| Basic Information | |
|---|---|
| Family ID | F084108 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 112 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MNTILTIAGVIFTLVIAGNLEMIDHSEDLEKEIKNSIDLNHLFN |
| Number of Associated Samples | 86 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 59.82 % |
| % of genes from short scaffolds (< 2000 bps) | 83.04 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (89.286 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater (25.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (74.107 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (83.036 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 86.36% β-sheet: 0.00% Coil/Unstructured: 13.64% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF06067 | DUF932 | 5.36 |
| PF02562 | PhoH | 2.68 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG1702 | Phosphate starvation-inducible protein PhoH, predicted ATPase | Signal transduction mechanisms [T] | 2.68 |
| COG1875 | Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domains | General function prediction only [R] | 2.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 89.29 % |
| All Organisms | root | All Organisms | 10.71 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 25.00% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 16.07% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 11.61% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 8.04% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 7.14% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 7.14% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 4.46% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.57% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 2.68% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 2.68% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.79% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.79% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.79% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.89% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.89% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.89% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.89% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.89% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.89% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000149 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P16 10m | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300003478 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_100m_DNA | Environmental | Open in IMG/M |
| 3300003580 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300004457 | Marine viral communities from Newfoundland, Canada MC-1 | Environmental | Open in IMG/M |
| 3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
