| Basic Information | |
|---|---|
| Family ID | F084065 |
| Family Type | Metagenome |
| Number of Sequences | 112 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MSSILIKNGTLVTMDPANTIVRGDLLIRDERIAEIGS |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 20.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.21 % |
| % of genes from short scaffolds (< 2000 bps) | 93.75 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (52.679 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (14.286 % of family members) |
| Environment Ontology (ENVO) | Unclassified (48.214 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (63.393 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 32.31% Coil/Unstructured: 67.69% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF00154 | RecA | 57.14 |
| PF09720 | Unstab_antitox | 4.46 |
| PF01797 | Y1_Tnp | 2.68 |
| PF14022 | DUF4238 | 1.79 |
| PF00290 | Trp_syntA | 1.79 |
| PF00117 | GATase | 0.89 |
| PF05016 | ParE_toxin | 0.89 |
| PF01979 | Amidohydro_1 | 0.89 |
| PF07510 | DUF1524 | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 57.14 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 2.68 |
| COG0159 | Tryptophan synthase alpha chain | Amino acid transport and metabolism [E] | 1.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 54.46 % |
| Unclassified | root | N/A | 45.54 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_16936729 | Not Available | 2281 | Open in IMG/M |
| 3300002244|JGI24742J22300_10029849 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300004643|Ga0062591_102253362 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300005289|Ga0065704_10196096 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
| 3300005332|Ga0066388_103804800 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300005334|Ga0068869_101884570 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300005338|Ga0068868_100568778 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300005440|Ga0070705_100250751 | All Organisms → cellular organisms → Bacteria | 1242 | Open in IMG/M |
| 3300005444|Ga0070694_101166794 | Not Available | 644 | Open in IMG/M |
| 3300005459|Ga0068867_100408609 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
| 3300005518|Ga0070699_101853505 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300005530|Ga0070679_101492401 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300005545|Ga0070695_101108934 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300005549|Ga0070704_101193235 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300005554|Ga0066661_10720378 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 585 | Open in IMG/M |
| 3300005555|Ga0066692_10871895 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300005556|Ga0066707_10605892 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300005564|Ga0070664_100386272 | All Organisms → cellular organisms → Bacteria | 1279 | Open in IMG/M |
| 3300005568|Ga0066703_10473394 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300005576|Ga0066708_10107502 | All Organisms → cellular organisms → Bacteria | 1666 | Open in IMG/M |
| 3300005587|Ga0066654_10772169 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300005615|Ga0070702_100080501 | All Organisms → cellular organisms → Bacteria | 1949 | Open in IMG/M |
