EnvironmentalOpen in IMG/M
3300026221Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062 (SPAdes)EnvironmentalOpen in IMG/M
3300027497Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027667Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028445Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 61 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300029911III_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029915III_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029945I_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300029953II_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029954I_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030000I_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300030519Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_3EnvironmentalOpen in IMG/M
3300031090Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031238Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaGHost-AssociatedOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031711Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaGHost-AssociatedOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300034065Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5EnvironmentalOpen in IMG/M
3300034282Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12270J11330_1001106743300000567Peatlands SoilMPQARGVAQAAELQKKLNGIMPQPSSGVVKWRHTLGNDWTGDPAIFFWVTLTDEASKKDNLSKATEAFRKVLCERIDFQNDWDLIPYFNFRSESEQAILNDEVYA*
JGI24129J20441_105360023300001870Arctic Peat SoilMSPQPSIAHYRMTSKLGEAVVKWYSETGMPQARGVAQAAELQKKLNGIMPQPSLGVVKWRHTFGNDWTGDPAIFFWVTLTDEASKKGNLSKATEAFRKVLCERIDFQNDWDLIPYFNFRSESEQAILNDEVYA*
Ga0062389_10096944413300004092Bog Forest SoilMPKPSPGVVKWRHTFDSDWSGDPAIFFWVTLTDDASKKANLSKATTSFRKAITDRIDFLNDWGLIPYFNFRSESERAKLKDEV*
Ga0062389_10099475423300004092Bog Forest SoilMAYLAKGIAHAADLQIRLNGIMPTPSPGVMKWRHTFGSDWSGDPAIFFWVTLTDDASKKANLSKATAAFTKAINDHIDFLNDWGLIPYFHFRSESEQAKLKDEVYA*
Ga0068982_108095013300004466Peatlands SoilRGVAQAAELQKKLNGIMPQPSSGVVKWRHTLGNDWTGDPAIFFWVTLTDEASKKDNLSKATEAFRKVLCERIDFQNDWDLIPYFNFRSESEQAILNDEVYA*
Ga0068967_124681533300004470Peatlands SoilARGVAQAAELQKKLNGIMPQPSSGVVKWRHTLGNDWTGDPAIFFWVTLTDEASKKDNLSKATEAFRKVLCERIDFQNDWDLIPYFNFRSESEQAILNDEVYA*
