Metagenome / Metatranscriptome Family F084063

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F084063
Family Type	Metagenome / Metatranscriptome
Number of Sequences	112
Average Sequence Length	39 residues
Representative Sequence	MGSLALLQSLKESVLGQASVKAIYGEPISAHEKTIIPVA
Number of Associated Samples	93
Number of Associated Scaffolds	112

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	100.00 %
% of genes near scaffold ends (potentially truncated)	94.64 %
% of genes from short scaffolds (< 2000 bps)	86.61 %
Associated GOLD sequencing projects	90
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (89.286 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.286 % of family members)
Environment Ontology (ENVO)	Unclassified (28.571 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (49.107 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Fibrous	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 31.34% β-sheet: 8.96% Coil/Unstructured: 59.70%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.37
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 112 Family Scaffolds
PF14534	DUF4440	2.68
PF02567	PhzC-PhzF	2.68
PF09579	Spore_YtfJ	1.79
PF13649	Methyltransf_25	1.79
PF03448	MgtE_N	0.89
PF00326	Peptidase_S9	0.89
PF00589	Phage_integrase	0.89
PF00754	F5_F8_type_C	0.89
PF01757	Acyl_transf_3	0.89
PF07676	PD40	0.89
PF00484	Pro_CA	0.89
PF13676	TIR_2	0.89
PF02308	MgtC	0.89
PF01834	XRCC1_N	0.89
PF13544	Obsolete Pfam Family	0.89
PF04366	Ysc84	0.89
PF00132	Hexapep	0.89
PF00782	DSPc	0.89
PF06778	Chlor_dismutase	0.89
PF13360	PQQ_2	0.89
PF00848	Ring_hydroxyl_A	0.89
PF03473	MOSC	0.89
PF00011	HSP20	0.89
PF01243	Putative_PNPOx	0.89
PF16576	HlyD_D23	0.89
PF07681	DoxX	0.89
PF07786	HGSNAT_cat	0.89
PF03167	UDG	0.89
PF00903	Glyoxalase	0.89
PF00232	Glyco_hydro_1	0.89
PF14294	DUF4372	0.89
PF00873	ACR_tran	0.89
PF00719	Pyrophosphatase	0.89
PF00072	Response_reg	0.89

COG ID	Name	Functional Category	% Frequency in 112 Family Scaffolds
COG0384	Predicted epimerase YddE/YHI9, PhzF superfamily	General function prediction only [R]	2.68
COG4638	Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunit	Inorganic ion transport and metabolism [P]	1.79
COG2259	Uncharacterized membrane protein YphA, DoxX/SURF4 family	Function unknown [S]	0.89
COG4270	Uncharacterized membrane protein	Function unknown [S]	0.89
COG3663	G:T/U-mismatch repair DNA glycosylase	Replication, recombination and repair [L]	0.89
COG3503	Uncharacterized membrane protein, DUF1624 family	Function unknown [S]	0.89
COG3253	Coproheme decarboxylase/chlorite dismutase	Coenzyme transport and metabolism [H]	0.89
COG3174	Membrane component of predicted Mg2+ transport system, contains DUF4010 domain	Inorganic ion transport and metabolism [P]	0.89
COG2930	Lipid-binding SYLF domain, Ysc84/FYVE family	Lipid transport and metabolism [I]	0.89
COG2723	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase	Carbohydrate transport and metabolism [G]	0.89
COG0071	Small heat shock protein IbpA, HSP20 family	Posttranslational modification, protein turnover, chaperones [O]	0.89
COG2239	Mg/Co/Ni transporter MgtE (contains CBS domain)	Inorganic ion transport and metabolism [P]	0.89
COG1573	Uracil-DNA glycosylase	Replication, recombination and repair [L]	0.89
COG1285	Magnesium uptake protein YhiD/SapB, involved in acid resistance	Inorganic ion transport and metabolism [P]	0.89
COG0692	Uracil-DNA glycosylase	Replication, recombination and repair [L]	0.89
COG0288	Carbonic anhydrase	Inorganic ion transport and metabolism [P]	0.89
COG0221	Inorganic pyrophosphatase	Energy production and conversion [C]	0.89

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	89.29 %
Unclassified	root	N/A	10.71 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	89.29 %
Unclassified	root	N/A	10.71 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	89.29 %
Unclassified	root	N/A	10.71 %

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	34.82 %
Unclassified	root	N/A	10.71 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.89 %

Name	Rank	Taxonomy	Distribution
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	11.61 %
Unclassified	root	N/A	10.71 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	9.82 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	0.89 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	11.61 %
Unclassified	root	N/A	10.71 %
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	9.82 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.89 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	11.61 %
Unclassified	root	N/A	10.71 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	9.82 %