| 3300005615|Ga0070702_101006739 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300005718|Ga0068866_10387192 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300005719|Ga0068861_101313101 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300005840|Ga0068870_10321178 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300005842|Ga0068858_100891551 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300005886|Ga0075286_1028854 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300006046|Ga0066652_100284633 | All Organisms → cellular organisms → Bacteria | 1462 | Open in IMG/M |
| 3300006755|Ga0079222_11246721 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300006880|Ga0075429_101064093 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300006918|Ga0079216_11008886 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300006954|Ga0079219_10023645 | All Organisms → cellular organisms → Bacteria | 2319 | Open in IMG/M |
| 3300009011|Ga0105251_10165321 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300009089|Ga0099828_11284934 | Not Available | 648 | Open in IMG/M |
| 3300009101|Ga0105247_11380094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 569 | Open in IMG/M |
| 3300009101|Ga0105247_11794997 | Not Available | 510 | Open in IMG/M |
| 3300009137|Ga0066709_102663593 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300009143|Ga0099792_10321911 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300009148|Ga0105243_10907013 | Not Available | 877 | Open in IMG/M |
| 3300009148|Ga0105243_12322296 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 574 | Open in IMG/M |
| 3300009156|Ga0111538_13511337 | Not Available | 544 | Open in IMG/M |
| 3300009162|Ga0075423_10884314 | Not Available | 947 | Open in IMG/M |
| 3300009174|Ga0105241_10177368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1765 | Open in IMG/M |
| 3300009174|Ga0105241_10643459 | Not Available | 962 | Open in IMG/M |
| 3300009174|Ga0105241_12494360 | Not Available | 518 | Open in IMG/M |
| 3300009551|Ga0105238_10505011 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Rhabditina → Rhabditomorpha → Rhabditoidea → Rhabditidae → Rhabditidae incertae sedis → Diploscapter → Diploscapter pachys | 1210 | Open in IMG/M |
| 3300009551|Ga0105238_12616357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 541 | Open in IMG/M |
| 3300009553|Ga0105249_11973161 | Not Available | 656 | Open in IMG/M |
| 3300010038|Ga0126315_10268328 | Not Available | 1045 | Open in IMG/M |
| 3300010166|Ga0126306_11208514 | Not Available | 621 | Open in IMG/M |
| 3300010358|Ga0126370_11698638 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300010359|Ga0126376_13281535 | Not Available | 500 | Open in IMG/M |
| 3300010397|Ga0134124_11908299 | Not Available | 630 | Open in IMG/M |
| 3300010397|Ga0134124_12137687 | Not Available | 599 | Open in IMG/M |
| 3300010399|Ga0134127_10536549 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Rhabditina → Rhabditomorpha → Rhabditoidea → Rhabditidae → Rhabditidae incertae sedis → Diploscapter → Diploscapter pachys | 1188 | Open in IMG/M |
| 3300011269|Ga0137392_10980687 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300012205|Ga0137362_10858159 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300012206|Ga0137380_11502733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 558 | Open in IMG/M |
| 3300012208|Ga0137376_11547525 | Not Available | 554 | Open in IMG/M |
| 3300012209|Ga0137379_11399728 | All Organisms → cellular organisms → Bacteria → PVC group | 603 | Open in IMG/M |
