| Basic Information | |
|---|---|
| Family ID | F084055 |
| Family Type | Metagenome |
| Number of Sequences | 112 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MHALVVRVTIHNADRTREVLNSQVVPQVSGAPGFKTGYWTWMTGGG |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 91.07 % |
| % of genes from short scaffolds (< 2000 bps) | 91.96 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (51.786 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (20.536 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.893 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.214 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 21.62% β-sheet: 0.00% Coil/Unstructured: 78.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF00248 | Aldo_ket_red | 5.36 |
| PF06803 | DUF1232 | 4.46 |
| PF00583 | Acetyltransf_1 | 2.68 |
| PF00903 | Glyoxalase | 1.79 |
| PF00266 | Aminotran_5 | 1.79 |
| PF00211 | Guanylate_cyc | 1.79 |
| PF03069 | FmdA_AmdA | 1.79 |
| PF02803 | Thiolase_C | 1.79 |
| PF03733 | YccF | 1.79 |
| PF00754 | F5_F8_type_C | 0.89 |
| PF00561 | Abhydrolase_1 | 0.89 |
| PF13560 | HTH_31 | 0.89 |
| PF11769 | DUF3313 | 0.89 |
| PF00990 | GGDEF | 0.89 |
| PF03575 | Peptidase_S51 | 0.89 |
| PF01548 | DEDD_Tnp_IS110 | 0.89 |
| PF03193 | RsgA_GTPase | 0.89 |
| PF07883 | Cupin_2 | 0.89 |
| PF12697 | Abhydrolase_6 | 0.89 |
| PF00216 | Bac_DNA_binding | 0.89 |
| PF04892 | VanZ | 0.89 |
| PF14681 | UPRTase | 0.89 |
| PF02129 | Peptidase_S15 | 0.89 |
| PF04191 | PEMT | 0.89 |
| PF02371 | Transposase_20 | 0.89 |
| PF01609 | DDE_Tnp_1 | 0.89 |
| PF02311 | AraC_binding | 0.89 |
| PF10648 | Gmad2 | 0.89 |
| PF01243 | Putative_PNPOx | 0.89 |
| PF01979 | Amidohydro_1 | 0.89 |
| PF00293 | NUDIX | 0.89 |
| PF03551 | PadR | 0.89 |
| PF05239 | PRC | 0.89 |
| PF00106 | adh_short | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG3339 | Uncharacterized membrane protein YkvA, DUF1232 family | Function unknown [S] | 4.46 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.79 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 1.79 |
| COG2421 | Acetamidase/formamidase | Energy production and conversion [C] | 1.79 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 1.79 |
| COG3304 | Uncharacterized membrane protein YccF, DUF307 family | Function unknown [S] | 1.79 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.89 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.89 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.89 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.89 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.89 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.89 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.89 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.89 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.89 |
| COG1162 | Ribosome biogenesis GTPase RsgA | Translation, ribosomal structure and biogenesis [J] | 0.89 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 51.79 % |
| Unclassified | root | N/A | 48.21 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573002|GZIGXIF02GKQIG | Not Available | 501 | Open in IMG/M |
| 3300000890|JGI11643J12802_12048440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 731 | Open in IMG/M |
| 3300000953|JGI11615J12901_10615053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 508 | Open in IMG/M |
| 3300000955|JGI1027J12803_104559177 | Not Available | 526 | Open in IMG/M |
| 3300000956|JGI10216J12902_111598195 | Not Available | 606 | Open in IMG/M |
| 3300004156|Ga0062589_100727539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 886 | Open in IMG/M |
| 3300004479|Ga0062595_101676937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 597 | Open in IMG/M |
| 3300005177|Ga0066690_11032153 | Not Available | 515 | Open in IMG/M |
