Basic Information | |
---|---|
Family ID | F084061 |
Family Type | Metagenome |
Number of Sequences | 112 |
Average Sequence Length | 41 residues |
Representative Sequence | TAHYFPLEGPGKSPAQRQTDATFRLGLIARLMGIPVEIV |
Number of Associated Samples | 93 |
Number of Associated Scaffolds | 112 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 99.11 % |
% of genes from short scaffolds (< 2000 bps) | 83.93 % |
Associated GOLD sequencing projects | 88 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.44 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (100.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (22.321 % of family members) |
Environment Ontology (ENVO) | Unclassified (45.536 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.357 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.36% β-sheet: 0.00% Coil/Unstructured: 71.64% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 112 Family Scaffolds |
---|---|---|
PF01978 | TrmB | 79.46 |
PF00561 | Abhydrolase_1 | 8.04 |
PF00440 | TetR_N | 5.36 |
PF00246 | Peptidase_M14 | 1.79 |
PF13500 | AAA_26 | 0.89 |
PF12697 | Abhydrolase_6 | 0.89 |
PF07587 | PSD1 | 0.89 |
PF00069 | Pkinase | 0.89 |
PF02780 | Transketolase_C | 0.89 |
COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.57 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 100.00 % |
Unclassified | root | N/A | 0.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002908|JGI25382J43887_10251848 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
3300002911|JGI25390J43892_10008265 | All Organisms → cellular organisms → Bacteria | 2389 | Open in IMG/M |
3300002911|JGI25390J43892_10067465 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 827 | Open in IMG/M |
3300005341|Ga0070691_10362604 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
3300005447|Ga0066689_10665456 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300005546|Ga0070696_100522878 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
3300005552|Ga0066701_10265287 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1063 | Open in IMG/M |
3300005553|Ga0066695_10185764 | All Organisms → cellular organisms → Bacteria | 1301 | Open in IMG/M |
3300005554|Ga0066661_10243858 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
3300005554|Ga0066661_10951837 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 502 | Open in IMG/M |
3300005568|Ga0066703_10187793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1251 | Open in IMG/M |
3300005568|Ga0066703_10345095 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 895 | Open in IMG/M |
3300005568|Ga0066703_10726679 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 570 | Open in IMG/M |
3300005719|Ga0068861_100732829 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
3300006031|Ga0066651_10000687 | All Organisms → cellular organisms → Bacteria | 10743 | Open in IMG/M |
3300006032|Ga0066696_10299761 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1044 | Open in IMG/M |
3300006034|Ga0066656_10239638 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1163 | Open in IMG/M |
3300006046|Ga0066652_101987512 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 518 | Open in IMG/M |
3300006755|Ga0079222_11787735 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 594 | Open in IMG/M |
3300006796|Ga0066665_10119857 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1958 | Open in IMG/M |
3300006796|Ga0066665_10681296 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 815 | Open in IMG/M |
3300006797|Ga0066659_10196021 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1475 | Open in IMG/M |