Ga0068918_124000313300004603Peatlands SoilKLNGIMPQPSSGVVKWRHTLGNDWTGDPAIFFWVTLTDEASKKDNLSKATEAFRKVLCERIDFQNDWDLIPYFNFRSESEQAILNDEVYA*
Ga0068952_124133013300004605Peatlands SoilAGGVAQAAELQKKLNGIMPQPSSGVVKWRHTLGNDWTGDPAIFFWVTLTDEASKKDNLSKATEAFRKVLCERIDFQNDWDLIPYFNFRSESEQAILNDEVYA*
Ga0068926_108475413300004615Peatlands SoilQKKLNGIMPQPSSGVVKWRHTLGNDWTGDPAIFFWVTLTDEASKKDNLSKATEAFRKVLCERIDFQNDWDLIPYFNFRSESEQAILNDEVYA*
Ga0072321_110464023300004965Peatlands SoilRGVAQAADLQKKLNGIMPQPSSGVVKWRHTLGNDWTGDPAIFFWVTLTDEASKKDNLSKATEAFRKVLCERIDFQNDWDLIPYFNFRSESEQAILNDEVYA*
Ga0072322_113800513300004973Peatlands SoilPQARGVAQAAELQKKLNGIMPQPSSGVVKWRHTLGNDWTGDPAIFFWVTLTDEASKKDNLSKATEAFRKVLCERIDFQNDWDLIPYFNFRSESEQAILNDEVYA*
Ga0066788_1001079943300005944SoilMLRARGVAQVTELQKKLNGIMPQPSPGVVKWRHTFGNDWTGDPAIFFWVTLTDEASRKDNLSKATEAFRNVLSERIDFQNDWDLIPYFNFRSESEQAILSDEVYA*
Ga0075527_1004569713300006640Arctic Peat SoilMPQARGVAQAAELQKKLNGIMPQPSLGVVKWRHTFGNDWTGDPAIFFWVTLTDEASKKGNLSKATEAFRKVLCERIDFQNDWDLIP
Ga0066793_1019049433300009029Prmafrost SoilGMPRARGVAQAAELQKKLNGIMPQPSLGVVKWRHTFGNDWTGDPAIFFWVTLTDEASKKGNLSNATEAFRKVLCEPIDFQNDWDLIPYFNFRSESEQAILNDEVYA*
Ga0116133_106949623300009623PeatlandGIMPQPSPGVVKWRHTFGNDWTGDPAIFFWVTLTDEASKKDNLLNATEAFRKALDEHIDFQNDWELIPYFSFRSESEQAILKGEVYA*
Ga0116125_107678413300009628PeatlandMPQARGVAHAAELQKKLNGIMPQPSPGVVKWRHTFGNDWTGDPAIFFWVTLTDEASKKDNLSKATEAFRKALSKRIDFQNEWDLIPYFNFRSESEQAILNDEVYA*
Ga0116125_118730913300009628PeatlandMPQPSPGVVKLRHTFDNDWTGDPAIFFWVTLTDEASRKDNLLKTTEAFRKVLSERIDFQNDWDLIPYFSFRSESEQAILKGEVYA*
Ga0105858_125548923300009661Permafrost SoilMLRARGVAQATELQKKLNGIMPQPSPGVVKWRHTFGNDWTGDPEIFFWVTLTDEASRKDNLSKATEAFRNVLSERIDFQNDWDLIPYFNFRSESEQAILSDEVYA*
Ga0105856_105402213300009662Permafrost SoilMPRARGVAQAAELQKKLNGIMPQPSPGVVKLRHTFGNDWTGDPAIFFWVTLTDEASRKDNLSKATEAFRNVLSERIDFQNDWDLIPYFNFRSESEQAILSDEVYA*
Ga0074045_1019549633300010341Bog Forest SoilMPRARGVAQAAELQTKLNGIMPQPSPGVVKWRHTFGNDWTGDPAIFFWVTLTDEASKKDNLSKATEAFRKALGERIDFQDDWDLIPYFNFRSESEQAALNDEVYA*
Ga0136449_10039875233300010379Peatlands SoilMPRARGVAQAAELQKKLNGIMPQPSPGVVKWRHTFGNDWTGDPAIFFWVTLTDEASKKDNLSKATEAFRQLLCDRIDFQNDWDLIPYFNFRSESEQAILNDEVYA*