Chitinophagia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia	0.89 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	11.61 %
Unclassified	root	N/A	10.71 %
Candidatus Sulfotelmatobacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter	3.57 %
Candidatus Koribacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	1.79 %
Granulicella	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella	0.89 %
Chitinophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales	0.89 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	11.61 %
Unclassified	root	N/A	10.71 %
unclassified Candidatus Sulfotelmatobacter	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter	3.57 %
Candidatus Koribacter versatilis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	1.79 %
Chitinophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	0.89 %
Granulicella	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella	0.89 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	11.61 %
Unclassified	root	N/A	10.71 %
Candidatus Sulfotelmatobacter sp. SbA7	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7	3.57 %
Candidatus Koribacter versatilis Ellin345	isolate	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345	1.79 %
Segetibacter	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Segetibacter	0.89 %
Granulicella	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella	0.89 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	11.61 %
Unclassified	root	N/A	10.71 %
Candidatus Sulfotelmatobacter sp. SbA7	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7	3.57 %
Candidatus Koribacter versatilis Ellin345	isolate	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345	1.79 %
Segetibacter koreensis	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Segetibacter → Segetibacter koreensis	0.89 %
Granulicella	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella	0.89 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000364\|INPhiseqgaiiFebDRAFT_101465854	All Organisms → cellular organisms → Bacteria	1416	Open in IMG/M
3300000955\|JGI1027J12803_104064796	All Organisms → cellular organisms → Bacteria	667	Open in IMG/M
3300004092\|Ga0062389_103458345	All Organisms → cellular organisms → Bacteria	592	Open in IMG/M
3300004631\|Ga0058899_10187717	All Organisms → cellular organisms → Bacteria	1070	Open in IMG/M
3300005167\|Ga0066672_11006181	All Organisms → cellular organisms → Bacteria	509	Open in IMG/M
3300005177\|Ga0066690_10178498	All Organisms → cellular organisms → Bacteria	1406	Open in IMG/M
3300005439\|Ga0070711_100455560	All Organisms → cellular organisms → Bacteria	1048	Open in IMG/M
3300005534\|Ga0070735_10722057	All Organisms → cellular organisms → Bacteria	588	Open in IMG/M
3300005538\|Ga0070731_10479989	All Organisms → cellular organisms → Bacteria	827	Open in IMG/M
3300005541\|Ga0070733_10407965	All Organisms → cellular organisms → Bacteria	905	Open in IMG/M
3300005591\|Ga0070761_10898264	All Organisms → cellular organisms → Bacteria	560	Open in IMG/M
3300005617\|Ga0068859_102684050	All Organisms → cellular organisms → Bacteria	547	Open in IMG/M
3300005618\|Ga0068864_101580336	All Organisms → cellular organisms → Bacteria	660	Open in IMG/M
3300005712\|Ga0070764_10874852	All Organisms → cellular organisms → Bacteria	562	Open in IMG/M
3300005719\|Ga0068861_100187274	All Organisms → cellular organisms → Bacteria	1727	Open in IMG/M
3300006755\|Ga0079222_11365837	All Organisms → cellular organisms → Bacteria	652	Open in IMG/M
3300006755\|Ga0079222_12621194	Not Available	507	Open in IMG/M
3300006797\|Ga0066659_10371333	All Organisms → cellular organisms → Bacteria	1116	Open in IMG/M
3300006800\|Ga0066660_10682522	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Segetibacter → Segetibacter koreensis	847	Open in IMG/M
3300006893\|Ga0073928_11063781	All Organisms → cellular organisms → Bacteria	549	Open in IMG/M
3300007255\|Ga0099791_10489915	All Organisms → cellular organisms → Bacteria → Acidobacteria	596	Open in IMG/M
3300009089\|Ga0099828_11924704	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	519	Open in IMG/M
3300009092\|Ga0105250_10036241	All Organisms → cellular organisms → Bacteria	1979	Open in IMG/M
3300009137\|Ga0066709_104526049	Not Available	508	Open in IMG/M
3300009174\|Ga0105241_12233969	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	543	Open in IMG/M
3300009792\|Ga0126374_11155925	All Organisms → cellular organisms → Bacteria	617	Open in IMG/M
3300010048\|Ga0126373_12963524	All Organisms → cellular organisms → Bacteria	529	Open in IMG/M
3300010361\|Ga0126378_13147471	All Organisms → cellular organisms → Bacteria	525	Open in IMG/M