| 3300012354|Ga0137366_10023711 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 4774 | Open in IMG/M |
| 3300012354|Ga0137366_10795312 | Not Available | 671 | Open in IMG/M |
| 3300012357|Ga0137384_10820843 | Not Available | 751 | Open in IMG/M |
| 3300012362|Ga0137361_10676215 | Not Available | 944 | Open in IMG/M |
| 3300012362|Ga0137361_11700526 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 550 | Open in IMG/M |
| 3300012530|Ga0136635_10059615 | All Organisms → cellular organisms → Bacteria | 1164 | Open in IMG/M |
| 3300012685|Ga0137397_11363174 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 500 | Open in IMG/M |
| 3300012923|Ga0137359_10670858 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → unclassified Rikenellaceae → Rikenellaceae bacterium | 905 | Open in IMG/M |
| 3300012948|Ga0126375_11810298 | Not Available | 533 | Open in IMG/M |
| 3300012971|Ga0126369_12813771 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300013102|Ga0157371_11532702 | Not Available | 520 | Open in IMG/M |
| 3300013306|Ga0163162_11022996 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 934 | Open in IMG/M |
| 3300013760|Ga0120188_1040649 | Not Available | 569 | Open in IMG/M |
| 3300014166|Ga0134079_10271914 | Not Available | 741 | Open in IMG/M |
| 3300014326|Ga0157380_10918153 | Not Available | 903 | Open in IMG/M |
| 3300014968|Ga0157379_12539277 | Not Available | 513 | Open in IMG/M |
| 3300015262|Ga0182007_10294411 | Not Available | 594 | Open in IMG/M |
| 3300015371|Ga0132258_10402692 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 3400 | Open in IMG/M |
| 3300015373|Ga0132257_102777444 | Not Available | 638 | Open in IMG/M |
| 3300018429|Ga0190272_11370822 | Not Available | 709 | Open in IMG/M |
| 3300018429|Ga0190272_13050271 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 520 | Open in IMG/M |
| 3300018466|Ga0190268_11557892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 579 | Open in IMG/M |
| 3300020215|Ga0196963_10035016 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2114 | Open in IMG/M |
| 3300021968|Ga0193698_1033762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 674 | Open in IMG/M |
| 3300025906|Ga0207699_10693526 | Not Available | 745 | Open in IMG/M |
| 3300025918|Ga0207662_10719353 | Not Available | 700 | Open in IMG/M |
| 3300025921|Ga0207652_11275408 | Not Available | 637 | Open in IMG/M |
| 3300025927|Ga0207687_11045278 | Not Available | 701 | Open in IMG/M |
| 3300025927|Ga0207687_11079081 | Not Available | 689 | Open in IMG/M |
| 3300025933|Ga0207706_11307509 | Not Available | 599 | Open in IMG/M |
| 3300025945|Ga0207679_11127070 | Not Available | 720 | Open in IMG/M |
| 3300025949|Ga0207667_11658108 | Not Available | 607 | Open in IMG/M |
| 3300025949|Ga0207667_11942157 | Not Available | 550 | Open in IMG/M |
| 3300025960|Ga0207651_11282178 | Not Available | 658 | Open in IMG/M |
| 3300025981|Ga0207640_11437162 | Not Available | 618 | Open in IMG/M |
| 3300026075|Ga0207708_11329974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 630 | Open in IMG/M |
| 3300026285|Ga0209438_1120720 | Not Available | 735 | Open in IMG/M |
| 3300026497|Ga0257164_1022397 | Not Available | 906 | Open in IMG/M |
| 3300026536|Ga0209058_1083508 | Not Available | 1667 | Open in IMG/M |
| 3300027875|Ga0209283_10286523 | Not Available | 1089 | Open in IMG/M |
| 3300027915|Ga0209069_10780283 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 569 | Open in IMG/M |