Ga0138523_110483813300011054Peatlands SoilGVAQAAELQKKLNGIMPQPSSGVVKWRHTLGNDWTGDPAIFFWVTLTDEASKKDNLSKATEAFRKVLCERIDFQNDWDLIPYFNFRSESEQAILNDEVYA*
Ga0138524_105629423300011066Peatlands SoilAQAAELQKKLNGIMPQPSSGVVKWRHTLGNDWTGDPAIFFWVTLTDEASKKDNLSKATEAFRKVLCERIDFQNDWDLIPYFNFRSESEQAILNDEVYA*
Ga0138592_102213013300011069Peatlands SoilVMPQARGVAQAAELQKKLNGIMPQPSSGVVKWRHTLGNDWTGDPAIFFWVTLTDEASKKDNLSKATEAFRKVLCERIDFQNDWDLIPYFNFRSESEQAILNDEVYA*
Ga0138560_110671713300011083Peatlands SoilQARGVAQAAELQKKLNGIMPQPSSGVVKWRHTLGNDWTGDPAIFFWVTLTDEASKKDNLSKATEAFRKVLCERIDFQNDWDLIPYFNFRSESEQAILNDEVYA*
Ga0137372_1057514523300012350Vadose Zone SoilPELTRKAVVKWYSEIGMRRARGVAQAVELQKKLNGIMPQPSPGVVKWRHTFGNDWTGDPAIFFWVTLTDEASKKDNLSKATEAFRKVLCERIDFQNDWDLIPYFNFRSESEQAILNGEVYA*
Ga0181533_124381513300014152BogKRGAAPGMPRTTTGINAENLRETWRQPENVGLPELTREAVVKWYSETGMPRARGVAQAAELQKKLNGIMPQPSSGVVKWRHTFGNDWAGDPAIFFWVTLTDEASKKDNLSKATEDFRKVLCERIDFQNDWDLIPYFNFRSESEQAILKDEVYA*
Ga0181524_1001969243300014155BogMPRTTTGINAENLRETWRQPENVGLPELTREAVVKWYSETGMPRARGVAQAAELQKKLNGIMPQPSSGVVKWRHTFGNDWAGDPAIFFWVTLTDEASKKDNLSKATEDFRKVLCERIDFQNDWDLIPYFNFRSESEQAILKDEVYA*
Ga0181530_1001488773300014159BogMPRARGVAQAAELQKKLNGIMPQPSSGVVKWRHTFGNDWAGDPAIFFWVTLTDEASKKDNLSKATEDFRKVLCERIDFQNDWDLIPYFNFRSESEQAILKDEVYA*
Ga0181531_1020082033300014169BogMPRARGVAQAAELQKKLNGIMPQPSPGVVKLRHTFDNDWTGDPAIFFWVTLTDEASKRDNLLKATDAFMKALHECIDFQNDWDLIPYFSFRSESEQAILKGEVYA*
Ga0181526_1055499813300014200BogMHRARGVAQAAELQKQLNGIMPQPSPGVVKWRHTFGNDWAGDPAIFFWVTLTDESSKKDNLLKATQAFQNVLDARIDFQNDWDLIPYFNFRSESEQAVLKDEVYA*
Ga0181526_1094841323300014200BogPQPSPGVVKLRQTFDNDWTGDPAIFFWVTLTDEASKKDNLLKATEAFMKALDEHIDFQNDWDLIPYFSFRSESEQAILKGEVYA*
Ga0182014_1023449823300014491BogAARGTVVKWYSETGMPRARGVAQAAELQTKLNGIMPQPSPGVVKWRHTFGNDWTGDPAIFFWVTLTDEASKKDNLSKATEAFRKVLGERIDFQNDWDLIPYFNFRSESEQAALNDEVYA*
Ga0182013_1007749323300014492BogMPRARGVAQAAELQKKLNGIRPQPSSGVVKWRHTFGNDWTGDPAIFFWVTLTDEASKKGNLSKATEAFRKVLCERIDFQNDWDLIPYFNFRSESEQAILNDEVYA*
Ga0182013_1011971933300014492BogMPRARGVAQAAELQKQLNGILPQPSAGVVKWRHTFGNDWAGDPAIFFWVTLTDEASKKDNLLKATQAFQNVLDERIDFRDDWDLIPYFNFRSESEQAVLKGEVYA*
Ga0182013_1025154813300014492BogGIAQAAELQKKLNGIMPHPSPGVVKWRHTFANDWAGDPAIFFWVTLTDEASKKDKLSQTTEGFKNVLSGIDFQNDWDLIPYFNFRSESEQALLKDEVYA*
