NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F084055

Metagenome Family F084055

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F084055
Family Type Metagenome
Number of Sequences 112
Average Sequence Length 45 residues
Representative Sequence MHALVVRVTIHNADRTREVLNSQVVPQVSGAPGFKTGYWTWMTGGG
Number of Associated Samples 101
Number of Associated Scaffolds 112

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 100.00 %
% of genes near scaffold ends (potentially truncated) 91.07 %
% of genes from short scaffolds (< 2000 bps) 91.96 %
Associated GOLD sequencing projects 97
AlphaFold2 3D model prediction Yes
3D model pTM-score0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (51.786 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(20.536 % of family members)
Environment Ontology (ENVO) Unclassified
(25.893 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(48.214 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 21.62%    β-sheet: 0.00%    Coil/Unstructured: 78.38%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.40
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 112 Family Scaffolds
PF00248Aldo_ket_red 5.36
PF06803DUF1232 4.46
PF00583Acetyltransf_1 2.68
PF00903Glyoxalase 1.79
PF00266Aminotran_5 1.79
PF00211Guanylate_cyc 1.79
PF03069FmdA_AmdA 1.79
PF02803Thiolase_C 1.79
PF03733YccF 1.79
PF00754F5_F8_type_C 0.89
PF00561Abhydrolase_1 0.89
PF13560HTH_31 0.89
PF11769DUF3313 0.89
PF00990GGDEF 0.89
PF03575Peptidase_S51 0.89
PF01548DEDD_Tnp_IS110 0.89
PF03193RsgA_GTPase 0.89
PF07883Cupin_2 0.89
PF12697Abhydrolase_6 0.89
PF00216Bac_DNA_binding 0.89
PF04892VanZ 0.89
PF14681UPRTase 0.89
PF02129Peptidase_S15 0.89
PF04191PEMT 0.89
PF02371Transposase_20 0.89
PF01609DDE_Tnp_1 0.89
PF02311AraC_binding 0.89
PF10648Gmad2 0.89
PF01243Putative_PNPOx 0.89
PF01979Amidohydro_1 0.89
PF00293NUDIX 0.89
PF03551PadR 0.89
PF05239PRC 0.89
PF00106adh_short 0.89

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 112 Family Scaffolds
COG3339Uncharacterized membrane protein YkvA, DUF1232 familyFunction unknown [S] 4.46
COG3547TransposaseMobilome: prophages, transposons [X] 1.79
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 1.79
COG2421Acetamidase/formamidaseEnergy production and conversion [C] 1.79
COG0183Acetyl-CoA acetyltransferaseLipid transport and metabolism [I] 1.79
COG3304Uncharacterized membrane protein YccF, DUF307 familyFunction unknown [S] 1.79
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.89
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.89
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.89
COG5421TransposaseMobilome: prophages, transposons [X] 0.89
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.89
COG3293TransposaseMobilome: prophages, transposons [X] 0.89
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.89
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.89
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.89
COG1162Ribosome biogenesis GTPase RsgATranslation, ribosomal structure and biogenesis [J] 0.89
COG0776Bacterial nucleoid DNA-binding protein IHF-alphaReplication, recombination and repair [L] 0.89