| 3300028380|Ga0268265_11049519 | Not Available | 807 | Open in IMG/M |
| 3300031548|Ga0307408_100911093 | Not Available | 805 | Open in IMG/M |
| 3300031548|Ga0307408_101086321 | Not Available | 741 | Open in IMG/M |
| 3300031720|Ga0307469_11281988 | Not Available | 695 | Open in IMG/M |
| 3300031740|Ga0307468_100113387 | Not Available | 1648 | Open in IMG/M |
| 3300031740|Ga0307468_102373580 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 517 | Open in IMG/M |
| 3300032211|Ga0310896_10822680 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 533 | Open in IMG/M |
| 3300034820|Ga0373959_0170554 | Not Available | 560 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.04% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.04% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.46% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 4.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.57% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.57% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.57% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.57% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.68% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.68% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.68% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.68% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.79% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.79% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.79% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.79% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.89% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.89% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.89% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.89% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.89% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Host-Associated | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005886 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012530 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06) | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013760 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep2 | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300020215 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5 | Environmental | Open in IMG/M |
| 3300021968 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c1 | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_02939370 | 2088090014 | Soil | MTQSILIKNGTIVTMDDSNSMGRGDVLIRDGRIADFSETI |
| JGI24742J22300_100298492 | 3300002244 | Corn, Switchgrass And Miscanthus Rhizosphere | MTNSILIKNGTIVTMDAKDSIVRGDLLIRDGRITSVGEQDT |
| Ga0062591_1022533621 | 3300004643 | Soil | MKSILIKGGTLLTMDRVNTIVRGDLLIDGNRITTIGETGQVADVVV |
| Ga0065704_101960962 | 3300005289 | Switchgrass Rhizosphere | MSSILIRNGTLVTMDSSNTIVRGDLLIRDQRIVEIGGTGQAADT |
| Ga0066388_1038048002 | 3300005332 | Tropical Forest Soil | MIKSILIKGGTIVAMDEKNSIVRGDVLIRDGRIAEVGEKVVGQADE |
| Ga0068869_1018845701 | 3300005334 | Miscanthus Rhizosphere | MSSILIKNGTLVTMDSANNIVRGDLLVSDGRIADIGGSGQTADT |
| Ga0068868_1005687782 | 3300005338 | Miscanthus Rhizosphere | MSILIKNGTLVTMDSANTIKRADLLIEGERIAAISSGDQTAD |
| Ga0070705_1002507511 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MTNSILFKNGTIVTMDADNSIVRGDLLIRDGRIASIGENDAS |
| Ga0070694_1011667941 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSSILFKNGTIVTMDADNSIVRGDLLIRDRRIAALGEQNESGTDEVID |