3300010398\|Ga0126383_13284369	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	528	Open in IMG/M
3300010398\|Ga0126383_13379751	All Organisms → cellular organisms → Bacteria → Acidobacteria	521	Open in IMG/M
3300012189\|Ga0137388_11932436	All Organisms → cellular organisms → Bacteria → Acidobacteria	520	Open in IMG/M
3300012199\|Ga0137383_10260326	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1271	Open in IMG/M
3300012202\|Ga0137363_10051373	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2958	Open in IMG/M
3300012202\|Ga0137363_11575983	All Organisms → cellular organisms → Bacteria	549	Open in IMG/M
3300012206\|Ga0137380_10045387	All Organisms → cellular organisms → Bacteria	4038	Open in IMG/M
3300012349\|Ga0137387_10445521	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	939	Open in IMG/M
3300012362\|Ga0137361_10533229	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1077	Open in IMG/M
3300012918\|Ga0137396_10618222	All Organisms → cellular organisms → Bacteria	801	Open in IMG/M
3300012989\|Ga0164305_11075183	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	689	Open in IMG/M
3300013102\|Ga0157371_10110731	All Organisms → cellular organisms → Bacteria	1949	Open in IMG/M
3300013296\|Ga0157374_10006802	All Organisms → cellular organisms → Bacteria → Acidobacteria	9725	Open in IMG/M
3300013296\|Ga0157374_10539749	All Organisms → cellular organisms → Bacteria	1173	Open in IMG/M
3300013296\|Ga0157374_12084538	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	594	Open in IMG/M
3300014489\|Ga0182018_10251554	All Organisms → cellular organisms → Bacteria	972	Open in IMG/M
3300017927\|Ga0187824_10126652	All Organisms → cellular organisms → Bacteria → Acidobacteria	835	Open in IMG/M
3300017970\|Ga0187783_10458502	All Organisms → cellular organisms → Bacteria → Acidobacteria	925	Open in IMG/M
3300018020\|Ga0187861_10346956	All Organisms → cellular organisms → Bacteria	629	Open in IMG/M
3300018026\|Ga0187857_10505610	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345	541	Open in IMG/M
3300018034\|Ga0187863_10122682	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7	1453	Open in IMG/M
3300018037\|Ga0187883_10149309	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345	1203	Open in IMG/M
3300018037\|Ga0187883_10247135	All Organisms → cellular organisms → Bacteria → Acidobacteria	913	Open in IMG/M
3300018047\|Ga0187859_10041901	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7	2447	Open in IMG/M
3300018060\|Ga0187765_11393985	Not Available	500	Open in IMG/M
3300019890\|Ga0193728_1225169	All Organisms → cellular organisms → Bacteria	770	Open in IMG/M
3300020579\|Ga0210407_10065688	All Organisms → cellular organisms → Bacteria → Acidobacteria	2720	Open in IMG/M
3300020580\|Ga0210403_10006892	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	9505	Open in IMG/M
3300020583\|Ga0210401_10142965	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	2237	Open in IMG/M
3300020583\|Ga0210401_11043031	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	676	Open in IMG/M
3300021170\|Ga0210400_11421829	Not Available	552	Open in IMG/M
3300021180\|Ga0210396_10617258	All Organisms → cellular organisms → Bacteria	942	Open in IMG/M
3300021181\|Ga0210388_11302076	All Organisms → cellular organisms → Bacteria	613	Open in IMG/M
3300021404\|Ga0210389_11206823	All Organisms → cellular organisms → Bacteria	582	Open in IMG/M
3300021404\|Ga0210389_11366794	All Organisms → cellular organisms → Bacteria → Acidobacteria	541	Open in IMG/M
3300021404\|Ga0210389_11405016	All Organisms → cellular organisms → Bacteria	532	Open in IMG/M
3300021405\|Ga0210387_10096254	All Organisms → cellular organisms → Bacteria → Acidobacteria	2468	Open in IMG/M
3300021433\|Ga0210391_11578024	Not Available	502	Open in IMG/M
3300021478\|Ga0210402_11866625	All Organisms → cellular organisms → Bacteria	527	Open in IMG/M
3300021559\|Ga0210409_11254258	Not Available	617	Open in IMG/M
3300021560\|Ga0126371_10132322	All Organisms → cellular organisms → Bacteria	2535	Open in IMG/M
3300021560\|Ga0126371_11383480	All Organisms → cellular organisms → Bacteria	835	Open in IMG/M
3300022521\|Ga0224541_1028862	All Organisms → cellular organisms → Bacteria	598	Open in IMG/M
3300022557\|Ga0212123_10110105	Not Available	2220	Open in IMG/M
3300022557\|Ga0212123_10358218	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7	994	Open in IMG/M
3300022557\|Ga0212123_10891920	All Organisms → cellular organisms → Bacteria	524	Open in IMG/M
3300023250\|Ga0224544_1062429	Not Available	539	Open in IMG/M
3300023255\|Ga0224547_1029179	All Organisms → cellular organisms → Bacteria	709	Open in IMG/M