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms51.79 %
UnclassifiedrootN/A48.21 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2189573002|GZIGXIF02GKQIGNot Available501Open in IMG/M
3300000890|JGI11643J12802_12048440All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium731Open in IMG/M
3300000953|JGI11615J12901_10615053All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium508Open in IMG/M
3300000955|JGI1027J12803_104559177Not Available526Open in IMG/M
3300000956|JGI10216J12902_111598195Not Available606Open in IMG/M
3300004156|Ga0062589_100727539All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales886Open in IMG/M
3300004479|Ga0062595_101676937All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium597Open in IMG/M
3300005177|Ga0066690_11032153Not Available515Open in IMG/M
3300005329|Ga0070683_101566184Not Available633Open in IMG/M
3300005332|Ga0066388_102812792Not Available889Open in IMG/M
3300005334|Ga0068869_100751887All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium835Open in IMG/M
3300005337|Ga0070682_100013906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4641Open in IMG/M
3300005343|Ga0070687_100571691All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300005444|Ga0070694_100898428Not Available731Open in IMG/M
3300005446|Ga0066686_10445309All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium884Open in IMG/M
3300005455|Ga0070663_100533905Not Available978Open in IMG/M
3300005467|Ga0070706_101561647Not Available602Open in IMG/M
3300005468|Ga0070707_100907010All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium846Open in IMG/M
3300005546|Ga0070696_101271996Not Available624Open in IMG/M
3300005549|Ga0070704_100385106All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1192Open in IMG/M
3300005575|Ga0066702_10820839Not Available554Open in IMG/M
3300005764|Ga0066903_100163221All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium3236Open in IMG/M
3300005764|Ga0066903_107934453Not Available545Open in IMG/M
3300005842|Ga0068858_101214345Not Available741Open in IMG/M
3300006038|Ga0075365_10107095All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1919Open in IMG/M
3300006046|Ga0066652_101045444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium774Open in IMG/M
3300006755|Ga0079222_12248588Not Available543Open in IMG/M
3300006806|Ga0079220_10684882All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300006852|Ga0075433_10003255All Organisms → cellular organisms → Bacteria12540Open in IMG/M
3300006871|Ga0075434_101414104Not Available705Open in IMG/M
3300006903|Ga0075426_11252416Not Available563Open in IMG/M
3300007076|Ga0075435_101793681All Organisms → cellular organisms → Bacteria → Terrabacteria group539Open in IMG/M
3300009147|Ga0114129_10467305All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1652Open in IMG/M
3300009148|Ga0105243_12649266Not Available541Open in IMG/M
3300009148|Ga0105243_13081313Not Available505Open in IMG/M
3300009162|Ga0075423_10103288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2983Open in IMG/M
3300009162|Ga0075423_12643672All Organisms → cellular organisms → Bacteria → Terrabacteria group549Open in IMG/M