| Ga0068867_1004086091 | 3300005459 | Miscanthus Rhizosphere | MKSILIKGGTLLTMDEQNSVLNGDLFISDGRLESIGSTVAAADVVID |
| Ga0070699_1018535051 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSILIKNGTLVTMDNANTIVRGDLLINGEHIAAIGGSGQ |
| Ga0070679_1014924012 | 3300005530 | Corn Rhizosphere | MASILIKNGTLVTMDPANTIVRADLLIRDERIAEIGSAGVTV |
| Ga0070695_1011089341 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MTESILIKNGTIVTMDAKDSIVRGDLLIRDGRITSVGEQD |
| Ga0070704_1011932352 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSILIKNGTLVTMDSANNIVRGDLLVSDGRIADIGGSGQTAD |
| Ga0066661_107203781 | 3300005554 | Soil | MSKSLLIKDGTIVTMDISDSIRRGDLLIRDGRITEIAEGIKA |
| Ga0066692_108718952 | 3300005555 | Soil | MSKSILIKNGTIVTMDAKNSLVRGDLLIRDGRIAEVSK |
| Ga0066707_106058923 | 3300005556 | Soil | MSESILIKNGTIVTMDDNNSIVRGDLLIRDGRIAGIGE |
| Ga0070664_1003862721 | 3300005564 | Corn Rhizosphere | MSSILIKNGTLVTMDKANTIVPGDLLINGAHIAAIGET |
| Ga0066703_104733941 | 3300005568 | Soil | MTKAILVKDGTIVTMDESNSIARGDVLIRDGRIAEI |
| Ga0066708_101075023 | 3300005576 | Soil | MSKSLLIKDGTIVTMDTSDSIVRGDLLIRDGRITEIAEGIKA |
| Ga0066654_107721691 | 3300005587 | Soil | MNSILIKGGTLLTMDEQDAIVRGDLLIQDGVISGVGTSHQTAD |
| Ga0070702_1000805013 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSVLIKNGTLVTMDGGDSIVRGDLLVRDQRIVEIGGIGQTADTVIDAA |
| Ga0070702_1010067391 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MNSILIKNGTLLTMDANNSIVRGDLLIRDGRIESMGAATA |
| Ga0068866_103871922 | 3300005718 | Miscanthus Rhizosphere | MSSSILFKNGTIVTMDADNSIVRGDLLIRDRRIAALGEQNES |
| Ga0068861_1013131012 | 3300005719 | Switchgrass Rhizosphere | MSSILIKNGTLVTMDSANNIVRGDLLVSDGRIADIGGSGQTANTVI |
| Ga0068870_103211782 | 3300005840 | Miscanthus Rhizosphere | MSSILIKNGTLVTMDSANAIVRGDVLINGERIAAVGGSHTADTVIDAE |
| Ga0068858_1008915514 | 3300005842 | Switchgrass Rhizosphere | MTKSILIKGGTIVTMDENDSIVRGDVLIREGCIAEIG |
| Ga0075286_10288542 | 3300005886 | Rice Paddy Soil | MSSILIKNGTLVTIDPANTIVRGDLLINGERIVAIG |
| Ga0066652_1002846333 | 3300006046 | Soil | MANSILIKNGTIVTMGESASIGRGDVWIRDGRIAEVGESISSSADETI |
| Ga0079222_112467211 | 3300006755 | Agricultural Soil | MSSILIKNGTLVTMDSANTIVRDDLLINGERIVTIGGSQTAETVIDAEGC |
| Ga0075429_1010640932 | 3300006880 | Populus Rhizosphere | MTQSILIKNGTIVTMDQNNSIVRGDVLIRDGRVAEVAT |
| Ga0079216_110088861 | 3300006918 | Agricultural Soil | MSSILIKNGTVVTMDTRDSIVRGDVLVNDGRITDIGGAGHAA |
| Ga0079219_100236451 | 3300006954 | Agricultural Soil | MTQSILIKNGTIVTIDGENSIVRSDLLIRDGRILSIGGPN |
| Ga0105251_101653211 | 3300009011 | Switchgrass Rhizosphere | MSSVLIKNGTLVTMDNRNSIVRGDLLIRDERIAEI |
| Ga0099828_112849342 | 3300009089 | Vadose Zone Soil | MSESILIKGGRIVTMDDNNSIVRVDLLIRDGRIAGLGGD |
| Ga0105247_113800942 | 3300009101 | Switchgrass Rhizosphere | MKSILIKGGTLLTMDDGNAIVAGDLLIRDGLIASVGES |
| Ga0105247_117949972 | 3300009101 | Switchgrass Rhizosphere | MSSILIKNGTLVTMDPANTVVRGDVLINGERIAAIGGDQ |
| Ga0066709_1015890462 | 3300009137 | Grasslands Soil | MNQSILIKGGTIVTMDQNNSIVSGDLFIREGRIAETGKGIGSDADETI |
| Ga0066709_1026635931 | 3300009137 | Grasslands Soil | MSETILIKGGTIVTMDEKNSIVRGDVLIRNGRIEDVGDH |
| Ga0099792_103219114 | 3300009143 | Vadose Zone Soil | MTQSILIKNGTIVTMDEKNSIVRADVLIREGRVAEVGNHIDANA |
| Ga0105243_109070132 | 3300009148 | Miscanthus Rhizosphere | MSSILIKNGTLVTMDARDSMVQGDILLVDGRIAEIGGTG |
| Ga0105243_123222961 | 3300009148 | Miscanthus Rhizosphere | MKSILIKGGTLLTMDEGNAIVSGDLLIRDGRIASIGES |
| Ga0111538_135113371 | 3300009156 | Populus Rhizosphere | MTESILIKSGTLLTMDKNDSIVRGDLLIRDCKIASLGGTGATADVVI |