| 3300005329|Ga0070683_101566184 | Not Available | 633 | Open in IMG/M |
| 3300005332|Ga0066388_102812792 | Not Available | 889 | Open in IMG/M |
| 3300005334|Ga0068869_100751887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 835 | Open in IMG/M |
| 3300005337|Ga0070682_100013906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4641 | Open in IMG/M |
| 3300005343|Ga0070687_100571691 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300005444|Ga0070694_100898428 | Not Available | 731 | Open in IMG/M |
| 3300005446|Ga0066686_10445309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 884 | Open in IMG/M |
| 3300005455|Ga0070663_100533905 | Not Available | 978 | Open in IMG/M |
| 3300005467|Ga0070706_101561647 | Not Available | 602 | Open in IMG/M |
| 3300005468|Ga0070707_100907010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 846 | Open in IMG/M |
| 3300005546|Ga0070696_101271996 | Not Available | 624 | Open in IMG/M |
| 3300005549|Ga0070704_100385106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1192 | Open in IMG/M |
| 3300005575|Ga0066702_10820839 | Not Available | 554 | Open in IMG/M |
| 3300005764|Ga0066903_100163221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3236 | Open in IMG/M |
| 3300005764|Ga0066903_107934453 | Not Available | 545 | Open in IMG/M |
| 3300005842|Ga0068858_101214345 | Not Available | 741 | Open in IMG/M |
| 3300006038|Ga0075365_10107095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1919 | Open in IMG/M |
| 3300006046|Ga0066652_101045444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 774 | Open in IMG/M |
| 3300006755|Ga0079222_12248588 | Not Available | 543 | Open in IMG/M |
| 3300006806|Ga0079220_10684882 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300006852|Ga0075433_10003255 | All Organisms → cellular organisms → Bacteria | 12540 | Open in IMG/M |
| 3300006871|Ga0075434_101414104 | Not Available | 705 | Open in IMG/M |
| 3300006903|Ga0075426_11252416 | Not Available | 563 | Open in IMG/M |
| 3300007076|Ga0075435_101793681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 539 | Open in IMG/M |
| 3300009147|Ga0114129_10467305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1652 | Open in IMG/M |
| 3300009148|Ga0105243_12649266 | Not Available | 541 | Open in IMG/M |
| 3300009148|Ga0105243_13081313 | Not Available | 505 | Open in IMG/M |
| 3300009162|Ga0075423_10103288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2983 | Open in IMG/M |
| 3300009162|Ga0075423_12643672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 549 | Open in IMG/M |
| 3300009176|Ga0105242_10078069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2763 | Open in IMG/M |
| 3300010333|Ga0134080_10380539 | Not Available | 649 | Open in IMG/M |
| 3300010366|Ga0126379_12399323 | Not Available | 627 | Open in IMG/M |
| 3300010373|Ga0134128_10077616 | Not Available | 3796 | Open in IMG/M |
| 3300010373|Ga0134128_12333141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 589 | Open in IMG/M |
| 3300010375|Ga0105239_12689738 | Not Available | 580 | Open in IMG/M |
| 3300010401|Ga0134121_12384961 | Not Available | 569 | Open in IMG/M |
| 3300011003|Ga0138514_100004355 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2028 | Open in IMG/M |
| 3300012008|Ga0120174_1043761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1267 | Open in IMG/M |
| 3300012199|Ga0137383_11282344 | Not Available | 523 | Open in IMG/M |
| 3300012199|Ga0137383_11283033 | Not Available | 523 | Open in IMG/M |
| 3300012204|Ga0137374_10478997 | Not Available | 971 | Open in IMG/M |
| 3300012206|Ga0137380_11298188 | Not Available | 613 | Open in IMG/M |
| 3300012207|Ga0137381_11743848 | Not Available | 512 | Open in IMG/M |