3300006845|Ga0075421_101475537 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
3300006871|Ga0075434_100072028 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3448 | Open in IMG/M |
3300006871|Ga0075434_100949445 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 874 | Open in IMG/M |
3300006914|Ga0075436_100004779 | All Organisms → cellular organisms → Bacteria | 9304 | Open in IMG/M |
3300006954|Ga0079219_11747307 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 579 | Open in IMG/M |
3300007258|Ga0099793_10209782 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 935 | Open in IMG/M |
3300009012|Ga0066710_100151194 | All Organisms → cellular organisms → Bacteria | 3228 | Open in IMG/M |
3300009012|Ga0066710_101903947 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 890 | Open in IMG/M |
3300009012|Ga0066710_102271964 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
3300009012|Ga0066710_102290689 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 786 | Open in IMG/M |
3300009012|Ga0066710_103315333 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 614 | Open in IMG/M |
3300009090|Ga0099827_10826419 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 802 | Open in IMG/M |
3300009094|Ga0111539_11824295 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300009143|Ga0099792_10268320 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
3300009802|Ga0105073_1062037 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 522 | Open in IMG/M |
3300009819|Ga0105087_1112356 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 520 | Open in IMG/M |
3300010304|Ga0134088_10040634 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2119 | Open in IMG/M |
3300010304|Ga0134088_10159393 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1075 | Open in IMG/M |
3300010320|Ga0134109_10329028 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 595 | Open in IMG/M |
3300010325|Ga0134064_10479529 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 512 | Open in IMG/M |
3300010326|Ga0134065_10108235 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
3300010329|Ga0134111_10312310 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300010329|Ga0134111_10456861 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300010336|Ga0134071_10033954 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2243 | Open in IMG/M |
3300010359|Ga0126376_10861916 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 891 | Open in IMG/M |
3300010359|Ga0126376_12818983 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 536 | Open in IMG/M |
3300010371|Ga0134125_11025317 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 904 | Open in IMG/M |
3300011420|Ga0137314_1117486 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
3300011444|Ga0137463_1001613 | All Organisms → cellular organisms → Bacteria | 7447 | Open in IMG/M |
3300012189|Ga0137388_10651122 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 979 | Open in IMG/M |
3300012198|Ga0137364_10414426 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1009 | Open in IMG/M |
3300012200|Ga0137382_10159991 | All Organisms → cellular organisms → Bacteria | 1531 | Open in IMG/M |
3300012202|Ga0137363_10060842 | All Organisms → cellular organisms → Bacteria | 2743 | Open in IMG/M |
3300012207|Ga0137381_10874168 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 778 | Open in IMG/M |
3300012207|Ga0137381_11323820 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300012208|Ga0137376_10608101 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
3300012209|Ga0137379_11237731 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300012210|Ga0137378_10434584 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