3300009176|Ga0105242_10078069All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2763Open in IMG/M
3300010333|Ga0134080_10380539Not Available649Open in IMG/M
3300010366|Ga0126379_12399323Not Available627Open in IMG/M
3300010373|Ga0134128_10077616Not Available3796Open in IMG/M
3300010373|Ga0134128_12333141All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium589Open in IMG/M
3300010375|Ga0105239_12689738Not Available580Open in IMG/M
3300010401|Ga0134121_12384961Not Available569Open in IMG/M
3300011003|Ga0138514_100004355All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2028Open in IMG/M
3300012008|Ga0120174_1043761All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1267Open in IMG/M
3300012199|Ga0137383_11282344Not Available523Open in IMG/M
3300012199|Ga0137383_11283033Not Available523Open in IMG/M
3300012204|Ga0137374_10478997Not Available971Open in IMG/M
3300012206|Ga0137380_11298188Not Available613Open in IMG/M
3300012207|Ga0137381_11743848Not Available512Open in IMG/M
3300012912|Ga0157306_10073305All Organisms → cellular organisms → Bacteria926Open in IMG/M
3300012951|Ga0164300_10338711Not Available803Open in IMG/M
3300012955|Ga0164298_10703995Not Available709Open in IMG/M
3300012958|Ga0164299_10405246All Organisms → cellular organisms → Bacteria → Terrabacteria group878Open in IMG/M
3300012960|Ga0164301_10392069All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium969Open in IMG/M
3300012985|Ga0164308_12185837All Organisms → cellular organisms → Bacteria → Terrabacteria group515Open in IMG/M
3300012988|Ga0164306_11227005Not Available630Open in IMG/M
3300012989|Ga0164305_10317687Not Available1158Open in IMG/M
3300013294|Ga0120150_1023589All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1247Open in IMG/M
3300013306|Ga0163162_11433664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium786Open in IMG/M
3300015261|Ga0182006_1099959All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1031Open in IMG/M
3300015371|Ga0132258_11920338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Tetrasphaera → Tetrasphaera japonica → Tetrasphaera japonica T1-X71490Open in IMG/M
3300015374|Ga0132255_100856282All Organisms → cellular organisms → Bacteria1357Open in IMG/M
3300015374|Ga0132255_105853027All Organisms → cellular organisms → Bacteria → Terrabacteria group520Open in IMG/M
3300017974|Ga0187777_11317001All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium531Open in IMG/M
3300018027|Ga0184605_10323031Not Available698Open in IMG/M
3300018027|Ga0184605_10330082Not Available689Open in IMG/M
3300018032|Ga0187788_10033169All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1698Open in IMG/M
3300018433|Ga0066667_10914745All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium755Open in IMG/M
3300018465|Ga0190269_10044391All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2039Open in IMG/M
3300019362|Ga0173479_10777700Not Available527Open in IMG/M
3300020002|Ga0193730_1103705All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium790Open in IMG/M
3300023064|Ga0247801_1040314All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Lentzea → Lentzea jiangxiensis691Open in IMG/M