| 3300005838 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_130m_DNA | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300007551 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3 | Environmental | Open in IMG/M |
| 3300007665 | Estuarine microbial communities from the Columbia River estuary - metaG 1557A-3 | Environmental | Open in IMG/M |
| 3300007681 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753 | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300009024 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009054 | Estuarine microbial communities from the Columbia River estuary - metaG S.737 | Environmental | Open in IMG/M |
| 3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
| 3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
| 3300009426 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009606 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017724 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017733 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23 | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017750 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300020169 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1 | Environmental | Open in IMG/M |
| 3300020347 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994) | Environmental | Open in IMG/M |
| 3300020352 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556084-ERR599144) | Environmental | Open in IMG/M |
| 3300020385 | Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
| 3300021335 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540 | Environmental | Open in IMG/M |
| 3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
| 3300021371 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
| 3300023112 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MG | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300023276 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_1_MG | Environmental | Open in IMG/M |
| 3300024059 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2 | Environmental | Open in IMG/M |
| 3300024255 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MG | Environmental | Open in IMG/M |
| 3300024259 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_200_MG | Environmental | Open in IMG/M |
| 3300024261 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_100_MG | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024413 | Seawater microbial communities from Monterey Bay, California, United States - 21D | Environmental | Open in IMG/M |
| 3300024417 | Seawater microbial communities from Monterey Bay, California, United States - 62D | Environmental | Open in IMG/M |
| 3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
| 3300024528 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_23 | Environmental | Open in IMG/M |
| 3300024529 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_21 | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027298 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C49A8_35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027416 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757 (SPAdes) | Environmental | Open in IMG/M |