3300012349|Ga0137387_10367782 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 1042 | Open in IMG/M |
3300012350|Ga0137372_11010948 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 579 | Open in IMG/M |
3300012354|Ga0137366_10568312 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 815 | Open in IMG/M |
3300012355|Ga0137369_11040782 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 539 | Open in IMG/M |
3300012357|Ga0137384_10002627 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 14216 | Open in IMG/M |
3300012357|Ga0137384_10120372 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2195 | Open in IMG/M |
3300012359|Ga0137385_10339719 | All Organisms → cellular organisms → Bacteria | 1286 | Open in IMG/M |
3300012918|Ga0137396_10004651 | All Organisms → cellular organisms → Bacteria | 7875 | Open in IMG/M |
3300012924|Ga0137413_10321404 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
3300012930|Ga0137407_11512969 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
3300012972|Ga0134077_10234201 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
3300014150|Ga0134081_10086942 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 971 | Open in IMG/M |
3300014166|Ga0134079_10391107 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300014321|Ga0075353_1206943 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300015053|Ga0137405_1159855 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 863 | Open in IMG/M |
3300015053|Ga0137405_1266429 | All Organisms → cellular organisms → Bacteria | 1468 | Open in IMG/M |
3300015358|Ga0134089_10566551 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 505 | Open in IMG/M |
3300017657|Ga0134074_1010827 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2941 | Open in IMG/M |
3300017657|Ga0134074_1094863 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1023 | Open in IMG/M |
3300017959|Ga0187779_11184565 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 537 | Open in IMG/M |
3300018053|Ga0184626_10113120 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
3300018063|Ga0184637_10671708 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 571 | Open in IMG/M |
3300018071|Ga0184618_10407313 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 575 | Open in IMG/M |
3300018431|Ga0066655_11082853 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300018433|Ga0066667_10825057 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
3300019866|Ga0193756_1017959 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 973 | Open in IMG/M |
3300020003|Ga0193739_1114839 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 671 | Open in IMG/M |
3300024182|Ga0247669_1030135 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 917 | Open in IMG/M |
3300024290|Ga0247667_1092752 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300024325|Ga0247678_1079865 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 546 | Open in IMG/M |
3300025905|Ga0207685_10124882 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
3300026297|Ga0209237_1181037 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
3300026298|Ga0209236_1319480 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 503 | Open in IMG/M |
3300026301|Ga0209238_1006832 | All Organisms → cellular organisms → Bacteria | 4550 | Open in IMG/M |
3300026310|Ga0209239_1084282 | All Organisms → cellular organisms → Bacteria | 1369 | Open in IMG/M |
3300026314|Ga0209268_1008355 | All Organisms → cellular organisms → Bacteria | 4317 | Open in IMG/M |