3300025911|Ga0207654_10647079Not Available757Open in IMG/M
3300025922|Ga0207646_10017709All Organisms → cellular organisms → Bacteria6658Open in IMG/M
3300025934|Ga0207686_10882408All Organisms → cellular organisms → Bacteria → Terrabacteria group721Open in IMG/M
3300025935|Ga0207709_11719843Not Available521Open in IMG/M
3300025935|Ga0207709_11860475All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium501Open in IMG/M
3300025945|Ga0207679_11826621Not Available555Open in IMG/M
3300025981|Ga0207640_11325327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium643Open in IMG/M
3300026312|Ga0209153_1278876Not Available534Open in IMG/M
3300026547|Ga0209156_10160931All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1085Open in IMG/M
3300026550|Ga0209474_10539849Not Available592Open in IMG/M
3300027857|Ga0209166_10218341Not Available1020Open in IMG/M
3300028380|Ga0268265_12314593Not Available544Open in IMG/M
3300028592|Ga0247822_10495013All Organisms → cellular organisms → Bacteria966Open in IMG/M
3300028716|Ga0307311_10034584All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1310Open in IMG/M
3300028717|Ga0307298_10027041All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1511Open in IMG/M
3300028717|Ga0307298_10183083Not Available614Open in IMG/M
3300028778|Ga0307288_10024547All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1957Open in IMG/M
3300028784|Ga0307282_10069193All Organisms → cellular organisms → Bacteria → Terrabacteria group1601Open in IMG/M
3300028796|Ga0307287_10342232Not Available564Open in IMG/M
3300028807|Ga0307305_10112890All Organisms → cellular organisms → Bacteria → Terrabacteria group1255Open in IMG/M
3300028807|Ga0307305_10320353Not Available705Open in IMG/M
3300028814|Ga0307302_10239762Not Available888Open in IMG/M
3300028819|Ga0307296_10392321Not Available758Open in IMG/M
3300028828|Ga0307312_10176072All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. KY751367Open in IMG/M
3300028884|Ga0307308_10145439All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1134Open in IMG/M
3300031543|Ga0318516_10305896Not Available919Open in IMG/M
3300031680|Ga0318574_10840254Not Available538Open in IMG/M
3300031747|Ga0318502_10698212Not Available613Open in IMG/M
3300031859|Ga0318527_10167048All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium927Open in IMG/M
3300031893|Ga0318536_10661305All Organisms → cellular organisms → Bacteria → Terrabacteria group521Open in IMG/M
3300031896|Ga0318551_10541667Not Available669Open in IMG/M
3300031938|Ga0308175_100767492All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium1052Open in IMG/M
3300032001|Ga0306922_12064601Not Available553Open in IMG/M
3300032025|Ga0318507_10430726Not Available574Open in IMG/M
3300032075|Ga0310890_10287743All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1175Open in IMG/M
3300032180|Ga0307471_101556341Not Available818Open in IMG/M
3300032782|Ga0335082_10571179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium992Open in IMG/M