3300025898\|Ga0207692_10825088	All Organisms → cellular organisms → Bacteria	607	Open in IMG/M
3300025906\|Ga0207699_11110959	All Organisms → cellular organisms → Bacteria	585	Open in IMG/M
3300025928\|Ga0207700_11329914	Not Available	640	Open in IMG/M
3300025935\|Ga0207709_11218119	All Organisms → cellular organisms → Bacteria	621	Open in IMG/M
3300025940\|Ga0207691_10834312	All Organisms → cellular organisms → Bacteria	773	Open in IMG/M
3300025986\|Ga0207658_10157528	All Organisms → cellular organisms → Bacteria	1857	Open in IMG/M
3300025986\|Ga0207658_10391257	All Organisms → cellular organisms → Bacteria	1220	Open in IMG/M
3300026088\|Ga0207641_10011220	All Organisms → cellular organisms → Bacteria	7352	Open in IMG/M
3300026088\|Ga0207641_11662677	All Organisms → cellular organisms → Bacteria	640	Open in IMG/M
3300026329\|Ga0209375_1050473	All Organisms → cellular organisms → Bacteria	2077	Open in IMG/M
3300026524\|Ga0209690_1165497	Not Available	777	Open in IMG/M
3300026557\|Ga0179587_11025241	All Organisms → cellular organisms → Bacteria	543	Open in IMG/M
3300027069\|Ga0208859_1017364	All Organisms → cellular organisms → Bacteria	811	Open in IMG/M
3300027616\|Ga0209106_1062591	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7	833	Open in IMG/M
3300027867\|Ga0209167_10219041	All Organisms → cellular organisms → Bacteria	1017	Open in IMG/M
3300027869\|Ga0209579_10001633	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	18193	Open in IMG/M
3300027869\|Ga0209579_10434897	All Organisms → cellular organisms → Bacteria → Acidobacteria	712	Open in IMG/M
3300027895\|Ga0209624_10248507	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1183	Open in IMG/M
3300028047\|Ga0209526_10468394	All Organisms → cellular organisms → Bacteria	826	Open in IMG/M
3300028800\|Ga0265338_11129457	All Organisms → cellular organisms → Bacteria	527	Open in IMG/M
3300028906\|Ga0308309_10354724	All Organisms → cellular organisms → Bacteria	1251	Open in IMG/M
3300028906\|Ga0308309_10516417	All Organisms → cellular organisms → Bacteria → Acidobacteria	1033	Open in IMG/M
3300031236\|Ga0302324_100686164	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella	1449	Open in IMG/M
3300031573\|Ga0310915_11263789	All Organisms → cellular organisms → Bacteria	509	Open in IMG/M
3300031715\|Ga0307476_10195291	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1468	Open in IMG/M
3300031720\|Ga0307469_10134160	All Organisms → cellular organisms → Bacteria	1819	Open in IMG/M
3300031820\|Ga0307473_10502531	All Organisms → cellular organisms → Bacteria	818	Open in IMG/M
3300031820\|Ga0307473_11169032	All Organisms → cellular organisms → Bacteria	570	Open in IMG/M
3300031823\|Ga0307478_10081246	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2475	Open in IMG/M
3300031962\|Ga0307479_10286501	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1628	Open in IMG/M
3300031962\|Ga0307479_10395468	All Organisms → cellular organisms → Bacteria → Acidobacteria	1367	Open in IMG/M
3300032895\|Ga0335074_10006537	All Organisms → cellular organisms → Bacteria	16184	Open in IMG/M
3300032895\|Ga0335074_11532424	All Organisms → cellular organisms → Bacteria → Acidobacteria	527	Open in IMG/M
3300032898\|Ga0335072_10408833	Not Available	1452	Open in IMG/M
3300033158\|Ga0335077_10911294	All Organisms → cellular organisms → Bacteria → Acidobacteria	885	Open in IMG/M
3300033289\|Ga0310914_10950957	Not Available	759	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	85.71%
Host-Associated	Host-Associated	14.29%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	75.00%
Plants	Host-Associated → Plants	14.29%
Aquatic	Environmental → Aquatic	10.71%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	71.43%
Rhizosphere	Host-Associated → Plants → Rhizosphere	9.82%
Freshwater	Environmental → Aquatic → Freshwater	7.14%
Rhizoplane	Host-Associated → Plants → Rhizoplane	4.46%
Thermal Springs	Environmental → Aquatic → Thermal Springs	3.57%
Peat	Environmental → Terrestrial → Peat	3.57%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	53.57%
Loam	Environmental → Terrestrial → Soil → Loam	11.61%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	7.14%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	6.25%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	6.25%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	4.46%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	3.57%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	3.57%
