NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F084081

Metagenome / Metatranscriptome Family F084081

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F084081
Family Type Metagenome / Metatranscriptome
Number of Sequences 112
Average Sequence Length 65 residues
Representative Sequence ENELLKKVTLQQIQDNINFLQAKCMYKSHWQDCIEFNKRLDKTRGQDFLAANPEFTPYV
Number of Associated Samples 104
Number of Associated Scaffolds 112

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 98.21 %
% of genes from short scaffolds (< 2000 bps) 83.04 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (54.464 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater
(21.429 % of family members)
Environment Ontology (ENVO) Unclassified
(41.071 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(89.286 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 51.72%    β-sheet: 0.00%    Coil/Unstructured: 48.28%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 112 Family Scaffolds
PF04055Radical_SAM 81.25
PF01370Epimerase 1.79
PF13394Fer4_14 0.89
PF13353Fer4_12 0.89



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms75.89 %
UnclassifiedrootN/A24.11 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000224|SI34jun09_10mDRAFT_1047230All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage585Open in IMG/M
3300000265|LP_A_09_P04_10DRAFT_1004848Not Available3434Open in IMG/M
3300000401|BB_Man_B_Liq_inBBDRAFT_1010575All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1307Open in IMG/M
3300000928|OpTDRAFT_10010739Not Available12401Open in IMG/M
3300000928|OpTDRAFT_10057526All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage627Open in IMG/M
3300001940|GOS2222_1003077All Organisms → Viruses → Predicted Viral1716Open in IMG/M
3300003216|JGI26079J46598_1083295All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage595Open in IMG/M
3300003410|JGI26086J50260_1025413All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1696Open in IMG/M
3300003477|nap3_10070766All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage805Open in IMG/M
3300003592|JGI26246J51724_1080311All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage602Open in IMG/M
3300003908|JGI26085J52751_1015315All Organisms → Viruses → Predicted Viral1150Open in IMG/M
3300004279|Ga0066605_10216482All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage729Open in IMG/M
3300005931|Ga0075119_1042511All Organisms → Viruses → Predicted Viral1180Open in IMG/M
3300005941|Ga0070743_10062993All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1259Open in IMG/M
3300005942|Ga0070742_10178232All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage593Open in IMG/M
3300006752|Ga0098048_1142297All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage716Open in IMG/M
3300006922|Ga0098045_1047782All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1066Open in IMG/M
3300006924|Ga0098051_1078653All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage892Open in IMG/M
3300007538|Ga0099851_1249034Not Available636Open in IMG/M
3300007542|Ga0099846_1145419Not Available855Open in IMG/M
3300007609|Ga0102945_1019083All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1524Open in IMG/M
3300007960|Ga0099850_1023571Not Available2718Open in IMG/M
3300008116|Ga0114350_1050427All Organisms → Viruses → Predicted Viral1517Open in IMG/M
3300009002|Ga0102810_1232963All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage566Open in IMG/M
3300009024|Ga0102811_1027346All Organisms → Viruses → Predicted Viral2188Open in IMG/M
3300009079|Ga0102814_10113062All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1489Open in IMG/M
3300009086|Ga0102812_10042290All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium2559Open in IMG/M
3300009086|Ga0102812_10299414All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage875Open in IMG/M
3300009420|Ga0114994_10802766All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage611Open in IMG/M
3300009436|Ga0115008_10494709All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage873Open in IMG/M