3300032782|Ga0335082_11101352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria660Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil20.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil9.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.25%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.25%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.36%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere5.36%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.46%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.68%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.68%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.68%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.79%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.79%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.79%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.79%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.79%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.79%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.79%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.79%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.79%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.89%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.89%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.89%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.89%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.89%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.89%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.89%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.89%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.89%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.89%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2189573002Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml)EnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006038Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011003Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015EnvironmentalOpen in IMG/M
3300012008Permafrost microbial communities from Nunavut, Canada - A39_80cm_12MEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013294Permafrost microbial communities from Nunavut, Canada - A3_65cm_0MEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300015261Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018032Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300020002Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1EnvironmentalOpen in IMG/M
3300023064Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S001-104B-6EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026312Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FE1_071268002189573002Grass SoilMYALVVRVTIHNVDRTRDVLNNQVVPQVSGAPGFKAGYWTWGTGGGVTNGL
JGI11643J12802_1204844023300000890SoilMHALVVRATIHNADRTREVLKSQVVPQASGAPGFKAGYWTWPTGEGELNVL
JGI11615J12901_1061505323300000953SoilMHAVVVRATIHNADRTREVLNSQVVPQASGAPGFKAGYWTWP
JGI1027J12803_10455917723300000955SoilMHALVVRVTIHNADRTREVLNSQVVPGVSGAPGFEAGYWTWSTG
JGI10216J12902_11159819523300000956SoilMHSLVVRAAIHNADRTRQVLNSQVVPQVSSAPGFKAGYWTWSTGEG
Ga0062589_10072753913300004156SoilMHALVVRATIHNADRTREVLNSQVLPQASGAPGFKAGYWTWPTGEG
Ga0062595_10167693723300004479SoilMHALVVRVTIHNADRTRQVLNSQVVPRVSGAPGFKAGYWTWSTGG