Soil	Host-Associated → Plants → Rhizosphere → Soil	3.57%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	23.21%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	20.54%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	8.04%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	8.04%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	6.25%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	6.25%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	5.36%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	4.46%
Acidic	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic	3.57%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	3.57%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	3.57%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	3.57%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.79%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.89%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	0.89%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	14.29%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	9.82%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	7.14%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	6.25%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	6.25%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	5.36%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	5.36%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	4.46%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	4.46%
Iron-Sulfur Acid Spring	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring	3.57%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	3.57%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	3.57%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	3.57%
Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil	2.68%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.68%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.79%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.79%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	1.79%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.79%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	0.89%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	0.89%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.89%
Palsa	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa	0.89%
Palsa	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa	0.89%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.89%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.89%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.89%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.89%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	0.89%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.89%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000955	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300004092	Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3	Environmental	Open in IMG/M
3300004631	Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005167	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121	Environmental	Open in IMG/M
3300005177	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139	Environmental	Open in IMG/M
3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Environmental	Open in IMG/M
3300005534	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1	Environmental	Open in IMG/M
3300005538	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1	Environmental	Open in IMG/M
3300005541	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1	Environmental	Open in IMG/M
3300005591	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1	Environmental	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005712	Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4	Environmental	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006797	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108	Environmental	Open in IMG/M
3300006800	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109	Environmental	Open in IMG/M
3300006893	Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG	Environmental	Open in IMG/M
3300007255	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1	Environmental	Open in IMG/M
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental	Open in IMG/M
3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental	Open in IMG/M
3300012202	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG	Environmental	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012349	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012918	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG	Environmental	Open in IMG/M
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental	Open in IMG/M
3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Host-Associated	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300014489	Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG	Environmental	Open in IMG/M