| Ga0075423_108843141 | 3300009162 | Populus Rhizosphere | MSASILIKNGTIVTMDAENSIVRGDLLIRDGRIAAG |
| Ga0105241_101773681 | 3300009174 | Corn Rhizosphere | MASILIKDGTLVTMDAANRIVRGDILVVDGRIASIDSAR |
| Ga0105241_106434592 | 3300009174 | Corn Rhizosphere | MSSILIKQGTLVTMDAADSVVRRDLLVENDRITSIGATGQVADIV |
| Ga0105241_124943601 | 3300009174 | Corn Rhizosphere | MSSILIKNGTLVTMDKANTIVSGDLLINGAHIATIGETS |
| Ga0105238_105050112 | 3300009551 | Corn Rhizosphere | MSSIFIKNGTLVTMDSANTVVRDDLLINGERIAAIDGGGQTADTVID |
| Ga0105238_126163572 | 3300009551 | Corn Rhizosphere | MKSILIKNGTLLPMDEGNAIVSGDLLIRDGRIASIGESGQT |
| Ga0105249_119731611 | 3300009553 | Switchgrass Rhizosphere | MKSILIKGGTLLTMDDGNAIVAGDLLIRDGLIASVGESGQTADV |
| Ga0126315_102683282 | 3300010038 | Serpentine Soil | MSSILIKNGTLVTMDSANTIVRGDILVSGGRITDIGGAGQ |
| Ga0126306_112085141 | 3300010166 | Serpentine Soil | MSSILIQNGTLVTMDSANTIVRGDLLVSDGRIVDIGGT |
| Ga0126370_116986382 | 3300010358 | Tropical Forest Soil | MTRSILIRNGTIVTMDQQGTIVTGDVLIRDGRIAEIGAEINE |
| Ga0126376_132815352 | 3300010359 | Tropical Forest Soil | MSSIVIKHGTLVTMDQKDSIVRGDLLIVDGRITSLATS |
| Ga0134124_119082992 | 3300010397 | Terrestrial Soil | MSSVLIKNGTVVTMDTANTIVRGDLLIRDQRIAEIGGTGQTADTVIDAGSCAV |
| Ga0134124_121376871 | 3300010397 | Terrestrial Soil | MKSILIKGGTLLTMDEHNAVVAGDLLIRDGRIASIGEPGRAADLV |
| Ga0134127_105365491 | 3300010399 | Terrestrial Soil | MSSILIKNGTLVTMDARDSMVQGDILVADGRIAEIGGTGHTADTI |
| Ga0137392_109806871 | 3300011269 | Vadose Zone Soil | MSESILIKGGRVVTMDEDDSIVSGDVLIRDGRIASIAEAIDDTV |
| Ga0137362_108581592 | 3300012205 | Vadose Zone Soil | MTKAILVKDGTIVTMDESNSIARGDMLIRDGRIAEIAAEIDDTVNEVI |
| Ga0137380_115027331 | 3300012206 | Vadose Zone Soil | MSESILIKNGTVVTMDGNDSVVRGDLLINDGRIVEIGEGIKADAD |
| Ga0137376_115475251 | 3300012208 | Vadose Zone Soil | MSETILIKGGTVVTMDDRNSIVRGDVLIRNGRIEDVDDKVNLDVD |
| Ga0137379_112255741 | 3300012209 | Vadose Zone Soil | MSQSILIKGGTIVTMDQNNTIVSGDLFIRERRIAEIGNG |
| Ga0137379_113997282 | 3300012209 | Vadose Zone Soil | MAKSILMKHGTIVTMDQDGSVIRGDLLIRDGRIASIGEDLKETTDEI |
| Ga0137366_100237115 | 3300012354 | Vadose Zone Soil | MSESILIKGGIIVTMDQQGSIVRGDVLIRDGCIAEIGEEI |
| Ga0137366_107953122 | 3300012354 | Vadose Zone Soil | MKNSILIKNGALITMDRNRRIVTGDLLVADGRIESIGESIR |
| Ga0137384_108208432 | 3300012357 | Vadose Zone Soil | MNESILIRNGTIVTMDTKGSIAQGDLLIRGGRIAG |
| Ga0137361_106762153 | 3300012362 | Vadose Zone Soil | MSKTVLITNGTVVTMDKSDSIVRGDLLIRDGRIAGLGG |
| Ga0137361_117005261 | 3300012362 | Vadose Zone Soil | MKASIVVKGGTLITMNAENSIVRGDLLIEDGRIVSL |
| Ga0136635_100596153 | 3300012530 | Polar Desert Sand | MNESILIKGGTVVTMDDHDSIVNGDLFISGGQIQAIDGG |
| Ga0137397_113631742 | 3300012685 | Vadose Zone Soil | MEQSILIKGGALVTMDSLDSIVTGDLLIRDGRIASIGE |
| Ga0137359_106708581 | 3300012923 | Vadose Zone Soil | MSKSILIKGGTVVTMDERNSIVRGDLLIRDGHIAGV |
| Ga0126375_118102982 | 3300012948 | Tropical Forest Soil | MQMTESILIKNGTIVTMDEENSIVRGDVLIRDGRIADIAAEIHEAD |
| Ga0126369_128137711 | 3300012971 | Tropical Forest Soil | MTRSILIRNGTIVMMDPQETVVSGDIFIRDGRIAAVGPKI |
| Ga0157371_115327021 | 3300013102 | Corn Rhizosphere | MSSILIENGTVVTMDERDSIVRGDLLVTDGRIASIG |
| Ga0163162_110229962 | 3300013306 | Switchgrass Rhizosphere | MDSILIKNTAIVTMDENNSIVRGDVLIRDGRIAELGDS |
| Ga0120188_10406492 | 3300013760 | Terrestrial | MSSILIKNGTVVTMDARDSIVRGDVLVNDGRIVEIGGAG |
| Ga0134079_102719141 | 3300014166 | Grasslands Soil | MNSILIKGGTLLTMDEQDGIVRGDLLIQDGVISGV |