Ga0066690_1103215313300005177SoilMHALVVRVTINNADRTREVLNSQVVPQVSGAPGFKTGYWTWSAGGGE
Ga0070683_10156618423300005329Corn RhizosphereMHAVVVRVTIHNADRTRQVLTGQVVPQVSGATGFKSGYWTWSTGSGDLNGLS
Ga0066388_10281279223300005332Tropical Forest SoilMHALVVHGSIHNADRAREILDSQVVSLASGAPGFSAGYWTWPTGEGELNV
Ga0068869_10075188723300005334Miscanthus RhizosphereMHALVVRVTIHNADRTREVLNSQVVPQVSGAPGFKTGYWTWSTGGGESNGL
Ga0070682_10001390643300005337Corn RhizosphereMHALVVRLIIHDADRTREVLDSQVVPQVSGAPGFQTGYWTWSSGGGELKGSR*
Ga0070687_10057169123300005343Switchgrass RhizosphereMHALVVRVTIHNADRTREVLNGQVVPGISGAPGFKTGYWTWSSGGELNGLSMIIF
Ga0070694_10089842813300005444Corn, Switchgrass And Miscanthus RhizosphereMHALVVRVTIHNADRTRELLNSQVVPQVSGAPGFKTGYWTWPTGGGELNGL
Ga0066686_1044530923300005446SoilMHALVVRVTIHNADRTREVLNSQVVPQVSGAPGFKAGYWTWATGGGET
Ga0070663_10053390533300005455Corn RhizosphereMHALVVRLIIHDADRTREVLDSQVVPQVSGAPGFQTGYWRWSSGGGELKGSR*
Ga0070706_10156164713300005467Corn, Switchgrass And Miscanthus RhizosphereMHALVVRVTIHNADRTREVLNSQVVPQVSGAPGFKTGYWTWMTGGGE
Ga0070707_10090701013300005468Corn, Switchgrass And Miscanthus RhizosphereMHAVVVRVTIHNADRTREVLNSQVVPQVSGAPGFKTGYWTWSTGGG
Ga0070696_10127199633300005546Corn, Switchgrass And Miscanthus RhizosphereMHALVTRVTIHNADATREALNSQVVPGISGAPGFKTGYWTW
Ga0070704_10038510613300005549Corn, Switchgrass And Miscanthus RhizosphereMHALVVRVTIHNADRTREVLNSQVVPQVSGAPGFKTGYWTWMTGGG
Ga0066702_1082083913300005575SoilMHALVVRVNIHNADRTREVLNSQVVPQVSGAPGFKTGYWTWSTGGGELNGLSMI
Ga0066903_10016322113300005764Tropical Forest SoilMHALVVRVTIHDADSTGEVLRSEVVPQVTAAPGFKAGYWTWSSGG
Ga0066903_10793445313300005764Tropical Forest SoilMHALVVRGTIHDAERTREVLNGQVVLLASGAPGFKAG
Ga0068858_10121434523300005842Switchgrass RhizosphereMHAVVVRVTIHNADRTREVLTSQVVPQISAAPGFKSG
Ga0075365_1010709543300006038Populus EndosphereMHALVVRVTIHNADRTREVLNGQVVPGISGAPGFKTGYWTWS
Ga0066652_10104544433300006046SoilMHACVVRVTIHNADRTREVLNSQVVPQVSGAPGFKA
Ga0079222_1224858813300006755Agricultural SoilMHAVVVRVTIHNADRTREVLTGQVVPQVSGATGFKSGYWTWSTGSG
Ga0079220_1068488213300006806Agricultural SoilMHALVVRVTIHNADRTREVLNSQVVPQVSGAPGFKTGYWTWATGGGGLNGLSMIV
Ga0075433_1000325583300006852Populus RhizosphereMHALVVRATIHNADRTREVLNSQVLPQASGAPGFKAGYWTWPTGEGD*
Ga0075434_10141410443300006871Populus RhizosphereMHALVVRATIHNADRTREVLNSQVLPQASGAPGFKAGYWTWPTGEGE
Ga0075426_1125241623300006903Populus RhizosphereMHALVVRATIHNADRTREVLNSQVVPQASGAPGFKAGYWT
Ga0075435_10179368123300007076Populus RhizosphereMHALVVRATIHNADRTREVLNSQVLPQASGAPGFKAGYWTWPTGEGEL
Ga0114129_1046730523300009147Populus RhizosphereMHALVVRVTIHDAHRTREVLNGQVVPQLSGAPGFKTGYWTWSTGGEL
Ga0105243_1264926623300009148Miscanthus RhizosphereMHALVVRVTIHNADRTREVLNSQVVPQVSGAPGFKTGYW
Ga0105243_1308131313300009148Miscanthus RhizosphereMHALVVRVTIHNADRTREMLTGQVVPQASGAPGFKTGYWTWPT
Ga0075423_1010328813300009162Populus RhizosphereMHALVVRATIHNADRTREVLNSQVLPQASGAPGFKAGYWTWPTGE
Ga0075423_1264367213300009162Populus RhizosphereMHALVVRATIHNADRTREVLNSQVLPQASGAPGFKAGYWTWPTGEGELN
Ga0105242_1007806913300009176Miscanthus RhizosphereMHALVVRLIIHDADRTREVLDSQVVPQVSGAPGFQTGYWRWSSGGGEL
Ga0134080_1038053913300010333Grasslands SoilMYALVVRVTIHNADRTREVLNSQVVPQVSGAPGFTAGYWTWATGGGGDERSLDDHL*