3300017927	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4	Environmental	Open in IMG/M
3300017970	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG	Environmental	Open in IMG/M
3300018020	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100	Environmental	Open in IMG/M
3300018026	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100	Environmental	Open in IMG/M
3300018034	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10	Environmental	Open in IMG/M
3300018037	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10	Environmental	Open in IMG/M
3300018047	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10	Environmental	Open in IMG/M
3300018060	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG	Environmental	Open in IMG/M
3300019890	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1	Environmental	Open in IMG/M
3300020579	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M	Environmental	Open in IMG/M
3300020580	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M	Environmental	Open in IMG/M
3300020583	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M	Environmental	Open in IMG/M
3300021170	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M	Environmental	Open in IMG/M
3300021180	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O	Environmental	Open in IMG/M
3300021181	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O	Environmental	Open in IMG/M
3300021404	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O	Environmental	Open in IMG/M
3300021405	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O	Environmental	Open in IMG/M
3300021433	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O	Environmental	Open in IMG/M
3300021478	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M	Environmental	Open in IMG/M
3300021559	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300022521	Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 20-24	Environmental	Open in IMG/M
3300022557	Paint Pots_combined assembly	Environmental	Open in IMG/M
3300023250	Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14	Environmental	Open in IMG/M
3300023255	Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 10-14	Environmental	Open in IMG/M
3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026329	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes)	Environmental	Open in IMG/M
3300026524	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes)	Environmental	Open in IMG/M
3300026557	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal	Environmental	Open in IMG/M
3300027069	Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF002 (SPAdes)	Environmental	Open in IMG/M
3300027616	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes)	Environmental	Open in IMG/M
3300027867	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027869	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027895	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)	Environmental	Open in IMG/M
3300028047	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)	Environmental	Open in IMG/M
3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Host-Associated	Open in IMG/M
3300028906	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)	Environmental	Open in IMG/M
3300031236	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1	Environmental	Open in IMG/M
3300031573	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111	Environmental	Open in IMG/M
3300031715	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031820	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515	Environmental	Open in IMG/M
3300031823	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05	Environmental	Open in IMG/M
3300031962	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515	Environmental	Open in IMG/M
3300032895	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3	Environmental	Open in IMG/M
3300032898	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1	Environmental	Open in IMG/M
3300033158	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1	Environmental	Open in IMG/M
3300033289	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
INPhiseqgaiiFebDRAFT_1014658543	3300000364	Soil	MSSLALLQSLKESILTQANVKAVYGEPIAAQGKTVVPVAKI
JGI1027J12803_1040647962	3300000955	Soil	MGSLALLQALKESVLGQANVNAIYGEPISAHEKTIIPVAK
Ga0062389_1034583451	3300004092	Bog Forest Soil	MGSVALLQSLKESIFSHVGVKAIYGEPISAQGKTVIPVAKLMY
Ga0058899_101877171	3300004631	Forest Soil	MGSLAILQSLKESVLGQASVKAIYGEPISAQGKTVIPVAKVMYA
Ga0066672_110061812	3300005167	Soil	MGSLALLQSLKESILGQANVKAIYGEPISAHDKTIIPVAK