| 3300012912|Ga0157306_10073305 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300012951|Ga0164300_10338711 | Not Available | 803 | Open in IMG/M |
| 3300012955|Ga0164298_10703995 | Not Available | 709 | Open in IMG/M |
| 3300012958|Ga0164299_10405246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 878 | Open in IMG/M |
| 3300012960|Ga0164301_10392069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 969 | Open in IMG/M |
| 3300012985|Ga0164308_12185837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 515 | Open in IMG/M |
| 3300012988|Ga0164306_11227005 | Not Available | 630 | Open in IMG/M |
| 3300012989|Ga0164305_10317687 | Not Available | 1158 | Open in IMG/M |
| 3300013294|Ga0120150_1023589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1247 | Open in IMG/M |
| 3300013306|Ga0163162_11433664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 786 | Open in IMG/M |
| 3300015261|Ga0182006_1099959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1031 | Open in IMG/M |
| 3300015371|Ga0132258_11920338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Tetrasphaera → Tetrasphaera japonica → Tetrasphaera japonica T1-X7 | 1490 | Open in IMG/M |
| 3300015374|Ga0132255_100856282 | All Organisms → cellular organisms → Bacteria | 1357 | Open in IMG/M |
| 3300015374|Ga0132255_105853027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 520 | Open in IMG/M |
| 3300017974|Ga0187777_11317001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 531 | Open in IMG/M |
| 3300018027|Ga0184605_10323031 | Not Available | 698 | Open in IMG/M |
| 3300018027|Ga0184605_10330082 | Not Available | 689 | Open in IMG/M |
| 3300018032|Ga0187788_10033169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1698 | Open in IMG/M |
| 3300018433|Ga0066667_10914745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 755 | Open in IMG/M |
| 3300018465|Ga0190269_10044391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2039 | Open in IMG/M |
| 3300019362|Ga0173479_10777700 | Not Available | 527 | Open in IMG/M |
| 3300020002|Ga0193730_1103705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 790 | Open in IMG/M |
| 3300023064|Ga0247801_1040314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Lentzea → Lentzea jiangxiensis | 691 | Open in IMG/M |
| 3300025911|Ga0207654_10647079 | Not Available | 757 | Open in IMG/M |
| 3300025922|Ga0207646_10017709 | All Organisms → cellular organisms → Bacteria | 6658 | Open in IMG/M |
| 3300025934|Ga0207686_10882408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 721 | Open in IMG/M |
| 3300025935|Ga0207709_11719843 | Not Available | 521 | Open in IMG/M |
| 3300025935|Ga0207709_11860475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 501 | Open in IMG/M |
| 3300025945|Ga0207679_11826621 | Not Available | 555 | Open in IMG/M |
| 3300025981|Ga0207640_11325327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 643 | Open in IMG/M |
| 3300026312|Ga0209153_1278876 | Not Available | 534 | Open in IMG/M |
| 3300026547|Ga0209156_10160931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1085 | Open in IMG/M |
| 3300026550|Ga0209474_10539849 | Not Available | 592 | Open in IMG/M |
| 3300027857|Ga0209166_10218341 | Not Available | 1020 | Open in IMG/M |
| 3300028380|Ga0268265_12314593 | Not Available | 544 | Open in IMG/M |
| 3300028592|Ga0247822_10495013 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300028716|Ga0307311_10034584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1310 | Open in IMG/M |
| 3300028717|Ga0307298_10027041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1511 | Open in IMG/M |
| 3300028717|Ga0307298_10183083 | Not Available | 614 | Open in IMG/M |
| 3300028778|Ga0307288_10024547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1957 | Open in IMG/M |