| 3300027751 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 (SPAdes) | Environmental | Open in IMG/M |
| 3300027996 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MG | Environmental | Open in IMG/M |
| 3300028045 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MG | Environmental | Open in IMG/M |
| 3300028135 | Seawater microbial communities from Monterey Bay, California, United States - 7D | Environmental | Open in IMG/M |
| 3300028418 | Seawater microbial communities from Monterey Bay, California, United States - 16D | Environmental | Open in IMG/M |
| 3300032088 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515 | Environmental | Open in IMG/M |
| 3300032274 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSpr2010_101822461 | 3300000116 | Marine | MNTILTIAGVIFTLVIAGNLEMIDHSEDLEKEIKNS |
| LPaug09P1610mDRAFT_10012663 | 3300000149 | Marine | MNTILTITGVIFTLVIAGNLEMIDHSEDLEKEIKNSIDLNHLFN* |
| JGI24003J15210_101764922 | 3300001460 | Marine | MNTILTISGVIFTLVIYGNLEMLDHSEDLEKEIKNSIDLDYLFD* |
| JGI24004J15324_101547682 | 3300001472 | Marine | MNTILTIAGVIFTLVIYGNLEMLDHSEDLEKEIKNSIDLNYLFK* |
| JGI26238J51125_10832141 | 3300003478 | Marine | LTIAGVIFTLVIAGNLEMIDHSEDLEKEIKNSIDLNHLFN* |
| JGI26260J51721_10127813 | 3300003580 | Marine | MNSILTIAGVIFTLVIAGNLEMIDHSEDLEKEIKNSIDLNHLFN* |
| JGI26260J51721_10189952 | 3300003580 | Marine | MNTILTIAGVIFTLVIAGNLEMIDHSEDLEKEIKNSIDLNHLFN* |
| Ga0055584_1009202512 | 3300004097 | Pelagic Marine | MNSILTIAGVIFTLVIAGNLEMLDHSQDLEKDLQNSIDLDYLFN* |
| Ga0066224_11159684 | 3300004457 | Marine | KPLSNMNSILTIAGVIFTLVIAGNLEMIDHSQDLEKEIKNSIDLNHLFN* |
| Ga0073579_16093862 | 3300005239 | Marine | MNTILTISGVIFTLVIAGNLEMIDHSEDLEKDFQKSIDLNYLFN* |
| Ga0008649_102670171 | 3300005838 | Marine | SNMNTILTIAGVIFTLVIAGNLEMIDHSEDLEKEIKKSIDLNHLFN* |
| Ga0075466_10654334 | 3300006029 | Aqueous | ILTIAGVIFTLVIAGNLEMIDHSEDLEKEIKNSIDLNHLFN* |
| Ga0098038_10761564 | 3300006735 | Marine | MNSILTIAGVIFTLVIAGNLEMLDHSEDLEKDFQKSIDLNYLFN* |
| Ga0098038_12043602 | 3300006735 | Marine | TIAGVIFTLVIAGNLEMIDHSEDLEKEIKNSIDLNYLFN* |
| Ga0098048_10509053 | 3300006752 | Marine | MNSILTIAGVIFTLVIAGNLEMIDHSEDLEKEIKNSIDLNYLFN* |
| Ga0098054_10813441 | 3300006789 | Marine | LTIAGVIFTLVIAGNLEMIDHSEDLEKDFQKSIDLNYLFN* |
| Ga0098055_10779252 | 3300006793 | Marine | MNTILTIAGVIFTLVIAGNLEMLDHSEDLEKDFQKSIDLNYLFN* |
| Ga0098055_10922225 | 3300006793 | Marine | VIFTLVIAGNLEMLDHSEDLEKDFQKSIDLNYLFN* |
| Ga0098055_12943071 | 3300006793 | Marine | MNSILTIAGVIFTLVIAGNLEMLDHSEDLEKDFQKSI |
| Ga0098051_10253272 | 3300006924 | Marine | MNSILTIAGVIFTLVIAGNLEMLDHSQDLEKDLQNSLDLDYLFD* |
| Ga0098050_10078411 | 3300006925 | Marine | MNSILTIAGVIYTLVIAGNLEMLDHSEDLEKDFQKSIDLNYLFN* |
| Ga0102881_11680582 | 3300007551 | Estuarine | MNTILTIAGVIFTLVIAGNLEMIDHSEDLEKEIKKSIDLNHLFN* |