Ga0066690_101784983	3300005177	Soil	MGSLALLQSLRDSVLTQASVKTIYGEPIAAQGKTIIPVAR
Ga0070711_1004555602	3300005439	Corn, Switchgrass And Miscanthus Rhizosphere	MGSLALLQSLKESILGQANVKAIYGEPISAHEKTIIPVAKIMY
Ga0070735_107220572	3300005534	Surface Soil	MSSVAILQSLKESIAAANVKAVYGEPIAAQGKTIIPVAKI
Ga0070731_104799893	3300005538	Surface Soil	MSSVAILQSLTESILTANVKAVFGEPIAAQGKTVIPVAKIIFGY
Ga0070733_104079651	3300005541	Surface Soil	MSTLAVLESLKESILSQASVKAIYGEPISAHGRTV
Ga0070761_108982641	3300005591	Soil	MSSLALLQSLKESILLQANVKAISGEPIVAHGKTVIPAEKIMYP
Ga0068859_1026840502	3300005617	Switchgrass Rhizosphere	MGSLALLQSLKESILGQASVKTIYGEPILSQGKTI
Ga0068864_1015803362	3300005618	Switchgrass Rhizosphere	MGSLALLQYLKESVLGQANVKAIYGEPISAHEKTIIPVAKIMY
Ga0070764_108748521	3300005712	Soil	MSSLAILQSLKESILTANVKAVYGEPIAAQGKTIIPVAK
Ga0068861_1001872741	3300005719	Switchgrass Rhizosphere	MGSLALLQSLKDSVLGQANVKTIYGEPISAHEKTIIPVAKIM
Ga0079222_113658371	3300006755	Agricultural Soil	MSSLALLQSLKDTIITQANVKSVYGEPIAAQGKTIVPVAKII
Ga0079222_126211942	3300006755	Agricultural Soil	MSSLAILQSLKESILTEANVKTIYGEPIDAQGKTIIPVAKIVF
Ga0066659_103713331	3300006797	Soil	MSTQALLQSLKESILSQASVKAIYGEPIAAHGKTVIQVARIM
Ga0066660_106825221	3300006800	Soil	MGSLALLQSLRDSVLTQASVKTIYGEPIAAQGKTIIP
Ga0073928_110637812	3300006893	Iron-Sulfur Acid Spring	VPYFGVSEMSTQALLQSLKESVLSQASVKALYGEPISAHGKTVIPVAK*
Ga0099791_104899151	3300007255	Vadose Zone Soil	MFSFKEFPMGSLALLQSLKESILGQASVKAIYGEPISAHEK
Ga0099828_119247041	3300009089	Vadose Zone Soil	MGSLALLQSLKDSVLTQASVKTIYGEPIAAQGKTIIPVA
Ga0105250_100362411	3300009092	Switchgrass Rhizosphere	MGSLALLQSLKDSVLGQANVKTIYGEPISAHEKTII
Ga0066709_1045260491	3300009137	Grasslands Soil	MSSLALLQSLKESILTQANVKAVYGEPIAAQGQTVVPVA
Ga0105241_122339691	3300009174	Corn Rhizosphere	MGSLALLQTLKDSVLSQASVKAIYGEPISAQGKTIIPVARIT
Ga0126374_111559252	3300009792	Tropical Forest Soil	MGSLAILQSLKESVLGQANVKAIYGEPISAHEKTIIPVAKIM*
Ga0126373_129635241	3300010048	Tropical Forest Soil	MGSLALLQSLKESVLSQANVKAIYGEPVSAHDKTIIPVARI
Ga0126378_131474713	3300010361	Tropical Forest Soil	MGSLALLQSLKESVLGQASVKAIYGEPISAHEKTI
Ga0126383_132843692	3300010398	Tropical Forest Soil	MGSIALLQSLKESVLGQANVKAIYGEPISAHEKTIIPVA
Ga0126383_133797512	3300010398	Tropical Forest Soil	MEVPMGSVALLQSVKDGILSQASVKAIYGDPVAAHGKT
Ga0137388_119324361	3300012189	Vadose Zone Soil	MGSVMLLQSLKDGILSQASVKAIYGEPIVAQGKTIIPV
Ga0137383_102603263	3300012199	Vadose Zone Soil	MSTLAVLQSLKESILSQASVKAIYGEPIAAQGKTVIPIAKI
Ga0137363_100513731	3300012202	Vadose Zone Soil	MSALALLQSLKESILSQASVKAIYGEPIVAQGKTVIPV
Ga0137363_115759832	3300012202	Vadose Zone Soil	MGSLALLQSLKESILGQANVNAIYGEPISAHDKTIIP
Ga0137380_100453876	3300012206	Vadose Zone Soil	MSTHALLQSLKESILSQASVKAIYGEPIAAQGRTVIRLPK*
Ga0137387_104455211	3300012349	Vadose Zone Soil	MSTLAVLQSLKESILSQASVKPIYGEPNAAQGKTVIPVAKIMY
Ga0137361_105332294	3300012362	Vadose Zone Soil	MSALALLQSLKESILSQASVKAIYGEPIVAQGKTVIPVAKI
Ga0137396_106182222	3300012918	Vadose Zone Soil	MGSVALLQSLKESILGQASVKTIYGEPVSTHGKTIIPV
Ga0164305_110751832	3300012989	Soil	MSSSLALLQSLKESILTQANVKAVYGEPITTQGKTIVP
Ga0157371_101107311	3300013102	Corn Rhizosphere	MGSLALLQSLKDSVLGQANVKTIYGEPISAHEKTIIPVAKIMY
Ga0157374_1000680213	3300013296	Miscanthus Rhizosphere	MGSLALLQSLKESVLGQANVKAIYGEPISAHEKTIIPVAKI
Ga0157374_105397491	3300013296	Miscanthus Rhizosphere	VGSLALLQSLKESVLGQANVKAIYGEPISAHEKTIIPVAKI
Ga0157374_120845381	3300013296	Miscanthus Rhizosphere	MGSLALLQSLKESILGQASVKTIYGEPILSQGKTII
Ga0182018_102515542	3300014489	Palsa	MGSVALLQSLKESILGQVSVKTIYGEPIPAHGKTII
Ga0187824_101266521	3300017927	Freshwater Sediment	MSSVAILQSLKESIVSANVKAVYGEPVVAQGKTIIPVAKIM
Ga0187783_104585021	3300017970	Tropical Peatland	MGALSLLQSLKESVLTQASVKSIYGEPIAAQGKTVIPV
Ga0187861_103469561	3300018020	Peatland	MSTQALLQSLKESILSQASVKAIYGEPISANGKTVIPV
Ga0187857_105056102	3300018026	Peatland	MSTQALLQSLKESILSQASVKAIYGEPISAHGKTVIP
Ga0187863_101226821	3300018034	Peatland	MGSVALLQSLKEGILGQASVKTIYGEAVSAHGKTIIPV
Ga0187883_101493092	3300018037	Peatland	MSTQALLQSLKESILSQASVKAIYGEPISAHGKTVI
Ga0187883_102471351	3300018037	Peatland	MSTLAILQSLKESILSQASVKAIYGEPISAHGKTVIPVARIMY
Ga0187859_100419011	3300018047	Peatland	VSSVALLQSLKDGILGQVSVKTIYGEPVSAHGKTIIPV
Ga0187765_113939852	3300018060	Tropical Peatland	MSSVAILQSLKESIVTANVKAIYGEPIAAQGKTVIPVAKIIY
Ga0193728_12251692	3300019890	Soil	MSTQALLQSLKESILSQASVKAIYGEPISAQGKTVIPIAK
Ga0210407_100656882	3300020579	Soil	MSSLALLQSLKDSILGQASVKAIYGEPISAHGKTVVP
Ga0210403_100068928	3300020580	Soil	MGSVALLQSLKESILGQASVKTIYGEPISAHGKTIIPV
Ga0210401_101429652	3300020583	Soil	MGSLAILQSLKESVLGQASVKAIYGEPISAQGKTVI
Ga0210401_110430311	3300020583	Soil	MSSLALLQSLKDSVLGQASVKAIYGEPISAHGKTV
Ga0210400_114218293	3300021170	Soil	MSSPPPLQSLKESILSQANVKAIYGEPITAHFKNGHP