| 3300028784|Ga0307282_10069193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1601 | Open in IMG/M |
| 3300028796|Ga0307287_10342232 | Not Available | 564 | Open in IMG/M |
| 3300028807|Ga0307305_10112890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1255 | Open in IMG/M |
| 3300028807|Ga0307305_10320353 | Not Available | 705 | Open in IMG/M |
| 3300028814|Ga0307302_10239762 | Not Available | 888 | Open in IMG/M |
| 3300028819|Ga0307296_10392321 | Not Available | 758 | Open in IMG/M |
| 3300028828|Ga0307312_10176072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. KY75 | 1367 | Open in IMG/M |
| 3300028884|Ga0307308_10145439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1134 | Open in IMG/M |
| 3300031543|Ga0318516_10305896 | Not Available | 919 | Open in IMG/M |
| 3300031680|Ga0318574_10840254 | Not Available | 538 | Open in IMG/M |
| 3300031747|Ga0318502_10698212 | Not Available | 613 | Open in IMG/M |
| 3300031859|Ga0318527_10167048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 927 | Open in IMG/M |
| 3300031893|Ga0318536_10661305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 521 | Open in IMG/M |
| 3300031896|Ga0318551_10541667 | Not Available | 669 | Open in IMG/M |
| 3300031938|Ga0308175_100767492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 1052 | Open in IMG/M |
| 3300032001|Ga0306922_12064601 | Not Available | 553 | Open in IMG/M |
| 3300032025|Ga0318507_10430726 | Not Available | 574 | Open in IMG/M |
| 3300032075|Ga0310890_10287743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1175 | Open in IMG/M |
| 3300032180|Ga0307471_101556341 | Not Available | 818 | Open in IMG/M |
| 3300032782|Ga0335082_10571179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 992 | Open in IMG/M |
| 3300032782|Ga0335082_11101352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 660 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 20.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.25% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.25% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.36% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 5.36% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.46% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.68% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.68% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.68% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.79% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.79% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.79% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.79% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.79% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.79% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.79% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.79% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.89% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.89% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.89% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.89% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.89% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.89% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573002 | Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml) | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300012008 | Permafrost microbial communities from Nunavut, Canada - A39_80cm_12M | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013294 | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0M | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300023064 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S001-104B-6 | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FE1_07126800 | 2189573002 | Grass Soil | MYALVVRVTIHNVDRTRDVLNNQVVPQVSGAPGFKAGYWTWGTGGGVTNGL |