Ga0126379_1239932313300010366Tropical Forest SoilMHAVVVRVNIHNADRTREVLNSQVVPQVSGAPGFEAGY
Ga0134128_1007761613300010373Terrestrial SoilMHALVVRVTIHNADRTREVLNSQVVPQVSGAPGFKTGYWTWTTGGGETNGLSMV
Ga0134128_1233314113300010373Terrestrial SoilMHALVVRVTIHNADRTREVLNSQVVPQVSGAPGFKTGHWTWITGGGE
Ga0105239_1268973813300010375Corn RhizosphereMHAVVVRVTIHNADRTRQVLTGQVVPQVSGATGFK
Ga0134121_1238496113300010401Terrestrial SoilMHALVVRLIIHDADRTREVLDSQVVPQVSGAPGFQTGYWTWASGGGELKGSR*
Ga0138514_10000435513300011003SoilMHALVVQVTIHNADRTREVLNSQVVPQVSGAPGFKTGYWTWTTGGGETNGLS
Ga0120174_104376113300012008PermafrostMHALVVRVTIHDVDRTREVLNSQVVPQASGAPGFKAGYWTWSTGGGES
Ga0137383_1128234413300012199Vadose Zone SoilMHALVVRVTIDDADRTREVLKTQVVPQASGAPGFKTGYWTW
Ga0137383_1128303323300012199Vadose Zone SoilMHALVVRVTIHNADRTREVLNSQVVPQVSGAPGFKTGYWTWTTGGE
Ga0137374_1047899733300012204Vadose Zone SoilMHALVVHVTIHNADRTRELLNSQVVPQVSGAPGFK
Ga0137380_1129818813300012206Vadose Zone SoilMHALVVRVTIHNADRTREVLNNQVVPQVSGAPGFKTGYWTWPTGGGELNGLS
Ga0137381_1174384813300012207Vadose Zone SoilMHAVVVRVTIHNADRTREVLNSQVVPQVSGAPGFKSGYWTWSTDGGQLNGLSMVI
Ga0157306_1007330523300012912SoilMHALVVRVTIHNADRTREVLNGQVVPGISGAPGFKTGYWTW
Ga0164300_1033871113300012951SoilMHAVVVRVTIHNADRTREVLNGRVVPQVSGAPGFKAGYWTWSTG
Ga0164298_1070399513300012955SoilMHAVVVRVTIHNADRTREVLNSQVVPQVSGAPGFKTGYWTWSTGDGQLNGLAMS
Ga0164299_1040524643300012958SoilMHALVVRVTIHNADRTRRVLNSQVVPRVSAAPGFKAGYWTWAAGVG
Ga0164301_1039206913300012960SoilMHALVVRVTIHNDDRTREVLNSQVVPQVSGAPGFKTGYWTWTTG
Ga0164308_1218583723300012985SoilMHAVVVRVTIHNADRTREVLNSQVVPQVSGAPGFKAGYWTWATGGGE
Ga0164306_1122700533300012988SoilMHAVVVRVTIHNADRTREVLNSQVVPQVSGAPGFKTGYWTWSTG
Ga0164305_1031768713300012989SoilMHALVVRVTIHNVDRTREALNSRVVPQVSSAPGFKTGYWTWAT
Ga0120150_102358913300013294PermafrostMHAVVVRVTIHNADRTRDVLNDQVVPQVSGASGFKAGYWTWSTSGGGTNGLSM
Ga0163162_1143366413300013306Switchgrass RhizosphereMHALVVRVTIHNADRTREVLNSQVVPQVSGAPGFKTGYWTWMTGGGET
Ga0182006_109995923300015261RhizosphereMYALVVRVTIHNADRTREVLNNQVVPGISGAPGFKTGYWTWLTGGGG*
Ga0132258_1192033843300015371Arabidopsis RhizosphereMHAVAVRATIHNADRTREVLNSQVVPLASGAPGFKAGYWTWPTGEGS*
Ga0132255_10085628213300015374Arabidopsis RhizosphereMHALVVRVTIHNADRTREVLNSQVVPGVSGAPGFE
Ga0132255_10585302713300015374Arabidopsis RhizosphereMHAVVVRVTIHNADRTREVLNSQVVPQVSGAPGFKAGYWTW
Ga0187777_1131700113300017974Tropical PeatlandMHALVTHVTIHNADHTREMLTSRVVPGVSSAPGFKTGYWTWQTGGDGVNG
Ga0184605_1032303123300018027Groundwater SedimentMHALVVRVTIHNADRTREVLNSQVVPQVSGAPGFKTGYWTW
Ga0184605_1033008213300018027Groundwater SedimentMHALVVRVTIHNADRTREVLNSQVVPQVSGAPGFKTGYWTWTTGGAETNGLSM
Ga0187788_1003316913300018032Tropical PeatlandMYALVVRVTIRNADRVRGTLNSQVVPQTSSAPGFKAGYWTWPTGGGALNGLAMIIF
Ga0066667_1091474533300018433Grasslands SoilMHALVVRVTIHNADHTREVLNSQVVPQVSGAPGFKTGYWTWTTGGVETN
Ga0190269_1004439133300018465SoilMHALVVRVTIHNADRTREVLNSQVVPQVSGAPGFKTGYWT
Ga0173479_1077770023300019362SoilMHALVVRAAIHNADRTREVLKSRVVPLASGAPGFKA
Ga0193730_110370523300020002SoilMHALVVRVTIHNADRTRDVLNSQVVPQVSGAPGFKTGYWTWATGGGET
Ga0247801_104031413300023064SoilMHALVVRVTIHNADRTRELLNSQVVPQVSGAPGFKTGYWTWPTGGG
Ga0207654_1064707913300025911Corn RhizosphereMHALVVRVTIHNADRTREVLNSQVVPQVSGAPGFKTGYWTWTTGGGE