3300009442|Ga0115563_1192089All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage790Open in IMG/M
3300009495|Ga0115571_1004554Not Available8495Open in IMG/M
3300009495|Ga0115571_1042712All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2139Open in IMG/M
3300009496|Ga0115570_10076282All Organisms → Viruses → Predicted Viral1693Open in IMG/M
3300009507|Ga0115572_10005425Not Available9777Open in IMG/M
3300009507|Ga0115572_10028432Not Available3762Open in IMG/M
3300009526|Ga0115004_10423971All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage788Open in IMG/M
3300009526|Ga0115004_10499373All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage720Open in IMG/M
3300012031|Ga0136561_1057844All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage570Open in IMG/M
3300012145|Ga0136566_1059416All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage614Open in IMG/M
3300016781|Ga0182063_1703467All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1099Open in IMG/M
3300017727|Ga0181401_1022753All Organisms → Viruses → Predicted Viral1857Open in IMG/M
3300017739|Ga0181433_1162848Not Available522Open in IMG/M
3300017742|Ga0181399_1046590All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1140Open in IMG/M
3300017752|Ga0181400_1103535All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage834Open in IMG/M
3300017763|Ga0181410_1027864All Organisms → Viruses → Predicted Viral1825Open in IMG/M
3300017770|Ga0187217_1045208All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon1542Open in IMG/M
3300017818|Ga0181565_10185110All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1439Open in IMG/M
3300017824|Ga0181552_10518707All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage560Open in IMG/M
3300017951|Ga0181577_10849354All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage548Open in IMG/M
3300017952|Ga0181583_10420324All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage829Open in IMG/M
3300017957|Ga0181571_10433300All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage811Open in IMG/M
3300017958|Ga0181582_10109624All Organisms → Viruses → Predicted Viral1978Open in IMG/M
3300017962|Ga0181581_10039432Not Available3406Open in IMG/M
3300017964|Ga0181589_10032359Not Available4006Open in IMG/M
3300017985|Ga0181576_10258787All Organisms → Viruses → Predicted Viral1119Open in IMG/M
3300018041|Ga0181601_10509725All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage626Open in IMG/M
3300018421|Ga0181592_10850315All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage597Open in IMG/M
3300018426|Ga0181566_10311437All Organisms → Viruses → Predicted Viral1136Open in IMG/M
3300018428|Ga0181568_10382255All Organisms → Viruses → Predicted Viral1137Open in IMG/M
3300019266|Ga0182061_1341625All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage625Open in IMG/M
3300020185|Ga0206131_10397095All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage577Open in IMG/M
3300020187|Ga0206130_10290400Not Available713Open in IMG/M
3300021364|Ga0213859_10065262All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1730Open in IMG/M
3300021378|Ga0213861_10597847All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage508Open in IMG/M
3300021379|Ga0213864_10597409Not Available546Open in IMG/M
3300021959|Ga0222716_10090921All Organisms → Viruses → Predicted Viral2079Open in IMG/M
3300022200|Ga0196901_1202413Not Available637Open in IMG/M
3300022926|Ga0255753_1078135All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1718Open in IMG/M
3300023227|Ga0222690_1025238All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage761Open in IMG/M
3300023230|Ga0222709_1036159All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage639Open in IMG/M
3300024188|Ga0228602_1000214Not Available3773Open in IMG/M
3300024228|Ga0228633_1007728Not Available3200Open in IMG/M
3300024231|Ga0233399_1024627All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon1791Open in IMG/M
3300024237|Ga0228653_1047668All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage974Open in IMG/M
3300024242|Ga0228673_1082315All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage572Open in IMG/M
3300024248|Ga0228676_1064981All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage817Open in IMG/M
(restricted) 3300024264|Ga0233444_10080376All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1781Open in IMG/M
3300024267|Ga0228623_1072812Not Available643Open in IMG/M
3300024297|Ga0228658_1143975All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage574Open in IMG/M
3300024314|Ga0228657_1015491All Organisms → Viruses → Predicted Viral1836Open in IMG/M
3300024319|Ga0228670_1085605All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage651Open in IMG/M
3300024322|Ga0228656_1023562All Organisms → Viruses → Predicted Viral1415Open in IMG/M
3300024346|Ga0244775_10093002All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium2567Open in IMG/M
3300024346|Ga0244775_10188019All Organisms → Viruses → Predicted Viral1735Open in IMG/M
3300024415|Ga0228662_1020353All Organisms → Viruses → Predicted Viral1863Open in IMG/M
3300025084|Ga0208298_1044173All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage889Open in IMG/M
3300025438|Ga0208770_1064742Not Available682Open in IMG/M
3300025695|Ga0209653_1016672Not Available3586Open in IMG/M
3300025695|Ga0209653_1153975All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage673Open in IMG/M
3300025701|Ga0209771_1123323All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage829Open in IMG/M
3300025704|Ga0209602_1110167All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage953Open in IMG/M
3300025879|Ga0209555_10246796All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage701Open in IMG/M
3300026479|Ga0228622_1071957Not Available748Open in IMG/M
3300027191|Ga0208021_1027451All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage863Open in IMG/M
3300027192|Ga0208673_1001400Not Available5706Open in IMG/M
3300027525|Ga0208437_1058414All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage919Open in IMG/M
3300027525|Ga0208437_1118647Not Available602Open in IMG/M
3300027612|Ga0209037_1053800Not Available993Open in IMG/M
3300027686|Ga0209071_1040133All Organisms → Viruses → Predicted Viral1445Open in IMG/M
3300027810|Ga0209302_10386598All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage634Open in IMG/M
3300028127|Ga0233401_1000590Not Available13338Open in IMG/M
3300028128|Ga0228645_1133169Not Available547Open in IMG/M
3300028133|Ga0228609_1135211Not Available614Open in IMG/M
3300028136|Ga0228608_1163550All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage594Open in IMG/M
3300028273|Ga0228640_1020705All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1279Open in IMG/M
3300028416|Ga0228614_1102162All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage519Open in IMG/M
3300028418|Ga0228615_1187162All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage514Open in IMG/M
3300031589|Ga0307996_1045955All Organisms → Viruses → Predicted Viral1156Open in IMG/M
3300031695|Ga0308016_10363480All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage519Open in IMG/M
3300031706|Ga0307997_10081747All Organisms → Viruses → Predicted Viral1307Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater21.43%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh14.29%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine9.82%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine8.04%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine8.04%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine6.25%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater5.36%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous3.57%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine3.57%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake3.57%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine2.68%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine1.79%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater1.79%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine1.79%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water1.79%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.89%
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine0.89%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.89%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.89%
EstuarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Estuarine0.89%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water0.89%
Bioluminescent BayEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Unclassified → Unclassified → Bioluminescent Bay0.89%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000224Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 10mEnvironmentalOpen in IMG/M
3300000265Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_A_09_P04_10EnvironmentalOpen in IMG/M
3300000401Marine microbial community from La Parguera, Puerto Rico - BB Mangrove B LiquidEnvironmentalOpen in IMG/M
3300000928Marine plume microbial communities from the Columbia River - 25 PSUEnvironmentalOpen in IMG/M
3300001940Marine microbial communities from Bay of Fundy, Nova Scotia, Canada - GS006EnvironmentalOpen in IMG/M
3300003216Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNAEnvironmentalOpen in IMG/M
3300003410Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_153SG_22_DNAEnvironmentalOpen in IMG/M
3300003477Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 3EnvironmentalOpen in IMG/M
3300003592Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_10m_DNAEnvironmentalOpen in IMG/M
3300003908Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_125SG_5_DNAEnvironmentalOpen in IMG/M
3300004279Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10mEnvironmentalOpen in IMG/M
3300005931Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK9EnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300005942Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757EnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006922Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaGEnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007542Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaGEnvironmentalOpen in IMG/M
3300007609Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MGEnvironmentalOpen in IMG/M
3300007960Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaGEnvironmentalOpen in IMG/M
3300008116Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NAEnvironmentalOpen in IMG/M
3300009002Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573EnvironmentalOpen in IMG/M
3300009024Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705EnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009086Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713EnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009496Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524EnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300009526Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90EnvironmentalOpen in IMG/M
3300012031Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Hop E1 #498EnvironmentalOpen in IMG/M
3300012145Saline lake microbial communities from Deep lake, Antarctica - Metagenome #2EnvironmentalOpen in IMG/M
3300016781Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101409CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017727Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20EnvironmentalOpen in IMG/M
3300017739Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017818Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017824Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017952Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017957Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017958Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017962Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017964Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017985Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018041Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018421Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018426Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018428Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019266Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101407AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020185Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1EnvironmentalOpen in IMG/M
3300020187Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1EnvironmentalOpen in IMG/M
3300021364Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300021379Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247EnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300022200Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022926Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaGEnvironmentalOpen in IMG/M
3300023227Saline water microbial communities from Ace Lake, Antarctica - #1234EnvironmentalOpen in IMG/M
3300023230Saline water microbial communities from Ace Lake, Antarctica - #1692EnvironmentalOpen in IMG/M
3300024188Seawater microbial communities from Monterey Bay, California, United States - 2DEnvironmentalOpen in IMG/M
3300024226Seawater microbial communities from Monterey Bay, California, United States - 81DEnvironmentalOpen in IMG/M
3300024228Seawater microbial communities from Monterey Bay, California, United States - 41DEnvironmentalOpen in IMG/M
3300024231Seawater microbial communities from Monterey Bay, California, United States - 43DEnvironmentalOpen in IMG/M
3300024237Seawater microbial communities from Monterey Bay, California, United States - 65DEnvironmentalOpen in IMG/M
3300024242Seawater microbial communities from Monterey Bay, California, United States - 91DEnvironmentalOpen in IMG/M
3300024248Seawater microbial communities from Monterey Bay, California, United States - 48D_rEnvironmentalOpen in IMG/M
3300024264 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MGEnvironmentalOpen in IMG/M
3300024267Seawater microbial communities from Monterey Bay, California, United States - 28DEnvironmentalOpen in IMG/M
3300024297Seawater microbial communities from Monterey Bay, California, United States - 71DEnvironmentalOpen in IMG/M
3300024314Seawater microbial communities from Monterey Bay, California, United States - 70DEnvironmentalOpen in IMG/M
3300024319Seawater microbial communities from Monterey Bay, California, United States - 85DEnvironmentalOpen in IMG/M
3300024322Seawater microbial communities from Monterey Bay, California, United States - 68DEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300024415Seawater microbial communities from Monterey Bay, California, United States - 76DEnvironmentalOpen in IMG/M
3300025084Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025438Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK9 (SPAdes)EnvironmentalOpen in IMG/M
3300025695Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025701Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025704Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 (SPAdes)EnvironmentalOpen in IMG/M
3300025879Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026479Seawater microbial communities from Monterey Bay, California, United States - 26DEnvironmentalOpen in IMG/M
3300027191Estuarine microbial communities from the Columbia River estuary - metaG S.737 (SPAdes)EnvironmentalOpen in IMG/M
3300027192Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715 (SPAdes)EnvironmentalOpen in IMG/M
3300027525Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 (SPAdes)EnvironmentalOpen in IMG/M
3300027612Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_125SG_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027686Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028127Seawater microbial communities from Monterey Bay, California, United States - 49DEnvironmentalOpen in IMG/M
3300028128Seawater microbial communities from Monterey Bay, California, United States - 57DEnvironmentalOpen in IMG/M
3300028133Seawater microbial communities from Monterey Bay, California, United States - 10DEnvironmentalOpen in IMG/M
3300028136Seawater microbial communities from Monterey Bay, California, United States - 9DEnvironmentalOpen in IMG/M
3300028273Seawater microbial communities from Monterey Bay, California, United States - 51DEnvironmentalOpen in IMG/M
3300028416Seawater microbial communities from Monterey Bay, California, United States - 15DEnvironmentalOpen in IMG/M