| Ga0102908_10977992 | 3300007665 | Estuarine | LSATRSPNSSSKPPSNMNTILTIAGVIFTLVIAGNLEMIDHSEDLEKEIKKSIDLNHLFN |
| Ga0102824_11729773 | 3300007681 | Estuarine | MNTILTIAGVIFTLVIAGNLEMIDHSEDLEKEIKNSIDLNHLF |
| Ga0105748_101314321 | 3300007992 | Estuary Water | GVIFTLVIAGNLEMIDHSEDLEKEIKKSIDLNHLFN* |
| Ga0105748_101919732 | 3300007992 | Estuary Water | MNTILTIAGVIFTLVIAGNLEMLDHSEDLEKDFQNSIDLNYLFN* |
| Ga0102811_11752504 | 3300009024 | Estuarine | MNTILTIAGVIFTLVIAGNLEMIDHSEDLEKEIKN |
| Ga0102811_13611492 | 3300009024 | Estuarine | AGVIFTLVIYGNLEMIDHSEDLEKEIKNSIDLNHLFN* |
| Ga0102829_13316482 | 3300009026 | Estuarine | MNTILTIAGVIFTLVIAGNLEMIDHSEDLEKDFQKSIDLNYLFN* |
| Ga0102826_11353482 | 3300009054 | Estuarine | LSATRSPSSSSTPLSNMNTILTIAGVIFTLVIAGNLEMIDHSEDLEKEIKKSIDLNHLFN |
| Ga0102812_100838525 | 3300009086 | Estuarine | SSSKPPSNMNTILTIAGVIFTLVIAGNLEMIDHSEDLEKEIKNSIDLNHLFN* |
| Ga0115551_10741344 | 3300009193 | Pelagic Marine | MNTILTIAGVIFTLVIAGNLEMIDHSQDLEKEIKNSMDFNNLFN* |
| Ga0115547_12585402 | 3300009426 | Pelagic Marine | IAGVIFTLVIAGNLEMIDHSQDLEKEIKNSIDLNHLFN* |
| Ga0115545_10312604 | 3300009433 | Pelagic Marine | MNTILTIAGVIFTLVIAGNLEMIDHSQDLEKEIKNSIDLNHLFN* |
| Ga0115102_103431382 | 3300009606 | Marine | LSLMNTILTIAGVIFTLVIAGNLEMLDHSEDLEKDFQNSIDLNYLFN* |
| Ga0098056_10207951 | 3300010150 | Marine | SLMNSILTIAGVIFTLVIAGNLEMIDHSEDLEKEIKNSIDLNYLFN* |
| Ga0098056_10608711 | 3300010150 | Marine | IFTLVIAGNLEMLDHSEDLEKDFQKSIDLNYLFN* |
| Ga0181387_10390191 | 3300017709 | Seawater | SNMNTILTIAGVIFTLVIAGNLEMLDHSEDLEKEIKKSIDLNHLFT |
| Ga0181387_10738141 | 3300017709 | Seawater | ILTIAGVIFTLVIAGNLEMLDHSQDLEKDLQNSIDLDYLFN |
| Ga0181403_10641781 | 3300017710 | Seawater | MNTILTIAGVIFTLVIAGNLEMLDHSQDLEKDLQNSIDLDYLFN |
| Ga0181403_10819841 | 3300017710 | Seawater | MNSILTIAGVIFTLVIAGNLEMIDYSQDLEKDLQNSIDLDYLFN |
| Ga0181391_10326304 | 3300017713 | Seawater | TIAGVIFTLVIAGNLEMIDHSEDLEKDFQKSIDLNYLFN |
| Ga0181404_11414932 | 3300017717 | Seawater | NTILTIAGVIFTLVIAGNLEMIDHSEDLEKDFQKSIDLNYLFN |
| Ga0181388_10881361 | 3300017724 | Seawater | SNMNTILTIAGVIFTLVIAGNLEMLDHSQDLEKDLQNSIDLDYLFN |
| Ga0181416_10996451 | 3300017731 | Seawater | MNTILTIAGVIFTLVIAGNLEMIDHSEDLEKDFQK |
| Ga0181426_10365671 | 3300017733 | Seawater | MNTILTIAGVIFTLVIAGNLEMIDHSEDLEKEIKKGIDLNHLFN |
| Ga0181402_10276663 | 3300017743 | Seawater | MHTILTIAGVIFTLVIAGNLEMIDHSEDLEKDFQKSIDLNYLFN |
| Ga0181393_11139033 | 3300017748 | Seawater | MNTILTIAGVIFTLVIAGNLEMLDHSEDLEKDFQKSIDLNYLF |
| Ga0181392_10694341 | 3300017749 | Seawater | SNMNTILTIAGVIFTLVIAGNLEMIDHSEDLEKDFQKSIDLNHLFN |
| Ga0181405_10487784 | 3300017750 | Seawater | SNMNTILTIAGVIFTLVIAGNLEMIDHSEDLEKDFQKSIDLNYLFN |
| Ga0181407_10373461 | 3300017753 | Seawater | ILTIAGVIFTLVIAGNLEMIDHSEDLEKDFQKSIDLNYLFN |
| Ga0181407_10771971 | 3300017753 | Seawater | MNTILTIAGVIFTLVIAGNLEMIDHSEDLEKEIKKSI |
| Ga0181407_11104291 | 3300017753 | Seawater | PLSNMNTILTIAGVIFTLVIAGNLEMIDHSEDLEKEIKKSIDLNHLFN |
| Ga0181382_10572944 | 3300017756 | Seawater | IAGVIFTLVIAGNLEMLDHSKDLEKDLQNSIDLDYLFD |
| Ga0181414_11114223 | 3300017759 | Seawater | MNTILTIAGVIFTLVIAGNLEMIDHSEDLEKDFQKSIDLNY |
| Ga0181408_11263481 | 3300017760 | Seawater | TIAGVIFTLVIAGNLEMIDHSEDLEKEIKKSIDLNHLFN |
| Ga0181410_11013463 | 3300017763 | Seawater | STPLSNMNTILTIAGVIFTLVIAGNLEMIDHSEDLEKEIKNSIDLNHLFN |
| Ga0181406_10830271 | 3300017767 | Seawater | TPLSNMNTILTIAGVIFTLVIAGNLEMIDHSEDLEKDFQKSIDLNYLFN |
| Ga0181406_11225081 | 3300017767 | Seawater | TIAGVIFTLVIAGNLEMIDHSEDLEKEIKNSIDLNYLFN |
| Ga0181430_10284223 | 3300017772 | Seawater | MNTILTIAGVIFTLVIAGNLEMLDHSEDLEKEIKKSIDLNHLFN |
| Ga0181380_12392501 | 3300017782 | Seawater | TILTIAGVIFTLVIAGNLEMIDHSEDLEKEIKNSIDLNHLFN |
| Ga0206127_12689122 | 3300020169 | Seawater | MNTILTIAGVIFTLVIAGNLEMIDHSQDLEKEIKNSIDLNHLFN |
| Ga0211504_10096781 | 3300020347 | Marine | ILTIAGVIFTLVIAGNLEMIDHSQDLEKEIKNSIDLNHLFN |
| Ga0211505_10710432 | 3300020352 | Marine | MNTILTIAGVIFTLVIAGNLEMIDHSEDLEKDFQKSIDLNHLFN |
| Ga0211505_10867122 | 3300020352 | Marine | MNSILTIAGVIFTLVIAGNLEMIDHSQDLEKEIKNSIDLNHLFN |
| Ga0211677_100179553 | 3300020385 | Marine | MNSILTIAGVIFTLVIAGNLEMLDHSQDLEKDLQNSIDLDYLFN |
| Ga0211677_101504013 | 3300020385 | Marine | MNSILTIAGVIFTLVIAGNLEMLDHSEDLEKDFQKSIDLNYLFN |
| Ga0211677_103883112 | 3300020385 | Marine | MNSILTIAGVIFTLVIAGNLEMIDHSEDLEKDFQKSIDLNYLFN |
| Ga0211576_100185755 | 3300020438 | Marine | MNTILTIAGVIFTLVIAGNLEMIDYSQDLEKDLQNSIDLDYLFN |
| Ga0206682_101565792 | 3300021185 | Seawater | MNTILTIAGVIFTLVIAGNLEMIDHSEDLEKEIKKSIDLNHLFN |
| Ga0206682_104224491 | 3300021185 | Seawater | MNTILTIAGVIFTLVIAGNLEMIDHSEDLEKEIKNSIDLNHLFN |
| Ga0213867_12934082 | 3300021335 | Seawater | MNTILTIAGVIFTLVIAGNLEMIDHSEDLEKDFQKSIDLNYLFN |
| Ga0213862_100236551 | 3300021347 | Seawater | LTIAGVIFTLVIAGNLEMIDHSEDLEKDFQKSIDLNYLFN |
| Ga0213862_101947761 | 3300021347 | Seawater | MNTILTIAGVIFTLVIAGNLEMIDHSEDLEKDFQKSID |
| Ga0213863_1000222610 | 3300021371 | Seawater | MNSILTIAGVIFTLVIAGNLEMIDHSEDLEKKFKNSIDLNHLFN |
| Ga0222717_100158312 | 3300021957 | Estuarine Water | MNTILTIAGVIFTLVIYGNLEMIDHSEDLEKEIKNSIDLNHLFN |
| Ga0222717_100184256 | 3300021957 | Estuarine Water | MNTILTIAGVIFTLVIAGNLEMLDHSEDLEKDFQNSIDLNYLFN |
| Ga0222717_104133671 | 3300021957 | Estuarine Water | ILTIAGVIFTLVIAGNLEMIDHSEDLEKEIKNSIDLNHLFN |
| Ga0222717_104577823 | 3300021957 | Estuarine Water | SSSSTPLSNMNTILTIAGVIFTLVIAGNLEMIDHSEDLEKEIKKSIDLNHLFN |
| (restricted) Ga0233432_101147133 | 3300023109 | Seawater | IAGVIFTLVIAGNLEMIDHSEDLEKEIKNSIDLNHLFN |
| (restricted) Ga0233432_102664751 | 3300023109 | Seawater | MNTILTIAGVIFTLVIAGNLEMIDHSEDLEKEIKNSIDLN |
| (restricted) Ga0233432_104599381 | 3300023109 | Seawater | GVIFTLVIAGNLEMIDHSEDLEKEIKKSIDLNHLFN |
| (restricted) Ga0233411_103120662 | 3300023112 | Seawater | KPPSNMNTILTIAGVIFTLVIAGNLEMIDHSEDLEKEIKNSIDLNHLFN |
| (restricted) Ga0233412_100444672 | 3300023210 | Seawater | MNSILTIAGVIFTLVIAGNLEMIDHSEDLEKEIKNSIDLNHLFN |
| (restricted) Ga0233412_103081721 | 3300023210 | Seawater | MNTILTIAGVIFTLVIAGNLEMIDHSEDLEKEIKNSIDLNHL |
| (restricted) Ga0233410_100528984 | 3300023276 | Seawater | MNTILTIAGVIFTLVIAGNLEMIDHSEDLEKEIKKSIDLN |
| (restricted) Ga0233410_102651131 | 3300023276 | Seawater | SSSSTPLSNMNSILTIAGVIFTLVIAGNLEMIDHSEDLEKEIKKSIDLNHLFN |
| (restricted) Ga0255040_104199882 | 3300024059 | Seawater | SNMNTILTIAGVIFTLVIAGNLEMIDHSEDLEKEIKKSIDLNHLFN |
| (restricted) Ga0233438_100801111 | 3300024255 | Seawater | LTIAGVIFTLVIAGNLEMIDHSEDLEKEIKNSIDLNHLFN |
| (restricted) Ga0233437_10540912 | 3300024259 | Seawater | MNSILTIAGVIFTLVIAGNLEMIDHSEDLEKEIKKSIDLNHLFN |
| (restricted) Ga0233439_100932591 | 3300024261 | Seawater | RPLSLMNTILTIAGVIFTLVIAGNLEMIDHSEDLEKEIKNSIDLNHLFN |
| Ga0244775_101077392 | 3300024346 | Estuarine | MNSILTIAGVIFTVVIAGNLEMLDHSEDLEKDLQNSIDLDYLFD |
| Ga0233393_10958281 | 3300024413 | Seawater | NMNTILTIAGVIFTLVIAGNLEMIDHSEDLEKEIKNSIDLNHLFN |
| Ga0228650_11738041 | 3300024417 | Seawater | GVIFTLVIAGNLEMLDHSKDLEKDLQNSIDLDYLFD |
| (restricted) Ga0255046_101112733 | 3300024519 | Seawater | MNSILTIAGVIFTLVIAGNLEMLDRSEDLEKDLQNSIDLDYLFD |
| (restricted) Ga0255045_100597311 | 3300024528 | Seawater | NTILTIAGVIFTLVIAGNLEMIDHSEDLEKEIKNSIDLNHLFN |
| (restricted) Ga0255044_104133871 | 3300024529 | Seawater | ILTIAGVIFTLVIAGNLEMIDHSEDLEKEIKKSIDLNHLFN |
| Ga0208667_10031614 | 3300025070 | Marine | MNSILTIAGVIFTLVIAGNLEMIDHSEDLEKEIKNSIDLNYLFN |
| Ga0208793_11327242 | 3300025108 | Marine | MNTILTIAGVIFTLVIAGNLEMLDHSEDLEKDFQKSIDLNYLFN |
| Ga0209535_100141022 | 3300025120 | Marine | MNTILTISGVIFTLVIYGNLEMLDHSEDLEKEIKNSIDLDYLFD |
| Ga0209535_10094509 | 3300025120 | Marine | MNTILTIAGVIFTLVIYGNLEMLDHSEDLEKEIKNSIDLNYLFK |
| Ga0209535_10446341 | 3300025120 | Marine | TQQPLSLMNTILTITGVIFTLVIAGNLEMIDHSEDLEKEIKNSIDLNHLFN |
| Ga0208643_10211121 | 3300025645 | Aqueous | LSNMNTILTIAGVIFTLVIAGNLEMIDHSEDLEKEIKNSIDLNHLFN |
| Ga0208970_10737481 | 3300027298 | Marine | AGVIFTLVIAGNLEMIDHSEDLEKEIKNSIDLNHLFN |
| Ga0207994_10060125 | 3300027416 | Estuarine | SSKPPSNMNTILTIAGVIFTLVIAGNLEMIDHSEDLEKEIKKSIDLNHLFN |
| Ga0208304_101412903 | 3300027751 | Estuarine | LTIAGVIFTLVIAGNLEMIDHSEDLEKEIKKSIDLNHLFN |
| (restricted) Ga0233413_100944944 | 3300027996 | Seawater | VIFTLVIAGNLEMIDHSEDLEKEIKKSIDLNHLFN |
| (restricted) Ga0233414_104148373 | 3300028045 | Seawater | STPLSNMNTILTIAGVIFTLVIAGNLEMIDHSEDLEKEIKKSIDLNHLFN |
| Ga0228606_10731681 | 3300028135 | Seawater | MNSILTIAGVIFTLVIAGNLEMLDHSKDLEKDLQNSIDLDYLFD |
| Ga0228615_10626751 | 3300028418 | Seawater | PNSSSTPLSNMNTILTIAGVIFTLVIAGNLEMIDHSEDLEKEIKNSIDLNHLFN |
| Ga0315321_105274151 | 3300032088 | Seawater | MNTILTIAGVIFTLVIAGNLEMLDHSEDLEKEIKKSIDLNQLFN |
| Ga0316203_10693481 | 3300032274 | Microbial Mat | HFNNMNSILTIAGVIFTLVIAGNLEMIDHSEDLEKEIKNSIDLNHLFN |
| ⦗Top⦘ |