3300026315|Ga0209686_1122287 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 866 | Open in IMG/M |
3300026318|Ga0209471_1045216 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2069 | Open in IMG/M |
3300026323|Ga0209472_1049658 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1810 | Open in IMG/M |
3300026331|Ga0209267_1087998 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1334 | Open in IMG/M |
3300026331|Ga0209267_1237332 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 653 | Open in IMG/M |
3300026332|Ga0209803_1130185 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 995 | Open in IMG/M |
3300026342|Ga0209057_1010606 | All Organisms → cellular organisms → Bacteria | 5756 | Open in IMG/M |
3300026542|Ga0209805_1008429 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 5626 | Open in IMG/M |
3300027775|Ga0209177_10264956 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 641 | Open in IMG/M |
3300027882|Ga0209590_10598855 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
3300027909|Ga0209382_10947978 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 902 | Open in IMG/M |
3300031226|Ga0307497_10250995 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
3300031720|Ga0307469_10782769 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 873 | Open in IMG/M |
3300031720|Ga0307469_12520477 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 503 | Open in IMG/M |
3300032892|Ga0335081_10574477 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1398 | Open in IMG/M |
3300033433|Ga0326726_11456883 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 666 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 22.32% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 20.54% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 12.50% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 12.50% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.36% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.68% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.68% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.68% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.68% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.68% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.79% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.79% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.79% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.79% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.89% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.89% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.89% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.89% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.89% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.89% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.89% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009802 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_50_60 | Environmental | Open in IMG/M |
3300009819 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_40_50 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300011420 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT199_2 | Environmental | Open in IMG/M |
3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300014321 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1 | Environmental | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300019866 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m1 | Environmental | Open in IMG/M |
3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
3300024182 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10 | Environmental | Open in IMG/M |
3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
3300024325 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19 | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25382J43887_102518482 | 3300002908 | Grasslands Soil | LRAMPKATSPLTAHYFPLEGPGKSPAQRQTDATLRLGLIARLMGIPVEIV* |
JGI25390J43892_100082654 | 3300002911 | Grasslands Soil | PKASSPLTAHYFPLEGPGKSPAQRQTDATFRLGLIARLLGIPVEIV* |
JGI25390J43892_100674652 | 3300002911 | Grasslands Soil | MPKAASPLSVHYFPLEGAGKSPAQRQTDATVRLGLIARLLGIPVEIV* |
Ga0070691_103626041 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | SENPVVSHYFPLEGPGKSPAQRQTDVTFRLSLIAKLLGIPLNVI* |
Ga0066689_106654562 | 3300005447 | Soil | KAASPLTAHYFPLEGPGKSPAQRQTDTTFRLGLIARLMGIPVEIV* |
Ga0070696_1005228783 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VSHYFPLEGPGKSPAQRQTDVTFRLSLIAKLLGIPLNVV* |
Ga0066701_102652873 | 3300005552 | Soil | NPLTAHYFPLEGAGKSPAQRQTDATFRLGLIARLMGLPVDIL* |
Ga0066695_101857643 | 3300005553 | Soil | VYHYFPLEGPGKSPAQRQTDVTFRLALIARLLGIPLNVV* |
Ga0066661_102438583 | 3300005554 | Soil | HYFPLEGAGKSPAQRQTDATVRLGLIARLLGIPVEIV* |
Ga0066661_109518371 | 3300005554 | Soil | AMPKALSPLTAHYFPLEGPGKSPAQRQTDMTFRLGLIARLLGIPVEVAQD* |
Ga0066703_101877931 | 3300005568 | Soil | LTAHYFPLEGPGKSPAQRQTDVTFRLALIAKLIGLPVEVV* |
Ga0066703_103450951 | 3300005568 | Soil | PKSLRAMPKATSPLTAHCFPLEGAGKSPAQRQTDATFRLGLIARLLGIPVEIV* |
Ga0066703_107266792 | 3300005568 | Soil | MPKATSPLTAHYFPLEGAGKSPAQRQTDATFRLGLIARLLGLPVEIV* |
Ga0068861_1007328291 | 3300005719 | Switchgrass Rhizosphere | ENPVVSHYFPLEGPGKSPAQRQTDVTFRLSLIAKLLGIPLNVI* |
Ga0066651_100006878 | 3300006031 | Soil | SHYFPLEGPGRSPAQRQTDVTFRLALIARILGIPLNVV* |
Ga0066696_102997611 | 3300006032 | Soil | NPVTAHYFPLEGPGKSPAQRQTDGTFRLALIARLMGLPVEVV* |
Ga0066656_102396383 | 3300006034 | Soil | ATSPLTAHYFPLEGPGKSPAQRQTDATFRLGLIARLLGIPIEIL* |
Ga0066652_1019875121 | 3300006046 | Soil | AHYFPLEGPGKSPAQRQTDVTFRLALIARLMGLPVEVA* |
Ga0079222_117877351 | 3300006755 | Agricultural Soil | MPKATSSLTAHYFPLEGAGKSPAQRQTDATFRLGLIVRLLGIPVEIV* |
Ga0066665_101198574 | 3300006796 | Soil | TAHYFPLEGPGKSPAQRQTDATFRLGLIARLMGIPVEIV* |
Ga0066665_106812962 | 3300006796 | Soil | FPLEGPGKSPAQRQTDVTFRLALIAKLLGLPVEVI* |
Ga0066659_101960211 | 3300006797 | Soil | TSPLTAHYFPLEGPGKSPAQRQTDATFRLGLIARLMGIPVEIV* |
Ga0075421_1014755372 | 3300006845 | Populus Rhizosphere | PVVSHYFPLEGPGKSPAQRQTDVTFRLGLIARLLGIPIEVI* |
Ga0075434_1000720281 | 3300006871 | Populus Rhizosphere | SHYFPLEGPGKSPAQRQTDVTFRLALIARLLGLPIAVV* |
Ga0075434_1009494451 | 3300006871 | Populus Rhizosphere | FPLEGAGKSPAQRQTDVTFRLALIARLMGLPVEVT* |
Ga0075436_1000047791 | 3300006914 | Populus Rhizosphere | HYFPLEGPGKSPAQRQTDATFRLALIARLMGLPIEIV* |
Ga0079219_117473072 | 3300006954 | Agricultural Soil | TSSLTAHYFPLEGPGKSPAQRQTDVTFRLGLIARLMGLPIEVV* |
Ga0099793_102097823 | 3300007258 | Vadose Zone Soil | AHYFPLEGPGKSPAQRQTDVTFRLALIARLMGIPIEVV* |
Ga0066710_1001511945 | 3300009012 | Grasslands Soil | RAMPKATSPLTAHYFPLEGPGKSPAQRQTDATFRLGLIARFMGIPVEIV |
Ga0066710_1019039471 | 3300009012 | Grasslands Soil | HCFPLEGPGKSPAQRQTDATFRLGLIARLMGIPVDIA |
Ga0066710_1022719641 | 3300009012 | Grasslands Soil | YFPLEGPGRSPAQRQTDVTFRLALIARILGIPLNVV |
Ga0066710_1022906891 | 3300009012 | Grasslands Soil | PVTAHYFPLEGPGKSPAQRQTDVTFRLALIARLMGLPVEVA |
Ga0066710_1033153332 | 3300009012 | Grasslands Soil | LLTAHYFPLEGPGKSPAQRQTDVTFRLALIAKLIGLPIEVI |
Ga0099827_108264191 | 3300009090 | Vadose Zone Soil | SPLTAHYYPLEGPGQSPAQRQTDITFRLALIARIMGLPIEVV* |
Ga0111539_118242952 | 3300009094 | Populus Rhizosphere | SHYFPLEGPGKSPAQRQTDVTFRLALIARLLGIPLNVI* |
Ga0099792_102683201 | 3300009143 | Vadose Zone Soil | PLEGPGKSPAQRQTDVTFRLALIARLLGIPLNVV* |
Ga0105073_10620372 | 3300009802 | Groundwater Sand | FPLEGPGKSPAQRQTDATFRLGLIARLMGLPVEIV* |
Ga0105087_11123561 | 3300009819 | Groundwater Sand | ATSPLTAHYFPLEGPGKSPAQRQTDVTFRLGLIARLMRIPLEIG* |
Ga0134088_100406341 | 3300010304 | Grasslands Soil | TTLLTAHYFPLEGPGKSPAQRQTDVTFRLALIAKLLGLPVEVI* |
Ga0134088_101593931 | 3300010304 | Grasslands Soil | STNPVVSHYFPLEGPGKSPAQRQTDVTFRLALIARLMGLPVEVA* |
Ga0134109_103290281 | 3300010320 | Grasslands Soil | KSLRAMPKATDPLTAHCFPLEGAGKSPAQRQTDATFGLGLIARLMGLPVDIL* |
Ga0134064_104795292 | 3300010325 | Grasslands Soil | HYFPLEGPGKSPAQRQTDGTFRLALIARLMGLPVEVV* |
Ga0134065_101082352 | 3300010326 | Grasslands Soil | HYFPLEGPGKSPAQRQTDVTFRLALIARLLGLPLSIA* |
Ga0134111_103123102 | 3300010329 | Grasslands Soil | FPLEGPGKSPAQRQTDVTFRLALIARLMGIPIESV* |
Ga0134111_104568612 | 3300010329 | Grasslands Soil | YFPLEGPGKSPAQRQTDVTFRLALIARLLGIPLNVV* |
Ga0134071_100339541 | 3300010336 | Grasslands Soil | HYFPLEGPGKSPAQRQTDVTFRLALIARLMGIPIEVV* |
Ga0126376_108619163 | 3300010359 | Tropical Forest Soil | AHWFPLEGPGKSPAQRQTDITFRLGLIARLMGIPVEIG* |
Ga0126376_128189832 | 3300010359 | Tropical Forest Soil | HWFPLEGPGKSPAQRQTDITFRLGLIARLMGMPVEVV* |
Ga0134125_110253171 | 3300010371 | Terrestrial Soil | PKATNPLTAHYFPLEGPGKSPAQRQTDATFRLGLIARLMGIPVEIV* |
Ga0137314_11174861 | 3300011420 | Soil | MPKSDNPVVSHYFPLEGPGKSPAQRQTDATFRLALIARLLGIPLNVV* |
Ga0137463_10016137 | 3300011444 | Soil | WFPLEGPGKSPAQRQTDITFRLGLIARLMGIPVDIV* |
Ga0137388_106511223 | 3300012189 | Vadose Zone Soil | TAHSYPLEGAGRSPAQRQTDITFRLALIARLLGIPVTVG* |
Ga0137364_104144261 | 3300012198 | Vadose Zone Soil | FPLEGPGKSPAQRQTDATFRLGLIARLMGIPVEIV* |
Ga0137382_101599913 | 3300012200 | Vadose Zone Soil | AHYFPLEGPGKSPAQRQTDTTFRLGLIARLMGIPVEIL* |
Ga0137363_100608425 | 3300012202 | Vadose Zone Soil | YFPLEGPGKSPAQRQTDVTFRLALIARLLGIPLNVI* |
Ga0137381_108741681 | 3300012207 | Vadose Zone Soil | ATSPLTAHYFPLEGPGKSPAQRQTDVTFRLALIARLMGIPVEVV* |
Ga0137381_113238202 | 3300012207 | Vadose Zone Soil | PLTTHYFPLEGPGKSPAQRQTDVTFRLALIGRIMGLPIDVT* |
Ga0137376_106081011 | 3300012208 | Vadose Zone Soil | NPAVAHYFPLEGPGKSPAQRQTDVTFRLALIAKHLGIPLNVI* |
Ga0137379_112377312 | 3300012209 | Vadose Zone Soil | VSHYFPLEGPGKSPAQRQTDVTFRLALIARLLGMPLNIV* |
Ga0137378_104345843 | 3300012210 | Vadose Zone Soil | RAMPKAASPLTAHYFPLEGPGKSPAQRQTDTTFRLGLIARLMGIPVEIL* |
Ga0137387_103677821 | 3300012349 | Vadose Zone Soil | HYFPLEGPGKSPAQRQTDVSFRLALIARLLGMPLNVV* |
Ga0137372_110109481 | 3300012350 | Vadose Zone Soil | KSLRAMPKAASPLTAHCFPLEGPGKSPAQRQTDATFRLGLIARLMGIPVEIS* |
Ga0137366_105683121 | 3300012354 | Vadose Zone Soil | TAHCFPLEGPGRSPAQRQTDVTFRLGLIARLMGIPLEVA* |
Ga0137369_110407822 | 3300012355 | Vadose Zone Soil | FPLEGPGKSPAQRQTDATFRLGLIARLMGIPVEIS* |
Ga0137384_100026271 | 3300012357 | Vadose Zone Soil | KATNPVTAHYFPLEGPGKSPAQRQTDVTFRLALIARVMGLPVEVV* |
Ga0137384_101203721 | 3300012357 | Vadose Zone Soil | PVTAHYFPLEGPGKSPAQRQTDVTFRLALIARLMGLPVEVA* |
Ga0137385_103397191 | 3300012359 | Vadose Zone Soil | PPKATTPLTAYYFPLEGPGKSPAQRQTDVTFRLALIGRIMGLPIDVT* |
Ga0137396_100046516 | 3300012918 | Vadose Zone Soil | ENPVVAHYFPLEGPGKSPAQRQTDVTFRLALIARLLGIPLNIV* |
Ga0137413_103214043 | 3300012924 | Vadose Zone Soil | STNPVVYHSFPLEGPGKSPAQRQTDVTFRLALIARLLGIPLNVV* |
Ga0137407_115129692 | 3300012930 | Vadose Zone Soil | LTAHYFPLEGPGKSPAQRQTDATFRLGLIARLMGIPVEIV* |
Ga0134077_102342012 | 3300012972 | Grasslands Soil | AHYFPLEGPGKSPAQRQTDVTFRLALIAKHLGIPLNVI* |
Ga0134081_100869421 | 3300014150 | Grasslands Soil | TSNPVTAHYFPLEGPGKSPAQRQTDVTFRLALIARLMGLPVEVV* |
Ga0134079_103911071 | 3300014166 | Grasslands Soil | LTAHYFPLEGPGKSPAQRQTDATFRLGLIARLLGIPVEIL* |