Ga0207646_1001770993300025922Corn, Switchgrass And Miscanthus RhizosphereMHALVVRVTIHNPDRTREVLNSEVVPQVSGAPGFKTG
Ga0207686_1088240813300025934Miscanthus RhizosphereMHALVVRLIIHDADRTREVLDSQVVPQVSGAPGFQTGYWT
Ga0207709_1171984313300025935Miscanthus RhizosphereMHALVVRVTIHNADRTREMLTGQVVPQASGAPGFKTGYWTWPTGDGEL
Ga0207709_1186047513300025935Miscanthus RhizosphereMHALVVRVTIHNADRTREVLNSQVVPQVSGAPGFKTGYWTWMTGGGETNGLSMV
Ga0207679_1182662113300025945Corn RhizosphereMHALVVRLIIHDADRTREVLDGQVVPQVSGAPGFQTGYWTWSSGGGELKGSR
Ga0207640_1132532713300025981Corn RhizosphereMHALVVRVTIHNADRTREVLDSQVVPQVSGAPGFKAGYWTWATGGGETNGLSMIIFD
Ga0209153_127887613300026312SoilMHALVVRVTIHNADRTREVLNSQVVPQVSGAPGFKTGYWTWTTGG
Ga0209156_1016093113300026547SoilMYAVVIRVTIHNVDRTREVLNSQVVPQVSGAPGFKTGYWTWSTGGGESNGLSM
Ga0209474_1053984923300026550SoilMHALVTHVTIHNADATREALNSQVVPGISGAPGFKTGYWTWPTGSGASNGLAMLIF
Ga0209166_1021834113300027857Surface SoilMHAVVVRVTIHNADRTREMLNSQVVPQVSGAPGFK
Ga0268265_1231459313300028380Switchgrass RhizosphereMHALVVRVTIHNADRTREVLNGQVVPGISGAPGFKTGYWTWSSGGELNGLS
Ga0247822_1049501323300028592SoilMHALVVRVTIHNADRTREVLNGQVVPGISGAPGFK
Ga0307311_1003458433300028716SoilMHALVVRVTIHNADRTREVLNSQVVPQVSGGPGFKTGYW
Ga0307298_1002704113300028717SoilMHALVVRVTIHNADRTREVLNSQVVPQVSGAPGFKT
Ga0307298_1018308313300028717SoilMHALVVRVTIHNADRTREVLNSQVVPQVSGAPGFKTGYWTWT
Ga0307288_1002454713300028778SoilMHALVVRVTIHNADRTREVLNSQVVPQVSGAPGFKTGYWTWMTGGGETNGLS
Ga0307282_1006919333300028784SoilMHALVVRVTIHNADRTRELLNSQVVPQVSGAPGFKTG
Ga0307287_1034223213300028796SoilMHALVVRVTIHNADRTREVLNSQVVPQVSGAPGFKAGYWTWATGGGETNG
Ga0307305_1011289013300028807SoilMHALVVRVTIHNADRTRELLNSQVVPQVSGAPGFKTGY
Ga0307305_1032035313300028807SoilMHALVVRVTIHNADRTREVLNSQVVPQVSGAPGFKTGYWTWTTG
Ga0307302_1023976213300028814SoilMHALVVRVTIHNADRTREMLNSQVVPQVSGAPGFKTGYWTWPTGGAAPNG
Ga0307296_1039232123300028819SoilMHALVVRVTIHNADRTREMLNSRVVPQVSGAPGFKTGYWTWPTGGAAPN
Ga0307312_1017607243300028828SoilMHALIVRVIIHNADRTREMLNSQVVPQVSGAPGFKTGYWTWSTGGGEL
Ga0307308_1014543923300028884SoilMHALVVRVTIHNADRTREVLNSQVVPQVSGAPGFKTGYWTWTTGGAET
Ga0318516_1030589633300031543SoilMHAVVVRVTIHDADRAREVLNSQVVQLASGAPGFKAGYWTWPTV
Ga0318574_1084025423300031680SoilMYALVVRVTIHNADRTREVLNNQVVPQASGAPGFKAGYWTWPTGEGELNGL
Ga0318502_1069821223300031747SoilMHALVVRVTIHNMDRTREVLNSQVVPKLSGAPGFKTGYWTWST
Ga0318527_1016704833300031859SoilMYALVVRVTIHNADRVRGRLNSEVVPQTSSAPGFKAGYWTWPTGGEELN
Ga0318536_1066130523300031893SoilMYALVVRVTIRDADRVRGRLNSEVVPQTSSAPGFKAGYWT
Ga0318551_1054166733300031896SoilMHAVVVRVTIHDADRAREVLNSQVVQLASGAPGFK
Ga0308175_10076749223300031938SoilMHAVVIRVTINNPDRTREVLNSQVVPQVSGAPGFKTGYWTWAT
Ga0306922_1206460133300032001SoilMHAVVVRVTIHDADRAREVLNSQVVQLASGAPGFKAGYWTWPTVEGQLNALT
Ga0318507_1043072613300032025SoilMHAVVVRVTIHDADRAREVLNSQVVQLASGAPGFKAG
Ga0310890_1028774333300032075SoilMHALVVRVTIHNADRTREVLNGQVVPGISGAPGFKTGY
Ga0307471_10155634133300032180Hardwood Forest SoilMHALIVRVTIHNADTTREVLNSQVVPQASSAPGFKTGY
Ga0335082_1057117933300032782SoilMHALVTHVTIHDADRTRELLNSQVVPAVSGAPGFQTGHWAWSTGD
Ga0335082_1110135223300032782SoilMHALVTRVTIHNADHTREMLTSQVVPQVSGAPGFKTGYWTWQTDEGELN


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.