Ga0210396_106172583	3300021180	Soil	MGSVALLQSLRDSILGQAGVKAVYGEPISAQGKTVIPVAK
Ga0210388_113020762	3300021181	Soil	MGSLALLQSLKESVTSQASVKTLYGEPISAHEKTIIPVAKIM
Ga0210389_112068232	3300021404	Soil	MGSLALLQSLKESVTSQASVKTLYGEPISAHEKTIIPVAK
Ga0210389_113667942	3300021404	Soil	MGSVALLQSLKESILSGAGVKAIYGEPITAQGKTVIPV
Ga0210389_114050161	3300021404	Soil	MGSVALLQSLKDGILGQANVKTIYGEPIPANGKTIIPVA
Ga0210387_100962541	3300021405	Soil	MALLQSLKESILSQASAKAIYGEPVSALGKTVIPVAKIMYG
Ga0210391_115780242	3300021433	Soil	MSTLAVLQSLKESVLSQASVKAIYGEPISAHGKTVVP
Ga0210402_118666251	3300021478	Soil	MSALTILQSLKESILSQANVKAIYGDPITAHGKTV
Ga0210409_112542582	3300021559	Soil	MSTQPVLQSLKESVLCQASVKALYGEPVLANGKTVIPVAKIA
Ga0126371_101323223	3300021560	Tropical Forest Soil	MGSLALLQSLKESVLGQASVKAIYGEPISAHEKTIIPVA
Ga0126371_113834803	3300021560	Tropical Forest Soil	MSSLALLQSLKDSILTQANVKSVYGEPIAAQGKTIIPVAKI
Ga0224541_10288621	3300022521	Soil	MSTQALLQSLKESILSQASVKAIYGEPISAHGKTVIPVA
Ga0212123_101101051	3300022557	Iron-Sulfur Acid Spring	VGSQALLQSLKEGILSQASVKAIYGEPVSIQGKTVI
Ga0212123_103582181	3300022557	Iron-Sulfur Acid Spring	MSTLAVLQSLKESVLSQASVKAIYGEPISAHGRTVVP
Ga0212123_108919201	3300022557	Iron-Sulfur Acid Spring	MSSLALLQSLKESILSQANVKAIYGEPIAAHGKTVIPVAKS
Ga0224544_10624291	3300023250	Soil	MGSVALLQSLKDSIVGQAGVKTVFGEPISAQGKTIIPIA
Ga0224547_10291791	3300023255	Soil	MSTLPLLQSLKESVLSQASVKAIYGEPISAQGKTVIPV
Ga0207692_108250881	3300025898	Corn, Switchgrass And Miscanthus Rhizosphere	MGSLALLQSLKESVLAQANVKAIYGEPISAHEKTIIPVAK
Ga0207699_111109591	3300025906	Corn, Switchgrass And Miscanthus Rhizosphere	MGSLALLQSLKESVLAQANVKAIYGEPISAHEKTIIPVA
Ga0207700_113299143	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	MSRLALLQSLKESILSQASVKAIYGEPIAAQGKTIIPVAR
Ga0207709_112181191	3300025935	Miscanthus Rhizosphere	MGSLALLQSLKESILGQASVKTIYGEPILSQGKTIIPV
Ga0207691_108343122	3300025940	Miscanthus Rhizosphere	MGSLALLQYLKESVLGQANVKAIYGEPISAHEKTIIPVAKIM
Ga0207658_101575284	3300025986	Switchgrass Rhizosphere	MGSLALLQSLKDSVLGQANVKTIYGEPISAHEKTIIPV
Ga0207658_103912571	3300025986	Switchgrass Rhizosphere	MGSLALLQSLKESILGQASVKTICGEPISSPGKTIIPVA
Ga0207641_100112209	3300026088	Switchgrass Rhizosphere	MGSLALLQSLKESILGQASVKTIYGEPISSPGKTIIPVAKI
Ga0207641_116626772	3300026088	Switchgrass Rhizosphere	VGSLALLQSLKESVLGQANVKAIYGEPISAHEKTIIPVA
Ga0209375_10504734	3300026329	Soil	MTSVALLQSLKESFLTQADVKAVYGEPITAQGKTVVPVARIIY
Ga0209690_11654971	3300026524	Soil	MGSLALLQSLRDSVLTQASVKTIYGEPIAAQGKPIIPV
Ga0179587_110252412	3300026557	Vadose Zone Soil	MSSLALLQSLKESILSQANVKAIYGEPISAYGKTIIP
Ga0208859_10173641	3300027069	Forest Soil	MGSLALLQSLKDSVLGQANVKAIYGEPVSAHEKTI
Ga0209106_10625912	3300027616	Forest Soil	VGSLALLQSLKESILGQASVKTIYGEPISAHGKTII
Ga0209167_102190411	3300027867	Surface Soil	MSSLAFLQSLKDSVLGQASVKAIYGEPISAHGKTVIP
Ga0209579_100016331	3300027869	Surface Soil	MGALALLQSLKESVLSQASVKSIYGEPISAQGKTV
Ga0209579_104348971	3300027869	Surface Soil	MGTLTVLQSLKDNILSQASVKAIYGEPISANGKTV
Ga0209624_102485071	3300027895	Forest Soil	MSTQAILQSLKESILSQASVKAIYGEPISAHGKTVVPVAKIMYG
Ga0209526_104683941	3300028047	Forest Soil	MSTLSLLQSLKESILSQASVKAIYGEPISAHGKTVVPIAKIMY
Ga0265338_111294571	3300028800	Rhizosphere	MGSVALLQSLKDGILGQASVKAIYGEPIPAHGKTIVPVAKIL
Ga0308309_103547243	3300028906	Soil	MGSLALLQSLKESVLGQANVKAIYGEPISAHEKTIIPVAK
Ga0308309_105164171	3300028906	Soil	MSALTILQSLKESILSQANVKAIYGDPITAHGKTVI
Ga0302324_1006861642	3300031236	Palsa	VGSVALLQSLKEGILGQVSVKTIYGEPIPAHGKTIIPV
Ga0310915_112637892	3300031573	Soil	MGTFALLQSLKESILADANVKAIYGEPISAHEKTIIPVARIMY
Ga0307476_101952911	3300031715	Hardwood Forest Soil	MSSLALLQSLKESILSQANVKAVYGEPIAAQGKTIIPVAKII
Ga0307469_101341603	3300031720	Hardwood Forest Soil	MGSLALLQSLKESVLSQANVKAIYGEPISAHEKTIIPVAKM
Ga0307473_105025311	3300031820	Hardwood Forest Soil	MGSLALLQSLKESVLSQANVKAIYGEPISAHEKTIIPVAKMMY
Ga0307473_111690322	3300031820	Hardwood Forest Soil	MGSLALLQSLKDSVLGQASVRTIYGEPISAHGKTIIPV
Ga0307478_100812462	3300031823	Hardwood Forest Soil	MSSLALLQSLKESILSQANVKAIYGEPIVAQAKTVIPVAKIMYG
Ga0307479_102865011	3300031962	Hardwood Forest Soil	MGSLALLQSLKDSVLGQANVKAIYGEPVSAHEKTII
Ga0307479_103954681	3300031962	Hardwood Forest Soil	MGSLALMQSLKESVLTQANVKTIYGEPIQAQGKTIIPVAKI
Ga0335074_100065379	3300032895	Soil	MGSAALLQSLKEGILGQARVKAIYGEPITPQGKTIIPVAKLVYG
Ga0335074_115324242	3300032895	Soil	MGSVALLQSLKESILSGAGVKAIYGEPITAQGKTIVP
Ga0335072_104088332	3300032898	Soil	MSSVAILQSLKDSTLAANVKSVYGEPITAQGKTVIPV
Ga0335077_109112941	3300033158	Soil	MGALAVLQSLRDGILGQATVKTIYGEPIAANGKTVI
Ga0310914_109509573	3300033289	Soil	MEVLKMSGQALLQSLKESFVTQANVKAVYGEPITARG

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F084063

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences