| Basic Information | |
|---|---|
| Family ID | F084059 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 112 |
| Average Sequence Length | 41 residues |
| Representative Sequence | PAAGCAIIAFGVVAYLLDDGDLRAVLAWVRRVARLRS |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.11 % |
| % of genes from short scaffolds (< 2000 bps) | 89.29 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (54.464 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.429 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.536 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.250 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.23% β-sheet: 0.00% Coil/Unstructured: 50.77% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF00903 | Glyoxalase | 19.64 |
| PF13424 | TPR_12 | 4.46 |
| PF02881 | SRP54_N | 4.46 |
| PF01266 | DAO | 2.68 |
| PF01507 | PAPS_reduct | 2.68 |
| PF12680 | SnoaL_2 | 1.79 |
| PF00933 | Glyco_hydro_3 | 1.79 |
| PF00543 | P-II | 0.89 |
| PF03952 | Enolase_N | 0.89 |
| PF08335 | GlnD_UR_UTase | 0.89 |
| PF13193 | AMP-binding_C | 0.89 |
| PF14667 | Polysacc_synt_C | 0.89 |
| PF13669 | Glyoxalase_4 | 0.89 |
| PF10935 | DUF2637 | 0.89 |
| PF13374 | TPR_10 | 0.89 |
| PF13304 | AAA_21 | 0.89 |
| PF02646 | RmuC | 0.89 |
| PF01243 | Putative_PNPOx | 0.89 |
| PF13579 | Glyco_trans_4_4 | 0.89 |
| PF13379 | NMT1_2 | 0.89 |
| PF01943 | Polysacc_synt | 0.89 |
| PF01145 | Band_7 | 0.89 |
| PF00196 | GerE | 0.89 |
| PF13191 | AAA_16 | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 1.79 |
| COG0148 | Enolase | Carbohydrate transport and metabolism [G] | 0.89 |
| COG0347 | Nitrogen regulatory protein PII | Signal transduction mechanisms [T] | 0.89 |
| COG1322 | DNA anti-recombination protein (rearrangement mutator) RmuC | Replication, recombination and repair [L] | 0.89 |
| COG2844 | UTP:GlnB (protein PII) uridylyltransferase | Signal transduction mechanisms [T] | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 54.46 % |
| All Organisms | root | All Organisms | 45.54 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2070309004|prs_FHA1B5K04XJ8FI | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 527 | Open in IMG/M |
| 3300001356|JGI12269J14319_10202029 | Not Available | 781 | Open in IMG/M |
| 3300001356|JGI12269J14319_10307545 | Not Available | 569 | Open in IMG/M |
| 3300004080|Ga0062385_10818796 | Not Available | 611 | Open in IMG/M |
| 3300005172|Ga0066683_10312106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 977 | Open in IMG/M |
| 3300005435|Ga0070714_101111431 | Not Available | 770 | Open in IMG/M |
| 3300005435|Ga0070714_101691156 | Not Available | 618 | Open in IMG/M |
| 3300005437|Ga0070710_10548664 | Not Available | 798 | Open in IMG/M |
| 3300005614|Ga0068856_102252757 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300005921|Ga0070766_10315685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1007 | Open in IMG/M |
| 3300005921|Ga0070766_11256370 | Not Available | 513 | Open in IMG/M |
| 3300005995|Ga0066790_10076910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1436 | Open in IMG/M |
| 3300006755|Ga0079222_11982622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 571 | Open in IMG/M |
| 3300006893|Ga0073928_10160566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1802 | Open in IMG/M |
| 3300006914|Ga0075436_100306128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1139 | Open in IMG/M |
| 3300009524|Ga0116225_1180509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 957 | Open in IMG/M |
| 3300009524|Ga0116225_1275050 | Not Available | 753 | Open in IMG/M |
| 3300009698|Ga0116216_10237463 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300009700|Ga0116217_10776545 | Not Available | 590 | Open in IMG/M |
| 3300010049|Ga0123356_12102948 | Not Available | 705 | Open in IMG/M |
| 3300010379|Ga0136449_103474380 | Not Available | 601 | Open in IMG/M |
| 3300011076|Ga0138574_1023816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 968 | Open in IMG/M |
| 3300011087|Ga0138570_1026410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → environmental samples → uncultured Corynebacteriales bacterium | 1241 | Open in IMG/M |
| 3300011087|Ga0138570_1219366 | Not Available | 628 | Open in IMG/M |
| 3300011120|Ga0150983_11814923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 688 | Open in IMG/M |
| 3300011120|Ga0150983_12625567 | Not Available | 532 | Open in IMG/M |
| 3300012096|Ga0137389_10283490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1400 | Open in IMG/M |
| 3300012198|Ga0137364_10373770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1065 | Open in IMG/M |
| 3300012211|Ga0137377_10088034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Sphaerisporangium → Sphaerisporangium siamense | 2931 | Open in IMG/M |
| 3300012960|Ga0164301_11837700 | Not Available | 510 | Open in IMG/M |
| 3300012987|Ga0164307_11489624 | Not Available | 572 | Open in IMG/M |
| 3300014501|Ga0182024_10160859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3135 | Open in IMG/M |
| 3300016371|Ga0182034_10626664 | Not Available | 909 | Open in IMG/M |
| 3300016387|Ga0182040_11742348 | Not Available | 532 | Open in IMG/M |
| 3300016422|Ga0182039_11741050 | Not Available | 570 | Open in IMG/M |
| 3300017924|Ga0187820_1208996 | Not Available | 612 | Open in IMG/M |
| 3300017942|Ga0187808_10374483 | Not Available | 649 | Open in IMG/M |
| 3300017946|Ga0187879_10747728 | Not Available | 545 | Open in IMG/M |
| 3300017959|Ga0187779_11165172 | Not Available | 541 | Open in IMG/M |
| 3300017970|Ga0187783_10051781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3030 | Open in IMG/M |
| 3300017972|Ga0187781_10004102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 10875 | Open in IMG/M |
| 3300017972|Ga0187781_10703860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → environmental samples → uncultured Corynebacteriales bacterium | 731 | Open in IMG/M |
| 3300017972|Ga0187781_11474182 | Not Available | 504 | Open in IMG/M |
| 3300017973|Ga0187780_10536184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 838 | Open in IMG/M |
| 3300017974|Ga0187777_10656268 | Not Available | 742 | Open in IMG/M |
| 3300017994|Ga0187822_10164540 | Not Available | 720 | Open in IMG/M |
| 3300018037|Ga0187883_10057670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2049 | Open in IMG/M |
| 3300018060|Ga0187765_10123449 | Not Available | 1436 | Open in IMG/M |
| 3300018062|Ga0187784_11097971 | Not Available | 632 | Open in IMG/M |
| 3300018086|Ga0187769_10077063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2361 | Open in IMG/M |
| 3300018090|Ga0187770_10264587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → environmental samples → uncultured Corynebacteriales bacterium | 1334 | Open in IMG/M |
| 3300021180|Ga0210396_10406322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus pulveris | 1197 | Open in IMG/M |
| 3300021181|Ga0210388_11214473 | Not Available | 639 | Open in IMG/M |
| 3300021384|Ga0213876_10526528 | Not Available | 629 | Open in IMG/M |
| 3300021401|Ga0210393_11496918 | Not Available | 537 | Open in IMG/M |
| 3300021474|Ga0210390_11203604 | Not Available | 611 | Open in IMG/M |
| 3300021477|Ga0210398_11305762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 570 | Open in IMG/M |
| 3300025898|Ga0207692_10439936 | Not Available | 819 | Open in IMG/M |
| 3300025928|Ga0207700_11404353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 621 | Open in IMG/M |
| 3300025928|Ga0207700_11995178 | Not Available | 507 | Open in IMG/M |
| 3300026078|Ga0207702_11498446 | Not Available | 668 | Open in IMG/M |
| 3300026078|Ga0207702_11555166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 655 | Open in IMG/M |
| 3300026214|Ga0209838_1038609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 691 | Open in IMG/M |
| 3300027076|Ga0208860_1002476 | All Organisms → cellular organisms → Bacteria | 1417 | Open in IMG/M |
| 3300027817|Ga0209112_10287503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 580 | Open in IMG/M |
| 3300027879|Ga0209169_10305937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 835 | Open in IMG/M |
| 3300027889|Ga0209380_10823352 | Not Available | 525 | Open in IMG/M |
| 3300028742|Ga0302220_10066529 | Not Available | 1471 | Open in IMG/M |
| 3300028742|Ga0302220_10344675 | Not Available | 538 | Open in IMG/M |
| 3300028780|Ga0302225_10315893 | Not Available | 740 | Open in IMG/M |
| 3300028789|Ga0302232_10148042 | Not Available | 1185 | Open in IMG/M |
| 3300028793|Ga0307299_10401348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 514 | Open in IMG/M |
| 3300028808|Ga0302228_10054744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1916 | Open in IMG/M |
| 3300028808|Ga0302228_10509481 | Not Available | 530 | Open in IMG/M |
| 3300028877|Ga0302235_10385742 | Not Available | 600 | Open in IMG/M |
| 3300028879|Ga0302229_10106228 | Not Available | 1325 | Open in IMG/M |
| 3300029944|Ga0311352_11282399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 554 | Open in IMG/M |
| 3300030007|Ga0311338_11921546 | Not Available | 528 | Open in IMG/M |
| 3300030013|Ga0302178_10218996 | Not Available | 907 | Open in IMG/M |
| 3300030617|Ga0311356_10445430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → environmental samples → uncultured Corynebacteriales bacterium | 1272 | Open in IMG/M |
| 3300030617|Ga0311356_11306263 | Not Available | 663 | Open in IMG/M |
| 3300031028|Ga0302180_10112952 | Not Available | 1542 | Open in IMG/M |
| 3300031234|Ga0302325_12830239 | Not Available | 567 | Open in IMG/M |
| 3300031234|Ga0302325_13085260 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300031236|Ga0302324_100087637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5342 | Open in IMG/M |
| 3300031525|Ga0302326_10466320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1929 | Open in IMG/M |
| 3300031544|Ga0318534_10311304 | Not Available | 907 | Open in IMG/M |
| 3300031549|Ga0318571_10267998 | Not Available | 633 | Open in IMG/M |
| 3300031640|Ga0318555_10010260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4092 | Open in IMG/M |
| 3300031680|Ga0318574_10007475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4781 | Open in IMG/M |
| 3300031681|Ga0318572_10362280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 860 | Open in IMG/M |
| 3300031708|Ga0310686_112907757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1082 | Open in IMG/M |
| 3300031708|Ga0310686_114299328 | Not Available | 736 | Open in IMG/M |
| 3300031719|Ga0306917_10229365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1416 | Open in IMG/M |
| 3300031723|Ga0318493_10010461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3818 | Open in IMG/M |
| 3300031736|Ga0318501_10156652 | Not Available | 1175 | Open in IMG/M |
| 3300031778|Ga0318498_10057542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1733 | Open in IMG/M |
| 3300031778|Ga0318498_10067426 | Not Available | 1605 | Open in IMG/M |
| 3300031780|Ga0318508_1215751 | Not Available | 550 | Open in IMG/M |
| 3300031799|Ga0318565_10407357 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300032035|Ga0310911_10422862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 771 | Open in IMG/M |
| 3300032039|Ga0318559_10164649 | Not Available | 1011 | Open in IMG/M |
| 3300032044|Ga0318558_10411876 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300032055|Ga0318575_10124849 | Not Available | 1265 | Open in IMG/M |
| 3300032060|Ga0318505_10323777 | Not Available | 728 | Open in IMG/M |
| 3300032065|Ga0318513_10005402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 4641 | Open in IMG/M |
| 3300032068|Ga0318553_10526965 | Not Available | 619 | Open in IMG/M |
| 3300032160|Ga0311301_11442464 | Not Available | 854 | Open in IMG/M |
| 3300032515|Ga0348332_12562244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1274 | Open in IMG/M |
| 3300032770|Ga0335085_11082339 | Not Available | 860 | Open in IMG/M |
| 3300033290|Ga0318519_10214370 | Not Available | 1103 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.43% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 16.07% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 9.82% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 9.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.46% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.57% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.57% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.57% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.57% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.68% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.79% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.79% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.79% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.89% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.89% |
| Green-Waste Compost | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Green-Waste Compost | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.89% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.89% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.89% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.89% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.89% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2070309004 | Green-waste compost microbial communities at University of California, Davis, USA, from solid state bioreactor - Luquillo Rain Forest, Puerto Rico | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011076 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 59 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011087 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 55 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026214 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 (SPAdes) | Environmental | Open in IMG/M |
| 3300027076 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027817 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300028742 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| prs_00093780 | 2070309004 | Green-Waste Compost | VLAIPAAGCAIVAFGVVAYFLDDGDLKAVLAWVRRVTKRRP |
| JGI12269J14319_102020292 | 3300001356 | Peatlands Soil | AGCAILAFGVVAYFLDDGDLKTVLGWVRRVVRRRS* |
| JGI12269J14319_103075451 | 3300001356 | Peatlands Soil | PAAAFAIIVFFVVAYFLDDGDLRAVLAWVRRVTARRR* |
| Ga0062385_108187962 | 3300004080 | Bog Forest Soil | AVPAACCAIIAFTVVAYFLDDGDLRAVLAWVRRVAKLRRS* |
| Ga0066683_103121061 | 3300005172 | Soil | ALAVPAAGGAIIAFGVVAYILDDGDLKTVLAWLRRAIRPRS* |
| Ga0070714_1011114312 | 3300005435 | Agricultural Soil | VALAVPAACCAVLAFGVVAYILDKRDLKAVLTWVRRAVRRRP* |
| Ga0070714_1016911561 | 3300005435 | Agricultural Soil | LAVPAAGGAIIAFGVVAYILDDGDLTAVLAWARRAMRMRS* |
| Ga0070710_105486642 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VPAACGAIVAFGVVAYILDDGDLKAVLAWVRRAIGRARNGVRH* |
| Ga0068856_1022527571 | 3300005614 | Corn Rhizosphere | GVAVLAAGGAVIAFGVVAYLLDDGDLQPILALLRRVVRLRS* |
| Ga0070766_103156851 | 3300005921 | Soil | LVAIAAFGVVAYLLDDGDLRAIVARLRRAARSRGRHA* |
| Ga0070766_112563701 | 3300005921 | Soil | PSACCAIIAFTVVAYFLDDGDLRAVLAWVRRVAKLRS* |
| Ga0066790_100769103 | 3300005995 | Soil | HKLEAFALAVPAAGGAIIAFGVVAYLLDDGDLRAVLAWVRRVARLRS* |
| Ga0079222_119826221 | 3300006755 | Agricultural Soil | CAVIAFGIVAYLLDDGDLRAVLARVRRVVTTLRK* |
| Ga0073928_101605663 | 3300006893 | Iron-Sulfur Acid Spring | LEAFALAGPAAVVAILAFLVVACLLDDGDLRAVAARLRRAARSRGRAA* |
| Ga0075436_1003061281 | 3300006914 | Populus Rhizosphere | AAGGAVIAFGVVAYLLDDGDLQPILALLRRVVRLRS* |
| Ga0116225_11805091 | 3300009524 | Peatlands Soil | PAACCAIIAFTVVAYFLDDGDLRAVLVWVRRVAKLRQS* |
| Ga0116225_12750501 | 3300009524 | Peatlands Soil | GCAIIAFGVVAYLLDDGDLRAVLAWVRRVARLRS* |
| Ga0116216_102374631 | 3300009698 | Peatlands Soil | LEAFALAVPAAGGAIIAFGVVAYLLDDGDLRAVLAWVRRVARLRS* |
| Ga0116217_107765451 | 3300009700 | Peatlands Soil | PAACCAIIAFTVVAYFLDDGDLRAVLVWVRRVAKL* |
| Ga0123356_121029482 | 3300010049 | Termite Gut | AIPAAGCALIAFGVVAYLLDDGDLRAVLAWGRRAAARLRA* |
| Ga0136449_1034743801 | 3300010379 | Peatlands Soil | ALAVPAACCAIIAFTVVAYFLDDGDLRAVLAWVRRVAKLRS* |
| Ga0138574_10238162 | 3300011076 | Peatlands Soil | VAVPAAGCAIIAFGVVAYLLDDGDLKAALAFVRRVARRRS* |
| Ga0138570_10264102 | 3300011087 | Peatlands Soil | VAVALAVPAAAFAIVAFFVVAYFLDDGDLRTVLAWARRVTARRR* |
| Ga0138570_12193662 | 3300011087 | Peatlands Soil | AVVAAGCAVVAFGVVAYLLDNGDLKPAVARLRLLARRPAA* |
| Ga0150983_118149232 | 3300011120 | Forest Soil | FAAGCAIVAYGVVVFLLDDGDFKTVLAWLRRTARLRG* |
| Ga0150983_126255671 | 3300011120 | Forest Soil | AGCAILAFGVVAYLLDSGDLKAVLAWTRRMARRRP* |
| Ga0137389_102834901 | 3300012096 | Vadose Zone Soil | PAAGGAIIAFGFVAYILDDGDMKAVLAWVRRAARPRS* |
| Ga0137364_103737703 | 3300012198 | Vadose Zone Soil | DRKLVAVAVAVLAAGCAIIAFGVVAYILDDGDLKAVLAWVRRSIRPRS* |
| Ga0137377_100880343 | 3300012211 | Vadose Zone Soil | VAVAVLAAGCAIIAFGVVAYILDDGDLKAVLAWVRRSIRPRS* |
| Ga0164301_118377002 | 3300012960 | Soil | AGGAIIAFGVVAYILDKGDLTAVLAWARRAIRMRS* |
| Ga0164307_114896242 | 3300012987 | Soil | PAAGCAVIAFGIVAYLLDDGDLRAVLARVRRVVTRLRK* |
| Ga0182024_101608595 | 3300014501 | Permafrost | LAAGCAIVAFGVVAYFLDGGDLKFVLAWVRRVSRRRS* |
| Ga0182034_106266641 | 3300016371 | Soil | AGLAIVAYAVVAYLLDDGDLRAVLAWARRAVRPRG |
| Ga0182040_117423482 | 3300016387 | Soil | VPAAGCAIIAFGVVAYFLDDGDLRAVLAWLRRAVAKLRS |
| Ga0182039_117410501 | 3300016422 | Soil | VALALPAAGCAIIAFCVVAYLLDDGDLKAVLAWVRRVARPRS |
| Ga0187820_12089963 | 3300017924 | Freshwater Sediment | FALAVPAAACAVLVFGVVAYLLDDGDLRVTLSLARRALRPRR |
| Ga0187814_101436073 | 3300017932 | Freshwater Sediment | AAASCAIIAFVIVASLLDNGDLRAVLARLHQLARLRLSRQEAG |
| Ga0187808_103744832 | 3300017942 | Freshwater Sediment | LVAVAVAVPAAGCAILAFFVVAYFLNDGDLRAALAWVRRAIRRTR |
| Ga0187879_107477282 | 3300017946 | Peatland | LAVPVACLAIIVFGVVAYLLDDGDLRAVLAWVRRVTRLGS |
| Ga0187779_111651722 | 3300017959 | Tropical Peatland | LMAVALAVPAAGCAIIAFGVVAYILDGGDLKAVLTWARGAVRSRS |
| Ga0187783_100517814 | 3300017970 | Tropical Peatland | AFALAVPAALGAVLAFAVVAYLLDPRDLRTILALARRGRRG |
| Ga0187781_100041021 | 3300017972 | Tropical Peatland | KLVAAALAVPAAGLAIIAFGIVAYLLDDGDLKAVLAWVRRVARRRS |
| Ga0187781_107038601 | 3300017972 | Tropical Peatland | KLVAAALAVPAAGLAIIAFGIVAYLLDDGDLKAVLAWVRRVTRRRS |
| Ga0187781_114741822 | 3300017972 | Tropical Peatland | AGFAIIAYLVVAYLLDDGDLKAVLAWARRAAARLRS |
| Ga0187780_105361841 | 3300017973 | Tropical Peatland | AGLAIIAYGIVAYLLDDGDLKAILAWVRRVAMRRS |
| Ga0187777_106562681 | 3300017974 | Tropical Peatland | LALAVPAAGCAIIAYAVVAYLLDDGDLRAVLTWARTTVARLRS |
| Ga0187822_101645401 | 3300017994 | Freshwater Sediment | HKLEALALAIPAAGFAIVAYAVVAYLLDDGDLRAVLAWARRAAARPRS |
| Ga0187883_100576701 | 3300018037 | Peatland | ACGAIIAFTVVAYFLDDGDLRAVLAWVRRVAKLRKS |
| Ga0187765_101234492 | 3300018060 | Tropical Peatland | VAAALAVLAAGGAIIAFGVVAYILDDGDLKAVLAWVRHATRRR |
| Ga0187784_110979711 | 3300018062 | Tropical Peatland | AAGLAIIAFGIVAYLLDDGDLKAVLAWVRRVARRRS |
| Ga0187769_100770634 | 3300018086 | Tropical Peatland | LEAFVLAVPAACCAIIAFGVVAYFLDDGDLRAILAWVRRAAGRR |
| Ga0187770_102645871 | 3300018090 | Tropical Peatland | VPAAGGAIIVFGVVAYFLDDGDLKAVLGWVWRAAARLRS |
| Ga0210396_104063221 | 3300021180 | Soil | AACAIIAFGVVAYFLDDGDLKVVLRWARRAVARLRS |
| Ga0210388_112144732 | 3300021181 | Soil | LAVPAAGCAIIAFGVVAYFLDRRDLKVGLDWVRRIARLRSSTGKRAK |
| Ga0213876_105265281 | 3300021384 | Plant Roots | AVPAAAGAVIAFGAVAYVLDDGDLKAVVARVRRTTRPRSS |
| Ga0210393_114969182 | 3300021401 | Soil | VALAVPAAGCAIVAFGVVAFLLDDGDLKAVLTRVRRVVRRRS |
| Ga0210390_112036041 | 3300021474 | Soil | ALAVPPACCAILAFGIMAYILDKGDLKAVLARVRRAVRRRP |
| Ga0210398_113057623 | 3300021477 | Soil | KLDAVALAVPAVGGAILAFGLVAYFLDDGDLKAILAWVRRVTRPRS |
| Ga0207692_104399361 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | LAVPAAGSAIIAFGVVAYVLDDGDLKAVLAWVRGAVRRRS |
| Ga0207700_114043531 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | AATFAILAFGVVAYFLDDGDLRIILAWIRRAASRVRIRR |
| Ga0207700_119951782 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | AVLAAGCAIIAFGVVAYILDNGDLKAVLTWVRGAVRMRP |
| Ga0207702_114984462 | 3300026078 | Corn Rhizosphere | ALPAAGGAIIAFGVVAYILDDGDMKAVLAWLRRAVRQRS |
| Ga0207702_115551661 | 3300026078 | Corn Rhizosphere | VAGGVAVLAAGGAVIAFGVVAYLLDDGDLQPILALLRRVVRLRS |
| Ga0209838_10386091 | 3300026214 | Soil | MHHRLEDFALAVPAAGCAIIAFGVVAYLLDDGDLRAIVARVRRVARLRS |
| Ga0208860_10024761 | 3300027076 | Forest Soil | VALAVPAACCAILAFGVTAYILDNGDLKTILAWARRAVRRRS |
| Ga0209112_102875031 | 3300027817 | Forest Soil | HHKLDSFAVALPAALCAIVAFGVVAFLLDNGDLRAVLAWVRRAAPRLRS |
| Ga0209169_103059372 | 3300027879 | Soil | AIFAAGCAIVAYGVVVFLLDDGDFKTVLAWLRRTARLRG |
| Ga0209380_108233521 | 3300027889 | Soil | VPAACCAIIAFTVVAYFLDDGDLRAVLAWVRRVAKLRS |
| Ga0302220_100665291 | 3300028742 | Palsa | AVPAACGAIIVFLAVAYFLDDGDLRAVLAWVRRATRRGNRGKRGKS |
| Ga0302220_103446752 | 3300028742 | Palsa | VAVPAAGGAIIVFGVVAYFLDDGDLKAVLAWLRRAMTKLRS |
| Ga0302225_103158931 | 3300028780 | Palsa | FLLAIPAACGAIIAFGVVAYLLDNGDLKAVLAWVRRVARPRL |
| Ga0302232_101480421 | 3300028789 | Palsa | IPAACGAIIAFGVVAFLLDDGDLRAVLAWVRRVTRPRS |
| Ga0307299_104013481 | 3300028793 | Soil | GVAVLAAGGAVIAFGVVAYLLDDGDLQPILARLRRVVRLRS |
| Ga0302228_100547441 | 3300028808 | Palsa | PAACGAIIAFGVVAFLLDDGDLRAVLAWVRRVTRLRS |
| Ga0302228_105094811 | 3300028808 | Palsa | VAVAVPAAGGAIIVFGVVAYFLDDGDLKAVLAWLRRAMTKLRS |
| Ga0302235_103857421 | 3300028877 | Palsa | HKLEAFALAIPAACGAIIAFGVVAFLLDDGDLRAVLAWVRRVTRPRS |
| Ga0302229_101062282 | 3300028879 | Palsa | FALAIPAACGAIIAFGVVAFLLDDGDLRAVLAWVRRVTRPRS |
| Ga0311352_112823991 | 3300029944 | Palsa | HKLEAFALAIPAACGAIIAFGVVAFLLDDGDLRAVLAWVRRVTRLRS |
| Ga0311338_119215462 | 3300030007 | Palsa | VPAACGAIIVFLAVAYFLDDGDLRAVLAWVRRATRRGNRGKRGKS |
| Ga0302178_102189961 | 3300030013 | Palsa | EAFALAIPAACGAIIAFGVVAFLLDDGDLRAVLAWVRRVTRPRS |
| Ga0311356_104454301 | 3300030617 | Palsa | PAAGGAIIVFGVVAYFLDDGDLKAVLAWLRRAMTKLRS |
| Ga0311356_113062632 | 3300030617 | Palsa | IPAACGAIIAFGIVAYLLDNGDLKAVLAWVRRVARPRS |
| Ga0302180_101129522 | 3300031028 | Palsa | LVAAAMAVPAACGAIIVFLAVAYFLDDGDLRAVLAWVRRATRRGNRGKRGKS |
| Ga0302325_128302391 | 3300031234 | Palsa | AFLLAIPAACGAIIAFGVVAYLLDDGDLRAVLAWVRRVARLRS |
| Ga0302325_130852602 | 3300031234 | Palsa | PAACGAIIAFGIVAYLLDNGDLKAVLAWVRRVARLRS |
| Ga0302324_1000876374 | 3300031236 | Palsa | ALAIPAACGAIIAFGVVAFLLDDGDLRAVLAWVRRVTRPRS |
| Ga0302326_104663203 | 3300031525 | Palsa | HKLEAFLLAIPAACGAVIAFGVVAYLLDNGDLRAVLAWVRRVARLRS |
| Ga0318534_103113041 | 3300031544 | Soil | AGGAIVAFGVVAFLLDDGDLRAVLAWLRRVVRKRS |
| Ga0318571_102679981 | 3300031549 | Soil | LAVPAAGCAIIVFGVVAYFLDGGDLKAVLAWVRRAVRPRS |
| Ga0318555_100102603 | 3300031640 | Soil | LAAGCAIVAFGVVAYILDDGDLKAVLAWVRRAAKLRS |
| Ga0318574_100074754 | 3300031680 | Soil | HKLVAVFVAVPAAGCAIIAFGVVAYFLDDGDLRAVLAWLRRAVAKLRS |
| Ga0318572_103622801 | 3300031681 | Soil | AAGCAIIAFGVVAYLLDDGDLKAVLAWVRRAMGRLRS |
| Ga0310686_1129077572 | 3300031708 | Soil | GALAAACAAAVFGVVAYLLDGGELKTALARVRRTVLR |
| Ga0310686_1142993282 | 3300031708 | Soil | ALAVPAAVCAIIAFGVVAYLLDDGDLRAVLAWVRRAVRRQR |
| Ga0306917_102293653 | 3300031719 | Soil | KLEAVALALPAAGCAIIAFCVVAYLLDDGDLKAVLAWVRRVARPRS |
| Ga0318493_100104611 | 3300031723 | Soil | HHELEAAALAVPAAGLAIVAYAVVAYLLDDGDLRAVLAWARRAVRPRG |
| Ga0318501_101566522 | 3300031736 | Soil | LEAAALAVPAAGLAIVAYAVVAYLLDDGDLRAVLAWARRAVRPRG |
| Ga0318498_100575421 | 3300031778 | Soil | AALAVPAAGLGIVAYAVVAYLLDDGDLRAVLAWARRAVRPRG |
| Ga0318498_100674261 | 3300031778 | Soil | HKLEAVALAVPAAGGAIVAFGVVAFLLDDGDLRAVLAWLRRVVRKRS |
| Ga0318508_12157511 | 3300031780 | Soil | ALPAAGCAIIAFCVVAYLLDDGDLKAVLAWVRRVARPRS |
| Ga0318565_104073571 | 3300031799 | Soil | VLAILAFGVVAYLLDDGDLKAVLAWVRRTVARLRS |
| Ga0310911_104228622 | 3300032035 | Soil | VPAAGCAIIAFGVVAYLLDDGDLKAVLAWVRRAMGRLRS |
| Ga0318559_101646491 | 3300032039 | Soil | HELEAAALAVPAAGLAIVAYAVVAYLLDDGDLRAVLAWARRAVRPRG |
| Ga0318558_104118762 | 3300032044 | Soil | AAALAVPAAVLAIIAFGVVAYLLDDGDLKAVLAWVRRALARLRPS |
| Ga0318575_101248492 | 3300032055 | Soil | GLAVSLAVPAAGLAIVAYAVVAYLLDDGDLRAVLAWARRAIRPRG |
| Ga0318505_103237772 | 3300032060 | Soil | VAVAVLAAGCAIVAFGVVAYILDDGDLKAVLAWVRRAAKLRS |
| Ga0318513_100054025 | 3300032065 | Soil | ALAVPVAGLAIVAYAVVAYLLDDGDLRAVLAWARRAIRPRG |
| Ga0318553_105269653 | 3300032068 | Soil | AGGAIVAFGVVAFLLDDGDLRAVLSWLRRVVRKRS |
| Ga0311301_114424641 | 3300032160 | Peatlands Soil | PAAGCAIIAFGVVAYLLDDGDLRAVLAWVRRVARLRS |
| Ga0348332_125622441 | 3300032515 | Plant Litter | AAGCAIVAYGVVVFLLDDGDFKTVLAWLRRTARLRG |
| Ga0335085_110823391 | 3300032770 | Soil | AVAVPAAGCAIIAFTIVAYILDDGDLKAVLAWVRSAVRLRS |
| Ga0318519_102143702 | 3300033290 | Soil | LEAVALAVPAAGGAIVAFGVVAFFLDDGDLRAVLAWLRRVVRKRS |
| ⦗Top⦘ |