Ga0182016_1010920943300014493BogMSRARGVAQAAELQKELNGVMPQPSLGVVKWRHTFGNDWTGDPAIFFWVTLTDEASKKENLSRATEEFRKVLCEQIDFQNDWDLIPYFNFRSQSEQAVLNDEVYA*
Ga0182019_1116465813300014498FenAELQKKLNGILPQPSPGVVKWRHTFGNDWTGDPAIFFWVTLTDEASKKADLSKATEGFRKALCERIDFQNDWDLIPYFNFRSESEQAILNDEVYA*
Ga0182012_1009821833300014499BogLRRLQKQLNGILPQPSAGVVKWRHTFGNDWAGDPAIFFWVTLTDEASKKDNLLKATQAFQNVLDERIDFRDDWDLIPYFNFRSESEQAVLKGEVYA*
Ga0182024_1020693923300014501PermafrostLPSGILVLEMPLLARGIAHSAELQAKFNAILPQPIPGAVKWRHSIDRDWSGDPAIFFWVTLTDEASKKENLSRTTSAFTKLLTDRIDFQNDWDLIPYFNFRSESEQAKIQDEDYA*
Ga0181516_1017483923300014655BogMPQPSPGVVKWRHTFGNDWTGDPAIFFWVTLTDEASKRDNLSRATESFRKVLCERIDFQNDWDLIPYFNFRSESEQAILNDEVYA*
Ga0181516_1057710513300014655BogMPRARGVAQAAELQKQLNGITPQPSPGVVKWRHTFGNDWAGDPAIFFWVTLTDESSKKDNLLKATQAFQNVLDARIDFQNDWDLIPYFNFRSESEQAVLKDEVYA*
Ga0182027_1013767723300014839FenMPRARGVAQADELQKELNGIMPQPSPGVVKWRHTFGNDWTGDPAIFFWVTLTDEASKKDNLLKATTAFMNELDRRIDFQNDWDLIPYFSFRSESEQAILKGEVYA*
Ga0187879_1033020823300017946PeatlandMPRARGVAHAAELQKKLNGIMPQPSPGVVKWRYTFGNDWTGDAAIFFWVTLTDEASKKDNLLNATEAFRKALDEHIDFQNDWELIPYFSFRSESEQAILKGEVYA
Ga0187847_1074916323300017948PeatlandAQAPELQKKLNGIVPQPSPGVVKWRHTFGNDWTGEPAIFFWVTLTDEASKRDNLSRATESFRKVLCERIDFQNDWDLIPYFNFRSESEQAILNDEVYA
Ga0187817_1078841813300017955Freshwater SedimentMLRARGVAQAAELQKKLNGIMPQPSPGVVKWRHTFGNDWTGDPAIFFWVTLTDEASKKDNLAKATEDFRKVLCEHIDFQNDWDLIPYFNFRSESEQAILNDEVYA
Ga0181520_1030902013300017988BogMPRARGVAQAAELQVKLNGIMPQPSPGVVKWRHTFGNDWTGDPAIFFWVTLTDEASKKDNLSRATEAFRNELGKRIDFQNDWDLIPYFNFRSESEQAVLKDEVYA
Ga0187867_1026217823300018033PeatlandMPQPSPGVVKWRHTFGNDWTGEPAIFFWVTLTDEASKKDNLSKATEAFRNEFGRRVDFQNDWDPIPYFNFRSESEQAILNDEVYA
Ga0187863_1008805223300018034PeatlandMPQARGVAHAAELQKKLNGIMPQPSPGVVKWRHTFGNDWTGDPAIFFWVTLTDEASKKDNLSKATEAFRNEFGRRVDFQNDWDLIPYFNFRSESEQAILKDEVYA
Ga0187863_1032305723300018034PeatlandMPRARGVAHAAELQKKLNGIMPQPSPGVVKWRYTFGNDWTGDAAIFFWVTLTDEASKKDNLLNATEAFRKALDEHIDFQNDWDLIPYFSFRSESEQAILKGEVYA
Ga0187875_1032693723300018035PeatlandMPRARGVAHAAELQKKLNGIMPQPSPGVVKWRHTFGNDWTGDPAIFFWVTLTDEASKKDNLSKATEAFRNEFGRRVDFQNDWDLIPYFNFRSESEQAILKGEVYA