Ga0075353_12069431 | 3300014321 | Natural And Restored Wetlands | KSANPVVAYYFPLEGAGKSPAQRQTDVSFRLALIALLMGLAVEVA* |
Ga0137405_11598552 | 3300015053 | Vadose Zone Soil | LTAHYFPLEGPGKSPAQRQTDATFRLGLIARLMGIPVETV* |
Ga0137405_12664291 | 3300015053 | Vadose Zone Soil | TNPLTAHYFPLEGPGKSPAQRQTDATFRLGLIARLMGIPVETV* |
Ga0134089_105665512 | 3300015358 | Grasslands Soil | AHYFPLEGPGKSPAQRQTDATFRLGLIARLLGIPVEIV* |
Ga0134074_10108275 | 3300017657 | Grasslands Soil | YFPLEGPGKSPAQRQTDVTFRLALIARLMGLPVEVV |
Ga0134074_10948632 | 3300017657 | Grasslands Soil | FPLEGPGKSPAQRQTDVTFRLALIARIMSVPIEVV |
Ga0187779_111845651 | 3300017959 | Tropical Peatland | NPMTAHYFPLEGPGKSPAQRQTDVTFRLALIAKIMNLPLDVV |
Ga0184626_101131203 | 3300018053 | Groundwater Sediment | VSHYFPLEGPGKSPAQRQTDVTFRLGLIARLLGIPIGAT |
Ga0184637_106717081 | 3300018063 | Groundwater Sediment | HYFPLEGAGRSPAQRQTDVTFRLALICQLMGLPIEVV |
Ga0184618_104073132 | 3300018071 | Groundwater Sediment | AHYFPLEGPGKSPAQRQTDATFRLGLIARLMGIPVEIV |
Ga0066655_110828531 | 3300018431 | Grasslands Soil | TSPLTAHYFPLEGPGKSPAQRQTDATFRLGLIARLMGIPVEIV |
Ga0066667_108250572 | 3300018433 | Grasslands Soil | STNPVVYHYFPLEGPGKSPAQRQTDVTFRLALIARLLGMPLNIV |
Ga0193756_10179593 | 3300019866 | Soil | KATNPLTAHYFPLEGPGKSPAQRQTDATFRLGLIARLMGIPVEIV |
Ga0193739_11148392 | 3300020003 | Soil | HYFPLEGAGRSPAQRQTDVTFRLALISKLIGLTIEVV |
Ga0247669_10301353 | 3300024182 | Soil | YFPLEGAGKSPAQRQTDVTFRLALIARLMGMPVEVT |
Ga0247667_10927522 | 3300024290 | Soil | LRTLPKTVSPVIGHVFPLEGPGKSPAQRQTDITFRLGLIARLLGLPLEVA |
Ga0247678_10798651 | 3300024325 | Soil | WFPLEGPGKSPAQRQTDITFRLGLIARLMGIPIEVG |
Ga0207685_101248823 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | PLTAHYFPLEGPGKSPAQRQTDATFRLGLIARLMGIPVEIV |
Ga0209237_11810371 | 3300026297 | Grasslands Soil | VVAHYFPLEGPGKSPAQRQTDVTFRLALIARLLGIPLNIV |
Ga0209236_13194801 | 3300026298 | Grasslands Soil | KATNPVTAHYFPLEGPGRSPAQRQTDVTFRLALIARLMGIPIEVV |
Ga0209238_10068321 | 3300026301 | Grasslands Soil | STNPVISHYFPLEGPGKSPAQRQTDVTFRLALIARILGIPLNII |
Ga0209239_10842823 | 3300026310 | Grasslands Soil | AHYFPLEGPGKSPAQRQTDVTFRLALIAKLIGLPVEVG |
Ga0209268_10083551 | 3300026314 | Soil | LTAHYFPLEGPGKSPAQRQTDATFRLGLIARLMGIPVEIV |
Ga0209686_11222871 | 3300026315 | Soil | HYFPLEGAGKSPAQRQTDATFRLGLIARLIGIPVEIV |
Ga0209471_10452161 | 3300026318 | Soil | TAHYFPLEGPGKSPAQRQTDATFRLGLIARLLGIPVEIV |
Ga0209472_10496581 | 3300026323 | Soil | SSPLTAHYFPLEGPGKSPAQRQTDATFRLGLIARLVGIPVEIV |
Ga0209267_10879981 | 3300026331 | Soil | PKATSPLTAHYFPLEGAGKSPAQRQTDATFRLGLISRLLGIPVEIV |
Ga0209267_12373321 | 3300026331 | Soil | TAHYFPLEGPGKSPAQRQTDVTFRLALIAKLLGLPVEVI |
Ga0209803_11301851 | 3300026332 | Soil | AMPKAISPLTAHYLPLEGPGRSPAQRQTDATLRLALIARLMGLPIEVV |
Ga0209057_10106061 | 3300026342 | Soil | PKATSPLTAHYFPLEGPGKSPAQRQTDATFRLGLIARLLGIPVEIL |
Ga0209805_10084295 | 3300026542 | Soil | TAHYFPLEGPGKSPAQRQTDVTFRLALIARLMGLPVEVA |
Ga0209177_102649562 | 3300027775 | Agricultural Soil | YFPLEGAGKSPAQRQTDVTFRLALIARLMGLPIEVI |
Ga0209590_105988552 | 3300027882 | Vadose Zone Soil | HYFPLEGPGKSPAQRQTDVTFRLALIARLLGIPLNVV |
Ga0209382_109479782 | 3300027909 | Populus Rhizosphere | YFPLEGAGKSPAQRQTDVTFRLGLIARLLGIPVEVI |
Ga0307497_102509951 | 3300031226 | Soil | YFPLEGPGKSPAQRQTDVTFRLALIARLLGLPLNVV |
Ga0307469_107827691 | 3300031720 | Hardwood Forest Soil | SPLTAHCFPLEGPGKSPAQRQTDATFRLGLIARLMGIPVEIV |
Ga0307469_125204771 | 3300031720 | Hardwood Forest Soil | PLTSHYFPLEGPGKSPAQRQTDATFRLALIGRIMGLPIDVT |
Ga0335081_105744771 | 3300032892 | Soil | KTTSSILSHYFPLEGPGKSPAQRQTDVTFRLGLIARLLGLPIEVV |
Ga0326726_114568832 | 3300033433 | Peat Soil | LVSHWFPLEGPGKSPAQRQTDITFRLGLIARLMGLPLDVA |
⦗Top⦘ |