3300028418Seawater microbial communities from Monterey Bay, California, United States - 16DEnvironmentalOpen in IMG/M
3300031589Marine microbial communities from David Island wharf, Antarctic Ocean - #35EnvironmentalOpen in IMG/M
3300031695Marine microbial communities from water near the shore, Antarctic Ocean - #233EnvironmentalOpen in IMG/M
3300031706Marine microbial communities from David Island wharf, Antarctic Ocean - #36EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
SI34jun09_10mDRAFT_104723013300000224MarineEVLEYPLVKQHKLLETVTLQQIQDNINFLESKCMYETHWQDCIEFNKRLDKTRGQDFLAANPEFAAYV*
LP_A_09_P04_10DRAFT_100484853300000265MarineLQQIQDNINFLEAKCMHETHWQDCIEFNKRLDKTRGQDFLAANPEFASYV*
BB_Man_B_Liq_inBBDRAFT_101057513300000401Bioluminescent BayDYPAIQESELLKTVTLQQIQDNINFLEAKCMYDTHWRDCVDFNRALDKTRSQDFLAVNPEFKPYV*
OpTDRAFT_1001073963300000928Freshwater And MarineLPPELKQQVITKLEAMKETVLTYSLVQENELLKKVTLQQIQDNINFLQAKCMYKSHWQDCIEFNKRLDTTRGQDFLAANPEFTPYV*
OpTDRAFT_1005752623300000928Freshwater And MarineVLDYKLVKQHDIVKQVTLQQIQDNINFLQAKDMHYTHWKDCIEFNKRLDKTRGQDFLAANPEFKQYV*
GOS2222_100307743300001940MarineLPPELKQQVITKLEAMKETVLTYPLVQENELLKKVTLQQIQDNINFLQAKCMYESHWQDCIEFNKRLDKTRKQDFLLANPEFKLYV*
JGI26079J46598_108329513300003216MarineTLQQIQDNINFLESKCMYDTHWQDCINFNRALDKTRGQNFLTTNPEFTPYV*
JGI26086J50260_102541333300003410MarineMQIKVLDYTVIQENELLKTVTLQQIQDNINFLESKCMYDTHWQDCINFNRALDKTRGQSFLDANPEFKLYV*
nap3_1007076613300003477EstuarineAQVLPPELKQQVITKLEAMKKTVLTYSLVQENELLKKVTLQQIQDNINFLQAKCMYNTHWQDCIAFNHNLDKTRGQDFLTANPEFAPYV*
JGI26246J51724_108031113300003592MarineQDNINFLEAKCMYETHWQDCIEFNRRLDKTRGQDFLASNPEFSPYV*
JGI26085J52751_101531523300003908MarineVTLQQIQDNINFLQSKCMYDTHWQDCIEFNKRLDKTRNQDFLSANPEFKFYV*
Ga0066605_1021648223300004279MarineTLQQIQDNINFLQAKDMHPTHWQDCIEFNKRLDKTRGQDFLLANPEFKQYV*
Ga0075119_104251133300005931Saline LakeLKEGVIERLEEMKLEILDYPRIQENKLLETVTRQQIQDNINFLKAKCMYDSHWQDCIDFNMKLDKTRNQSLLQVIPEFKPYV*
Ga0070743_1006299333300005941EstuarineQIQDNINFLQAKDMHPTHWQDCIEFNKRLDKTRGQDFLLANPEFKQYV*
Ga0070742_1017823223300005942EstuarineQLLKTEVVNRLEQMKTKVLDYKLVKENDIIKKVTLQQIQDNINFLEAKDMHLTHWQDCIEFNRRLDKTRGQDFLAANPKFRPYV*
Ga0098048_114229713300006752MarineKKVTLQQIQDNINFLQAKCMYNTHWQDCIEFNKRLDKTRNQDFLSANPEFKLYV*
Ga0098045_104778223300006922MarineDLLKKVTLQQIQDNINFLEAKCMYDSHWQDCIEFNKRLDKTRNQNFLAANPEFKFYV*
Ga0098051_107865323300006924MarineLKKVTLQQIQDNINFLQAKCMYDTHWQDCIEFNKRLDKTREQDFLAANPEFTSYV*
Ga0099851_124903413300007538AqueousPELKSQVVDKLEAMKTKVLDYKLVKENSIIKSVTLQQIQDNINFLQATCTHDSHWKECIEFNRRLDLTRNQNFLAANPEFKPYV*
Ga0099846_114541913300007542AqueousKVLDYAVIQNNDLLKKVTLQQIQDNINFLESKCMYESHWQDCIRFNRALDKTRNQDFLKANPEFKHYV*
Ga0102945_101908333300007609Pond WaterLIQEHKLLESVTLQQIQDNINFLQAKCMHNSHWKDCIDFNLKLDKTRNQDFFQANPEFKKYA*
Ga0099850_102357113300007960AqueousIGDLEDMKVKVLDYAVIQNNDLLKKVTLQQIQDNINFLESKCMYESHWQDCIRFNRALDKTRNQDFLKANPEFKHYV*
Ga0114350_105042713300008116Freshwater, PlanktonKHALLKTVTLQQIQDNINFLKANDLSRFWPDCVEFNRQLDKTRNQNFLTTNPEFINYV*
Ga0102810_123296323300009002EstuarineQMKTKVLDYKLVKENDIIKKVTLQQIQDNINFLQEKDMHTTHWQDCIEFNKRLDKSRVQYFLLANPEFKQYV*
Ga0102811_102734633300009024EstuarineLLKKVTLQQIQDNINFLQAKCMYKSHWQDCIEFNKRLDTTRGQDFLAANPEFTPYV*
Ga0102814_1011306233300009079EstuarineEVVNRLEQMKTKVLDYKLVKENDIIKKVTLQQIQDNINFLEAKDMHLTHWQDCIEFNRRLDKTRGQDFLAANPKFRPYV*
Ga0102812_1004229013300009086EstuarineNELLKKVTLQQIQDNINFLQAKCMYKSHWQDCIEFNKRLDTTRGQDFLAANPEFTPYV*
Ga0102812_1029941413300009086EstuarineNELLKKVTLQQIQDNINFLQAKCMYKSHWQDCIEFNKRLDKTRGQDFLAANPEFTPYV*
Ga0114994_1080276613300009420MarineMKTEVVDYPLVKQHKLLETVTLQQIQDNINFLESKCMHETHWQDCIEFNKRLDKTRGQDFLAANPEFIPYV*
Ga0115008_1049470913300009436MarineIIKQVTLQQIQDNINFLQAKDMHPTHWQDCIEFNKRLDKTRGQDFLLANPEFKQYV*
Ga0115563_119208923300009442Pelagic MarineQVLPPELKTKVVARLEQMKTEVLEYPLVKQHKLLETVTLQQIQDNINFLESKCMYATHWQDCIEFNKRLDKTRGQDFLTANPEFIPYV*
Ga0115571_100455493300009495Pelagic MarineLEQMKTEVLEYPLVKQHKLLETVTLQQIQDNINFLESKCMYATHWQDCIEFNKRLDKTRGQDFLTANPEFIPYV*
Ga0115571_104271233300009495Pelagic MarineLEQMKTEVLEYPLVKQHKLLETVTLQQIQDNINFLESKCMYATHWQDCIEFNKRLDKTRGQDFLATNPEFMPYV*