Ga0187883_1029325813300018037PeatlandMPQARGVAHAAELQKKLNGIMPQPSPGVVKWRYTFGNDWTGDPAIFFWVTLTDEASKKDNLLNATEAFRKALDEHIDFQNDWELIPYFSFRSESEQAILKGEVYA
Ga0187855_1022464313300018038PeatlandMPQARGVAHAAELQKKLNSIMPQPRPGVVKWRHTFGNDWTGDPAIFFWVTLTDEASKKDNLLKATEAFMKALDEHIDFQNDWDLIPYFSFRSESEQAILKGEVYA
Ga0187871_1000600263300018042PeatlandMPQARGVAHAAELQKKLNGIMPQPSPGVVKLRHTFDNDWTGDPAIFFWVTLTDEASKKDNLLKATEAFMKALDEHIDFQNDWDLIPYFSFRSESEQAILKGEVYA
Ga0187871_1060697613300018042PeatlandMPRARGVAHAAELQKKLNGIMPQPSPGVVKWRYTFGNDWTGDAAIFFWVTLTDEASKKDNLLNATEAFRKALDEHIDFQNDWELIPYFSFRSESEQAI
Ga0187887_1013115333300018043PeatlandVSQLFKWYSETAMPRARGVAQAAELRKKLNGIMPQPSPGVVRWRHTFGNDWTGDPAIFFWVTLTDEASKRDNLSKATEAFRKVLGERVDFQNDWDLIPYFNFRSESEQAVLKDEVYA
Ga0187887_1073651713300018043PeatlandMPQARGVAHAAELQKKLNGIMPQPSPGVVKWRHTFGNDWTGDPAIFFWVTLTDEASKTDNLSKATEAFRQILYECIDFQNDWDLIPYFNFRSESEQAILKDEVYA
Ga0187890_1032180923300018044PeatlandEVAVKWYSETAMPRARGVAQAGELQKKLNGIMPQPSPGVVKWRHTFGNDWTGDPAIFFWVTLTDEASKRDNLSRATESFRKVLCERIDFQNDWDLIPYFNFRSESEQAILNDEVYA
Ga0187851_1034965523300018046PeatlandMPQARGVAHAAELQKKLNGIMPQPSPGVVKWRHTFGNDWTGDPAIFFWVTPTDEASKKDNLSKATEAFRNVLCDRIDFQNDWDLIPYFNFRSESEQAVLKDEVYA
Ga0187859_1042462313300018047PeatlandMPQARGVAHAAELQKKLNGIMPQPSPGVVKWRHTFGNDWTGDPAIFFWVTLTDEASTKDNLLRATEAFMKALDEHIDFQNDWDLIPYFSFRSESEQAILKGEVYA
Ga0181502_118156413300019242PeatlandRARGVAQAAELQKQLNGIMPQPSPGVVKWRHTFGNDWAGDPAIFFWVTLTDESSKKDNLLKATQAFQNVLDARIDFQNDWDLIPYFNFRSESEQAVLKDEVYA
Ga0187798_189363413300019275PeatlandRARGIAQAAELQKQLNGILPQPSPGVVKWRHTFGNDWAGDPAIFFWVTLTDNASEKDNLSKTTEGFKKVLSERIDFQNDWDLIPYFNFRSESEQALLKDEVYA
Ga0224555_117461723300023088SoilPEITREVAVRWYSETAMPRARGVAQADELQKELNGIMPQPSPGVVKWRHTFGNDWTGDPAIFFWVTLTDEASKKDNLLKATTAFMNELDRRIDFQNDWDLIPYFSFRSESEQAILKGEVY
Ga0209638_106017023300025725Arctic Peat SoilMSPQPSIAHYRMTSKLGEAVVKWYSETGMPQARGVAQAAELQKKLNGIMPQPSLGVVKWRHTFGNDWTGDPAIFFWVTLTDEASKKGNLSKATEAFRKVLCERIDFQNDWDLIPYFNFRSESEQAILNDEVYA
Ga0209584_1044279113300025878Arctic Peat SoilQPSSGVVKWRHTFGNDWTGDPAIFFWVTLTDEASKKGNLSKATEAFRKVLCERIDFQNDWDLIPYFNFRSESEQAILNDEVYA
Ga0209849_100728243300026215SoilMLRARGVAQVTELQKKLNGIMPQPSPGVVKWRHTFGNDWTGDPAIFFWVTLTDEASRKDNLSKATEAFRNVLSERIDFQNDWDLIPYFNFRSESEQAILSDEVYA
Ga0209848_108898623300026221Permafrost SoilGLRSRNSREAVVKWYSEIGMLRARGVAQATELQKKLNGIMPQPSPGVVKWRHTFGNDWTGDPAIFFWVTLTDEASRKDNLSKATEAFRNVLSERIDFQNDWDLIPYFNFRSESEQAILSDEVYA
Ga0208199_100042493300027497Peatlands SoilMPQARGVAQAAELQKKLNGIMPQPSSGVVKWRHTLGNDWTGDPAIFFWVTLTDEASKKDNLSKATEAFRKVLCERIDFQNDWDLIPYFNFRSESEQAILNDEVYA
Ga0209009_114230013300027667Forest SoilMAYLAKGIAHAADLQTELNGIMPKPSPGVVKWRYAFGSDWSGDPAIFFWVTLTDDASKKADLSKATASFRKAITDRIDFLNDWGLIPYFNFRSESEQAKLKDEVYA
Ga0209517_1058908013300027854Peatlands SoilMPRARGVAQAAELQKKLNGIMPQPSPGVVKWRHTFGNDWTGDPAIFFWVTLTDEASKKDNLSKATEAFRQLLCDRIDFQNDWDLIPYFNFRSESEQAILNDEVYA
Ga0209067_1091123923300027898WatershedsARTGEAVVQWYSETGMPQARGVAQAAELQKKLNSIMPQPSSGVVKWRHTFGNDWTGDPAIFFWVTLTDEASKKSNLSKATEAFRKVLCERIDFQNDWDLIPYFNFRSESEQAILNDEVYA
Ga0189899_10424223300028445Peatlands SoilRGVAQAAELQKKLNGIMPQPSSGVVKWRHTLGNDWTGDPAIFFWVTLTDEASKKDNLSKATEAFRKVLCERIDFQNDWDLIPYFNFRSESEQAILNDEVYA
Ga0311361_1137021023300029911BogIVGWYSETAMSRARGVAQAAELQTELNGVMPQPSLGVVKWRHTFGNDWTGDPAIFFWVTLTDEASKKENLSRATEEFRKVLCEQIDFQNDWDLIPYFNFRSQSEQAVLNDEVYA
Ga0311358_1051070423300029915BogLGTVRVGLTELAREAIVGWYSETAMSRARGVAQAAELQKELNGVMPQPSLGVVKWRHTFGNDWTGDPAIFFWVTLTDEASKKENLSRATEEFRKVLCEQIDFQNDWDLIPYFNFRSQSEQAVLNDEVYA
Ga0311340_10003305163300029943PalsaMPRARGVAQAAELQKKLNGIMLQPSSGVVKWRHSFGNDWTGDPAIFFWVTLTDEASKKDNLSKATETFRKVLCERIDFQNDWDLIPYFNFRSESEQAILKDEVYA
Ga0311330_1115821313300029945BogLGTVRVGLTELAREAIVGWYSETAMSRARGVAQAAELQKELNGVMPQPSLGVVKWRHTFGNDWTGDPAIFFWVTLTDEASKKENLSRATEEFRKVLCEQIDFQNDWDLIPYFNFR
Ga0311371_1160352523300029951PalsaISMIRARGVAHAAELQKKLNGIMPQPSPGVVKWRHTFGDDWSGDPAIFFWVTLSDEASKRENLLNASEAFRKAIDEQIDFENDWDLIPYFRFRSESEQAILKGEAYA
Ga0311343_1134598613300029953BogPAAVSRALGTVRVGLTELAREAIVGWYSETAMSRARGVAQAAELQKELNGVMPQPSLGVVKWRHTFGNDWTGDPAIFFWVTLTDEASKKENLSRATEEFRKVLCEQIDFQNDWDLIPYFNFRSQSEQAVLNDEVYA
Ga0311331_1091137723300029954BogAELQTELNGVMPQPSLGVVKWRHTFGNDWTGDPAIFFWVTLTDEASKKENLSRATEEFRKVLCEQIDFQNDWDLIPYFNFRSQSEQTVLNDEVYA
Ga0311339_1018634753300029999PalsaMPRARGVAQAAELQKKLNGIMPQPSSGVVKWRHSFGNDWTGDPAIFFWVTLTDEASKKDNLSKATETFRKVLCERIDFQNDWDLIPYFNFRSESEQAILKDEVYA
Ga0311339_1041448933300029999PalsaMIRARGVAHAAELQKKLNGIMPQPSPGVVKWRHTFGDDWSGDPAIFFWVTLSDEASKRENLLNASEAFRKAIDEQIDFENDWDLIPYFRFRSESEQAILKGEAYA
Ga0311337_1150617423300030000FenGFGQTVDLQERLNRIGTQPTPGVAKWRYTFGNDWAGDPAIFFWVTLTDEESRKDRLAPATEAFRKLISNQIDFQNDWDLIPYFSFRSESEQAVLNDEVYA
Ga0302193_1045113613300030519BogTVRVGLTELAREAIVGWYSETAMSRARGVAQAAELQKELNGVMPQPSLGVVKWRHTFGNDWTGDPAIFFWVTLTDEASKKENLSRATEEFRKVLCEQIDFQNDWDLIPYFNFRSQSEQAVLNDEVYA
Ga0265760_1017452513300031090SoilMPQLARGIAQAADLQKKLNGIMPQPIPGVVKWRHTFGNDWSGDPAIFFWVTLTDEASKKENLSGTTSAFNNLITGRVDFQNDWDLIPYFHFRSESEQAKLQDEVYA
Ga0302323_10238463623300031232FenVAKWRYTFGNDWAGDPAIFFWVTLTDEESRKDRLAPATEAFRKLISNQIDFQNDWDLIPYFSFRSESEQAVLNDEVYA
Ga0302325_1108836633300031234PalsaMAYLVKGIAHAADLQIMLNGIMPKPSPGVVKWRHTFGSDWSGDPAIFFWVTLSDEASKKANLSNATAAFTKAITDRIDFLNDWGLIPYFNYRSESEQTKLQDEVYARSLHDLIDAFF
Ga0302325_1116155223300031234PalsaMPQARGVAHAAELQKKLNSIMLQPSPGVVKWRHTFGNDGSGDPAVFFWVTLTDEASTKDNLLKATEAFRQILYECVDFQNDWDLIPYFNFRSESEQAMLKGEVYA
Ga0302325_1243218023300031234PalsaMAYLAKGIAHAADLQIRLNGIMPTPSPGVMKWRHTFGSDWSGDPAIFFWVTLTDDASKKANLSKATAAFTKAITDHIDFLNDWGLIPYFHFRSESEQAKLKDEVYA
Ga0265332_1028309413300031238RhizosphereMPRARGVTQAAELLKELNGIMPQPSLGVVKWRHTFGNDWAGDPAIFFWVTLTDEASKKDNLSKATEAFRNELYKRIDFQNDWDLIPYFNFRSES
Ga0302320_1216219123300031524BogELNGVMPQPSLGVVKWRHTFGNDWTGDPAIFFWVTLTDEASKKENLSRATEEFRKVLCEQIDFQNDWDLIPYFNFRSQSEQAVLNDEVYA
Ga0302326_1002685783300031525PalsaMLQPSSGVVKWRHSFGNDWTGDPAIFFWVTLTDEASKKDNLSKATETFRKVLCERIDFQNDWDLIPYFNFRSESEQAILKDEVYA
Ga0302326_1305886323300031525PalsaMAYLAKGIAHAADLQIKLNGIMPKPSPGVVKWRHTFDSDWSGDPAIFFWVTLTDDASKKANLSEATAAFTKAITDRIDFLNDWGLIPYFNFRSESEQAKLKDEVYA
Ga0310686_10797841633300031708SoilMLRARGVAQAAELQKKLNGIMPRPSFGVVKWRHTFGNDWAGDPAIFFWVTLTDEASKKDNLAKATEDFRKALCEQIDFQNDWDLIPYFNFRSESEQAILNDEVYA
Ga0310686_11395491313300031708SoilGVVQWRHTFGNDWSGDPAIFFWVTLTDETSKRVNLSKATAAFKKAITDRIDFLNDWGLLPYFHFRSESEQAKLKDEVYA
Ga0310686_11815998423300031708SoilMPQLARGIAQAADLQKKLNGIMPQPIPCVVKWRHTFGNDWSGDPAIFFWVTLTDEASKKENLSGTTSAFNNLITGRVDFQNDWDLIPYFHFRSESEQAKLQDEVYA
Ga0265314_1005786723300031711RhizosphereMPRARGVTQAAELLKELNGIMPQPSLGVVKWRHTFGNDWAGDPAIFFWVTLTDEASKKDNLSKATEAFRNELYKRIDFQNDWDLIPYFNFRSESEQAILKDEVYA
Ga0302321_10343961713300031726FenPELQKKLNGIMPQPSSGVVKWRHTFGNDWTGDPAIFFWVTLTDEASKKDNLSEATEAFMKVLSERIDFQNDWDLIPYFNFRSESEQAILNDEVYA
Ga0302319_1073371013300031788BogRGVAQAAELQKELNGVMPQPSLGVVKWRHTFGNDWTGDPAIFFWVTLTDEASKKENLSRATEEFRKVLCEQIDFQNDWDLIPYFNFRSQSEQAVLNDEVYA
Ga0311301_1061642333300032160Peatlands SoilSRVRQLSKWYSETAMPRARGVAQAAELQKKLNGIMPQPSPGVVKWRHTFGNDWTGDPAIFFWVTLTDEASKKDNLSKATEAFRQLLCDRIDFQNDWDLIPYFNFRSESEQAILNDEVYA
Ga0348332_1450858623300032515Plant LitterARGIAQAADLQKKLNGIMPQPIPGVVKWRHTFGNDWSGDPAIFFWVTLTDEASKKENLSGTTSAFNNLITGRVDFQNDWDLIPYFHFRSESEQAKLQDEVYA
Ga0335079_1012968623300032783SoilMSRARGIAQAAELQKKLNGIMPQPSPGVVKWRHTFGNDWAGDPAIFFWVTLTDEASKKDKLSQTTEGFKTALSERIDFQNDWDLIPYFNFRSESEQALLKDEVYA
Ga0335078_1028199423300032805SoilMIASTSEAVVKWYSETGMLQPRGVAQAAELQKKLNGIKPQPSSGVVKWRHTFGNDWAGDPAIFFWVTLTDEASKRDNLATATEDFRKVLCEHIDFQNDWDLIPYFNFRSESEQAILNDEVYA
Ga0335078_1058372513300032805SoilCLRQIEWYSGIAMSRARGIAQAAELQKKLNGIMPQPSPGVVKWRHTFGNDWAGDPAIFFWVTLTDEASKKDKLSQTTEGFKTALSERIDFQNDWDLIPYFNFRSESEQALLKDEVYA
Ga0335078_1271869123300032805SoilMPWARGVAHAAELQKKLNGIMPQPSPGVVKWRHTFGNDWTGDPAIFFWVTLTDEASKKDNLSKATEAFRKVLHECIDFQNDWDLIPYFNFRSESEQAILKDEVYA
Ga0335080_1062243943300032828SoilMSRARGIAQAAELQKTLNGLMPQPSPGVVKWRHTFGNDWAGDPAIFFWVTLTDEASKKDKLSQTTEGFKRALSERIDFQNDWDLIPYFNFRS
Ga0335080_1098951613300032828SoilMSRARGIAQAAELQKKLNSIMPQPSPGVVKWRHTFGNDWAGDPAIFFWVTLSDDASTKDKLSQTTEGFKRVFSESIDFQNDWDLIPYFNFRSESEQALLKDEVYA
Ga0335081_1047561033300032892SoilMPRARGIAQAAELQKTLNGLMPQPSPGVVKWRHTFGNDWAGDPAIFFWVTLTDEASKKDKLSQTTEGFKRVLTEHIDFQNDWDLIPYFNFRSESEQALLKDEVYA
Ga0335074_1004199363300032895SoilVLKWRHTFGEDWTGDPAIFFWVTLTDEASKKDNLSRATEAFRKMISERIDFQNDWDLIPYFNFRSQSEQAILNDEVYA
Ga0335077_1032521353300033158SoilMSRARGIAQAAELQKTLNGLMPQPSPGVVKWRHTFGNDWAGDPAIFFWVTLTDEASKKDKLSQTTEGFKRVLTEHIDFQNDWDLIPYFNFRSESEQALLKDEVYA
Ga0335077_1060355223300033158SoilMSRARGIAQAAELQKKLNGIMPQPSPGVVKWRHTFGNDWAGDPAIFFWVTLTDEASKKDKLSQTTEGFKRVLTEHIDFQSDWDLIPYFNFRSESEQALLKDEVYA
Ga0334827_122311_162_4523300034065SoilLRRLQKQLNGILPQPSAGVVKWRHTFGNDWAGDPAIFFWVTLTDEASKKDNLLKATQAFQNVLDERIDFRDDWDLIPYFNFRSESEQAVLKGEVYA
Ga0370492_0029762_1662_19793300034282Untreated Peat SoilMLQARGVAQSAELQRKLNGIVPEPSSGVVKWRHTFDNDWTGDPSIFFWVTLTDEASKKGNLAKTTEAFEKALCERIDFQNDWDLIPYFNFRSESEQAILNDEVYA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.