| Ga0157380_109181531 | 3300014326 | Switchgrass Rhizosphere | MSSVLIKNGTVVTMDNRNSIVRSDVLIRDQRIAEI |
| Ga0157379_125392772 | 3300014968 | Switchgrass Rhizosphere | MSSILIKNATLVMMDSANTIVRGDLLINGERIAAI |
| Ga0182007_102944111 | 3300015262 | Rhizosphere | MSSILIKNGTLVTMDPAHRIIRGDLLISASRITEL |
| Ga0132258_104026925 | 3300015371 | Arabidopsis Rhizosphere | MSSILIKQGTIVTMDEGDSIVRGDLLIEGDRIASIGSNGQTG |
| Ga0132257_1027774441 | 3300015373 | Arabidopsis Rhizosphere | MSESILIKNGTIVTMNAENGIVRGDLLIRNGRIASVGNET |
| Ga0190272_113708222 | 3300018429 | Soil | MSESILIKNGTIVTMDSENSIVRGDLLIRDGRIATVGE |
| Ga0190272_130502711 | 3300018429 | Soil | MKSILIKGGTVITVDTRNSIVRGDLLIRDGRIVAIGDTDETADE |
| Ga0190268_115578921 | 3300018466 | Soil | MMSILIKGGTLVTMDEQDSILRGDLLIRDGRIARV |
| Ga0196963_100350161 | 3300020215 | Soil | MKKSILIKDGTLVTMDRKDSIVVGDLLIRDGRIASLGQASNSADLL |
| Ga0193698_10337621 | 3300021968 | Soil | MSESILIKGGTIVTMDERSSIVRGDLLIRDGRIVEIA |
| Ga0207699_106935261 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSILIKNGTLVTVDPSNRIVPGDLLIAHGRIVALGD |
| Ga0207662_107193532 | 3300025918 | Switchgrass Rhizosphere | MSTILIKNGTLVTMDSANTIVRGDLLIEEGRITSINETGKTADTV |
| Ga0207652_112754082 | 3300025921 | Corn Rhizosphere | MASILIKNGTLVTMDPANTIVRADLLIRDERIAEIGSAGVT |
| Ga0207687_110452782 | 3300025927 | Miscanthus Rhizosphere | MSSILIKNGTLVTMDTANTIVRGDLLINGAHIAAIGDSQTAD |
| Ga0207687_110790811 | 3300025927 | Miscanthus Rhizosphere | MSSILIKNGTLVTMDSANTIVRDDLLINGERIVTIGGSQ |
| Ga0207706_113075092 | 3300025933 | Corn Rhizosphere | MKSILIKGGTLLTMDEQDSVLNGDLLISDGRIESIGSTVAAADVV |
| Ga0207679_111270701 | 3300025945 | Corn Rhizosphere | MSSILIKNGTLVTMDPANPIVRGDLLIRDERIAEIGGTG |
| Ga0207667_116581081 | 3300025949 | Corn Rhizosphere | MSSILIKNGTLVTMDQSNTIVRGDLLVRDERIAEIGS |
| Ga0207667_119421571 | 3300025949 | Corn Rhizosphere | MSSILIKNGTLVTMDSANTIVRDDLLINGERIVTIG |
| Ga0207651_112821781 | 3300025960 | Switchgrass Rhizosphere | MSSILIKNGTLVTMDSANTIVRGDLLINGEHIAVVGGS |
| Ga0207640_114371622 | 3300025981 | Corn Rhizosphere | MSSILIKNGTLVTMDQANTIVRGDLLIRDERITELGST |
| Ga0207708_113299743 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MTQSILIKSGTIVTMDQNNSIVRGDVLIRDGRVAEVATEVNDPGSDII |
| Ga0209438_11207201 | 3300026285 | Grasslands Soil | MKSILIKGGTLLTMDDGNAIVSGNLLIRDGRIASVGESGQ |
| Ga0257164_10223972 | 3300026497 | Soil | MKSILIKGGTLLTMDGQDAIVRGDLLIRDGRITSLGEPGQAA |
| Ga0209058_10835083 | 3300026536 | Soil | MSQSILIKGGTIVTMDANDSVVRGDLLIRDGRIAE |
| Ga0209283_102865232 | 3300027875 | Vadose Zone Soil | MGESILIKGGTVVTMDENDSIVRGDLLIRDGRIAEI |
| Ga0209069_107802831 | 3300027915 | Watersheds | MSESILIKGGTVVTMDENDSIVRGDLLIRDGRIANVGGENAKSADEV |
| Ga0268265_110495192 | 3300028380 | Switchgrass Rhizosphere | MSSILIKNGTLVTMDSANNIVRGDLLVSDGRIADIGGS |
| Ga0307408_1009110931 | 3300031548 | Rhizosphere | MSSILIKNGTLVMMDQQNTIVRGDVLITDGRIAEIAGSGQTA |
| Ga0307408_1010863212 | 3300031548 | Rhizosphere | MSSVLIKNGTLVTMDSANTIVRGDLLVSDGRITGIGS |
| Ga0307469_112819881 | 3300031720 | Hardwood Forest Soil | MTQSILIKNGTIVTMDADDSIVRGDLLIRDRRIAEAG |
| Ga0307468_1001133871 | 3300031740 | Hardwood Forest Soil | MKSILIKGGTILTMDERDAIARGDLLIRDGVIASIGETGQTADIVI |
| Ga0307468_1023735801 | 3300031740 | Hardwood Forest Soil | MSESILIKGGTVVTMDEKNSIVRGDVLIRDGRIAE |
| Ga0310896_108226801 | 3300032211 | Soil | MKSILIKGGTLLTMDRANPIVRGDLLINGNRITTIGQTG |
| Ga0373959_0170554_450_560 | 3300034820 | Rhizosphere Soil | MSSILIKNGTLVTMDPANTIVRGDLLIRDERIAEIGS |
| ⦗Top⦘ |