Ga0115570_1007628233300009496Pelagic MarinePPELKKQVVERLEQMKTEVLEYPLVKQHKLLETVTLQQIQDNINFLESKCMYATHWQDCIEFNKRLDKTRGQDFLATNPEFMPYV*
Ga0115572_10005425113300009507Pelagic MarineLLKKVTLQQIQDNINFLQAKCMYESHWQDCIEFNKRLDKTRGQDFLSANPEFTAYV*
Ga0115572_1002843253300009507Pelagic MarineLLKKVTLQQIQDNINFLQAKCMYESHWQDCIEFNKRLDKTRKQDFLLANPEFKLYV*
Ga0115004_1042397113300009526MarineKVITRLEQMKTEVLEYPMVKLHKLLETVTLQQIQDNINFLQAKCMYETHWQDCIEFNKRLDETRGQDFLASNPEFVPYV*
Ga0115004_1049937323300009526MarineQQIQDNINFLQAKCMYETHWQDCIEFNKRLDKTRGQDFLAANPEFIPYV*
Ga0136561_105784413300012031Saline LakeKIKEHALLKKVTLQQIQDNINFLQAKCMFDSHWQDCIDFNKRLDATRGQDFLLANPKFGQYV*
Ga0136566_105941613300012145Saline LakeLKQEVVDNLERMKTTVLDYAQIKENTLLEKITLQQIQDNINFLQSKCMYETHWQDCIDFNRRLDASRGQDFLAVNPRFIPYV*
Ga0182063_170346713300016781Salt MarshENELLKKVTLQQIDDNINFLQAKCMYDTHWQDCVNFNRALDKTRGQDFLSVNPEFKNYV
Ga0181401_102275333300017727SeawaterLKKVTLQQIQDNINFLQAKCMHDTHWQDCIAFNHNLDKTRGQDFLTANPEFAPYV
Ga0181433_116284823300017739SeawaterELLKKVTLQQIQDNINFLQAKCMHDTHWQDCIAFNHNLDKTRGQDFLTANPEFAPYV
Ga0181399_104659013300017742SeawaterENELLKKVTLQQIQDNINFLQAKCMYKSHWQDCIEFNKRLDKTRGQDFLAANPEFTPYV
Ga0181400_110353513300017752SeawaterMKTEVLEYPMVKQHKLLETVTLQQIQDNINFLESKCMYDTHWQDCIEFNRRLDKTRGQDFLASNPEFAPYV
Ga0181410_102786413300017763SeawaterIQDNINFLQAKCMHDTHWQDCIAFNHNLDKTRGQDFLTANPEFAPYV
Ga0187217_104520813300017770SeawaterENELLKKVTLQQIQDNINFLQAKCMYKSHWQDCIEFNKRLDTTRGQDFLAANPEFAAYV
Ga0181565_1018511013300017818Salt MarshNLEQMKKKVSDYKLVKENNIIKKVTLQQIQDNINFIQAKDMHKTHWADCVAFNKALDKTRNQDFLKTNPEFAQYV
Ga0181552_1051870713300017824Salt MarshQDNINFLQSKCMYETHWQDCIEFNQALDKTRDQDFLTTTPEFAAYV
Ga0181577_1084935413300017951Salt MarshNLQDMQVTIENYKLIQENKLLKKVTLQQIQDNINFLTAKCMYESHWADCVAFNKALDETRNQDFIKTNPEFAQYV
Ga0181583_1042032413300017952Salt MarshKTKVLDYPLVQQHELLKTVTLQQIQDNINFLEAKCMYETHWQDCIEFNRRLDKTRGQNFLDTNPEFASYV
Ga0181571_1043330013300017957Salt MarshIQDNINFLEAKCMHDTHWQDCVNFNLRLDKTRSQNFFAVNPEFTPYV
Ga0181582_1010962413300017958Salt MarshELLKTVTLQQIQDNINFLEAKCMYDTHWQDCINFNRALDKTRGQDFFSVNPEFKFYV
Ga0181581_1003943253300017962Salt MarshTLQQIQDNINFLEAKCMYDTHWQDCINFNRALDKTRGQDFFSVNPEFKFYV
Ga0181589_1003235953300017964Salt MarshQQIQDNINFLEAKCMYDTHWQDCVNFNRALDKTRKQDFLSVNPEFKFYV
Ga0181576_1025878713300017985Salt MarshVQQHELLKTVTLQQIQDNINFLEAKCMYETHWQDCIEFNRRLDKTRGQNFLDTNPEFASY
Ga0181601_1050972513300018041Salt MarshVLPPELKQKVVERLEQMKIEVLDYPLVQEHKILETLTLQQIQDNINFLNAKCMHESHWKDCINFNRALDKTRKQDFLLANPEFTAYV
Ga0181592_1085031513300018421Salt MarshYKVVSDLEDMKTKILDYAVIKENELLKKVTLQQIQDNINFLQAKCLYDSKWQDCINFNKRLDKTRNQDFLMANPEFKPYV
Ga0181566_1031143723300018426Salt MarshKKQVIERLEQMKTKVLDYPLVQQHELLKTVTLQQIQDNINFLEAKCMHDSHWQDCINFNLKLDKTRNQNFFSVNPEFTPYA
Ga0181568_1038225523300018428Salt MarshQMKHKVLGYSLVKEYDIIKQVTLQQIQDNINFLEAKDMHPTHWQDCVNFNRALDKTRNQDFLTVNPEFAPYV
Ga0182061_134162513300019266Salt MarshLQQIQDNINFLEAKCMHETHWQDCIEFNRRLDKTRGQNFLDTNPEFASYV
Ga0206131_1039709513300020185SeawaterPLVREHKLLEQVTLQQIQDNINFLEAKCMYDTHWKDCVEFNRRLDATRGQDFLATNPEFISYV
Ga0206130_1029040013300020187SeawaterLQQIQDNINFLQAKCMYDTHWQDCIEFNQALDKTRDQDFLSVNSEFKQYV
Ga0213859_1006526213300021364SeawaterITERQVADNINFLKSNCMHDTHWQDCINFNRALDKTRGQDFLSVNPEFAPYV
Ga0213861_1059784713300021378SeawaterLVQENDLLKKVTLQQIQDNINFLQSKCMYDTHWQDCIEFNKRLDKTRNQDFLSANPEFKLYV
Ga0213864_1059740913300021379SeawaterQVINKLEKMKDKVKKYPLVKQNKLLETVTLQQIQDNINFLQAKCMYESHWKDCVDFNRRLDVTRNQNFLTTNPEFIDYV
Ga0222716_1009092143300021959Estuarine WaterNRTLQQIQDNINFLQAKCMYDTHWNDCIEFNRRLDATRGQDFLATNPEFALYV
Ga0196901_120241323300022200AqueousDYAVIQNNDLLKKVTLQQIQDNINFLESKCMYESHWQDCIRFNRALDKTRNQDFLKANPEFKHYV
Ga0255753_107813533300022926Salt MarshSDLEEMKTKILDYAIVQEHELLKKVTLQQIQDNINFLTAKCMYDTHWQDCVNFNRALDKTRGQSFLDTTPEFKQYV
Ga0222690_102523823300023227Saline WaterQHKLLETVTLQQIQDNINFLESKCMHETHWQDCIEFNKRLDKTRGQDFLAANPEFIPYV
Ga0222709_103615923300023230Saline WaterQMKTEVLEYPMVKQHKLLETVTLQQIQDNINFLQAKCMYETHWQDCIEFNKRLDKTRGQDFLAANPEFIPYV
Ga0228602_100021453300024188SeawaterLLKKVTLQQIQDNINFLQAKCMHDTHWQDCIAFNHNLDKTRGQDFLTANPEFAPYV
Ga0228667_109413423300024226SeawaterTKVVNELEQMKSKVLDYKLVKEHDIVKQITLQQIQDNINFIEAKDMHKTHWGDCIEFNKRLDKTRNQDFLSANPEFKPYV
Ga0228633_100772853300024228SeawaterKEKVIKDLEAMKTKVLNYDAIKENELLKKVTLQQIQDNINFLQAKCMHDTHWQDCIAFNHNLDKTRGQDFLTANPEFAPYV
Ga0233399_102462733300024231SeawaterTEVLEYPMVKQHKLLKTVTLQQIQDNINFLEAKCMHETHWQDCIEFNKRLDKTRGQDFLAANPEFAAYV
Ga0228653_104766813300024237SeawaterIQDNINFLQAKCMYESHWQDCIEFNRRLDKTRNQNFLSANPEFESYV
Ga0228673_108231523300024242SeawaterMKETVLTYSLVQENELLKKVTLQQIQDNINFLQAKCMYKSHWQDCIEFNKRLDTTRGQDFLAANPEFTPYV
Ga0228676_106498123300024248SeawaterLEAMKETVLTYSLVQENELLKKVTLQQIQDNINFLQAKCMYKSHWQDCIEFNKRLDTTRGQDFLAANPEFTPYV
(restricted) Ga0233444_1008037633300024264SeawaterTVTLQQIQDNINFLESKCMYETHWQDCIEFNKRLDKTRGQDFLAANPEFTPYV
Ga0228623_107281213300024267SeawaterLEAMKTKVLNYDAIKENELLKKVTLQQIQDNINFLQAKCMHDTHWQDCIAFNHNLDKTRGQDFLTANPEFAPYV
Ga0228658_114397523300024297SeawaterQVLPPELKEQVIAKLEAMKETVLDYPLVKEHELLKTVTLQQIQDNINFLEAKCMYKTHWQDCIEFNKRLDKTRNQDFLTSNPEFAPYV
Ga0228657_101549113300024314SeawaterKVTLQQIQDNINFLQAKCMYKSHWQDCIEFNKRLDTTRGQDFLAANPEFTPYV
Ga0228670_108560523300024319SeawaterELKQKVIARLEQMKTEVLEYPMVKQHKLLKTVTLQQIQDNINFLEAKCMHETHWQDCIEFNKRLDKTRGQDFLAANPEFAAYV
Ga0228656_102356233300024322SeawaterDLEAMKTKVLNYDAIKENELLKKVTLQQIQDNINFLQAKCMHDTHWQDCIAFNHNLDKTRGQDFLTANPEFAPYV
Ga0244775_1009300213300024346EstuarineQENELLKKVTLQQIQDNINFLQAKCMYKSHWQDCIEFNKRLDTTRGQDFLAANPEFTPYV
Ga0244775_1018801913300024346EstuarineQENELLKKVTLQQIQDNINFLQAKCMYKSHWQDCIEFNKRLDKTRGQDFLAANPEFTPYV
Ga0228662_102035333300024415SeawaterAMKTKVLNYDAIKENELLKKVTLQQIQDNINFLQAKCMHDTHWQDCIAFNHNLDKTRGQDFLTANPEFAPYV
Ga0208298_104417313300025084MarineLKKVTLQQIQDNINFLQAKCMYDTHWQDCIEFNKRLDKTREQDFLAANPEFTSYV
Ga0208770_106474213300025438Saline LakeDLKEGVIERLEEMKLEILDYPRIQENKLLETVTRQQIQDNINFLKAKCMYDSHWQDCIDFNMKLDKTRNQSLLQVIPEFKPYV
Ga0209653_101667213300025695MarineTVTLQQIQDNINFLTAKCMHDTHWQDCINFNRALDKTRGQSFLDTTPEFKQYV
Ga0209653_115397513300025695MarineKLLETVTLQQIQDNINFLESKCMYDTHWQDCINFNRALDKTRSQDFLTTNPEFEPYV
Ga0209771_112332313300025701MarineEYPLVKQHKLLETVTLQQIQDNINFLESNCMYTTHWQDCIEFNKRLDKTRGQDFLATNPEFAPYV
Ga0209602_111016723300025704Pelagic MarineKTKVVNDLEYMKIKILDFAVIQENELLKKVTLQQIQDNINFLQAKCMYESHWQDCIEFNKRLDKTRKQDFLLANPEFKLYV
Ga0209555_1024679623300025879MarineLLETVTLQQIQDNINFLESNCMYDTHWHDCIEFNRRLDKTRGQDFLATNPEFIPYV
Ga0228622_107195713300026479SeawaterVKQITLQQIQDNINFIEAKDMHKTHWGDCIEFNKRLDKTRNQDFLSANPEFKPYV
Ga0208021_102745123300027191EstuarineKVTLQQIQDNINFLEAKDMHLTHWQDCIEFNRRLDKTRGQDFLAANPKFRPYV
Ga0208673_100140073300027192EstuarineLVQENELLKKVTLQQIQDNINFLQAKCMYKSHWQDCIEFNKRLDETRGQDFLASNPEFAPYV
Ga0208437_105841423300027525EstuarineENELLKKVTLQQIQDNINFLQAKCMYKSHWQDCIEFNKRLDTTRGQDFLAANPEFTPYV
Ga0208437_111864723300027525EstuarineEVLEYPMVKQHKLLETVTLQQIQDNINFLESKCMYDTHWQDCIEFNQRLDKTRGQDFLASNPEFVPYV
Ga0209037_105380023300027612MarineVQQHKLLETVTLQQIQDNINFLESNCMYTTHWQDCIEFNKRLDKTRGQDFLATNLEFAPY
Ga0209071_104013313300027686MarineKTEIVEYPLVKQHKLLETVTLQQIQDNINFLTSKCMYETHWQDCIEFNHRLDKTRGQDFLAANPEFKPYV
Ga0209302_1038659823300027810MarineEEMKIEVLEYPMVKQHKLLETVTLQQIQDNINFLQAKCMHDTHWQDCINFNHALDKTRSQDFLAANPEFIPYV
Ga0233401_100059013300028127SeawaterLTYSLVQENELLKKVTLQQIQDNINFLQAKCMYKSHWQDCIEFNKRLDTTRGQDFLAANPEFTPYV
Ga0228645_113316913300028128SeawaterPPELKEKVIKDLEAMKTKVLNYDAIKENELLKKVTLQQIQDNINFLQAKCMHDTHWQDCIAFNHNLDKTRGQDFLTANPEFAPYV
Ga0228609_113521123300028133SeawaterKVLNYDAIKENELLKKVTLQQIQDNINFLQAKCMHDTHWQDCIAFNHNLDKTRGQDFLTANPEFAPYV
Ga0228608_116355023300028136SeawaterENKLLKKVTLQQIQDNINFLQAKCMYKSHWQDCIEFNKRLDTTRGQDFLAANPEFTPYV
Ga0228640_102070513300028273SeawaterVPPELKEKVIKDLEAMKAKVLNYDAIKENELLKKVTLQQIQDNINFLQAKCMHDTHWQDCIAFNHNLDKTRGQDFLTANPEFAPYV
Ga0228614_110216213300028416SeawaterMVKQHKLLKTVTLQQIQDNINFLEAKCMHETHWQDCIEFNKRLDKTRGQDFLAANPEFAAYV
Ga0228615_118716223300028418SeawaterKQHKLLKTVTLQQIQDNINFLEAKCMHETHWQDCIEFNKRLDKTRGQDFLAANPEFAAYV
Ga0307996_104595523300031589MarineIQETDLLREVTLQQIQDNINFLQARCMYESHWKDCINFNRALDKTRGQDFLAANPEFTLY
Ga0308016_1036348013300031695MarineEVLEYPMVKQHKLLETVTLQQIQDNINFLQAKCMYETHWQDCIEFNKRLDKTRGQDFLAANPEFIPYV
Ga0307997_1008174713300031706MarineIARLEQMKTEVLEYPMVKQHKLLETVTLQQIQDNINFLQAKCMYETHWQDCIEFNKRLDKTRGQDFLAANPEFIPYV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.