| JGI11643J12802_120484402 | 3300000890 | Soil | MHALVVRATIHNADRTREVLKSQVVPQASGAPGFKAGYWTWPTGEGELNVL |
| JGI11615J12901_106150532 | 3300000953 | Soil | MHAVVVRATIHNADRTREVLNSQVVPQASGAPGFKAGYWTWP |
| JGI1027J12803_1045591772 | 3300000955 | Soil | MHALVVRVTIHNADRTREVLNSQVVPGVSGAPGFEAGYWTWSTG |
| JGI10216J12902_1115981952 | 3300000956 | Soil | MHSLVVRAAIHNADRTRQVLNSQVVPQVSSAPGFKAGYWTWSTGEG |
| Ga0062589_1007275391 | 3300004156 | Soil | MHALVVRATIHNADRTREVLNSQVLPQASGAPGFKAGYWTWPTGEG |
| Ga0062595_1016769372 | 3300004479 | Soil | MHALVVRVTIHNADRTRQVLNSQVVPRVSGAPGFKAGYWTWSTGG |
| Ga0066690_110321531 | 3300005177 | Soil | MHALVVRVTINNADRTREVLNSQVVPQVSGAPGFKTGYWTWSAGGGE |
| Ga0070683_1015661842 | 3300005329 | Corn Rhizosphere | MHAVVVRVTIHNADRTRQVLTGQVVPQVSGATGFKSGYWTWSTGSGDLNGLS |
| Ga0066388_1028127922 | 3300005332 | Tropical Forest Soil | MHALVVHGSIHNADRAREILDSQVVSLASGAPGFSAGYWTWPTGEGELNV |
| Ga0068869_1007518872 | 3300005334 | Miscanthus Rhizosphere | MHALVVRVTIHNADRTREVLNSQVVPQVSGAPGFKTGYWTWSTGGGESNGL |
| Ga0070682_1000139064 | 3300005337 | Corn Rhizosphere | MHALVVRLIIHDADRTREVLDSQVVPQVSGAPGFQTGYWTWSSGGGELKGSR* |
| Ga0070687_1005716912 | 3300005343 | Switchgrass Rhizosphere | MHALVVRVTIHNADRTREVLNGQVVPGISGAPGFKTGYWTWSSGGELNGLSMIIF |
| Ga0070694_1008984281 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MHALVVRVTIHNADRTRELLNSQVVPQVSGAPGFKTGYWTWPTGGGELNGL |
| Ga0066686_104453092 | 3300005446 | Soil | MHALVVRVTIHNADRTREVLNSQVVPQVSGAPGFKAGYWTWATGGGET |
| Ga0070663_1005339053 | 3300005455 | Corn Rhizosphere | MHALVVRLIIHDADRTREVLDSQVVPQVSGAPGFQTGYWRWSSGGGELKGSR* |
| Ga0070706_1015616471 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MHALVVRVTIHNADRTREVLNSQVVPQVSGAPGFKTGYWTWMTGGGE |
| Ga0070707_1009070101 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MHAVVVRVTIHNADRTREVLNSQVVPQVSGAPGFKTGYWTWSTGGG |
| Ga0070696_1012719963 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MHALVTRVTIHNADATREALNSQVVPGISGAPGFKTGYWTW |
| Ga0070704_1003851061 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MHALVVRVTIHNADRTREVLNSQVVPQVSGAPGFKTGYWTWMTGGG |
| Ga0066702_108208391 | 3300005575 | Soil | MHALVVRVNIHNADRTREVLNSQVVPQVSGAPGFKTGYWTWSTGGGELNGLSMI |
| Ga0066903_1001632211 | 3300005764 | Tropical Forest Soil | MHALVVRVTIHDADSTGEVLRSEVVPQVTAAPGFKAGYWTWSSGG |
| Ga0066903_1079344531 | 3300005764 | Tropical Forest Soil | MHALVVRGTIHDAERTREVLNGQVVLLASGAPGFKAG |
| Ga0068858_1012143452 | 3300005842 | Switchgrass Rhizosphere | MHAVVVRVTIHNADRTREVLTSQVVPQISAAPGFKSG |
| Ga0075365_101070954 | 3300006038 | Populus Endosphere | MHALVVRVTIHNADRTREVLNGQVVPGISGAPGFKTGYWTWS |
| Ga0066652_1010454443 | 3300006046 | Soil | MHACVVRVTIHNADRTREVLNSQVVPQVSGAPGFKA |
| Ga0079222_122485881 | 3300006755 | Agricultural Soil | MHAVVVRVTIHNADRTREVLTGQVVPQVSGATGFKSGYWTWSTGSG |
| Ga0079220_106848821 | 3300006806 | Agricultural Soil | MHALVVRVTIHNADRTREVLNSQVVPQVSGAPGFKTGYWTWATGGGGLNGLSMIV |
| Ga0075433_100032558 | 3300006852 | Populus Rhizosphere | MHALVVRATIHNADRTREVLNSQVLPQASGAPGFKAGYWTWPTGEGD* |
| Ga0075434_1014141044 | 3300006871 | Populus Rhizosphere | MHALVVRATIHNADRTREVLNSQVLPQASGAPGFKAGYWTWPTGEGE |
| Ga0075426_112524162 | 3300006903 | Populus Rhizosphere | MHALVVRATIHNADRTREVLNSQVVPQASGAPGFKAGYWT |
| Ga0075435_1017936812 | 3300007076 | Populus Rhizosphere | MHALVVRATIHNADRTREVLNSQVLPQASGAPGFKAGYWTWPTGEGEL |
| Ga0114129_104673052 | 3300009147 | Populus Rhizosphere | MHALVVRVTIHDAHRTREVLNGQVVPQLSGAPGFKTGYWTWSTGGEL |
| Ga0105243_126492662 | 3300009148 | Miscanthus Rhizosphere | MHALVVRVTIHNADRTREVLNSQVVPQVSGAPGFKTGYW |
| Ga0105243_130813131 | 3300009148 | Miscanthus Rhizosphere | MHALVVRVTIHNADRTREMLTGQVVPQASGAPGFKTGYWTWPT |
| Ga0075423_101032881 | 3300009162 | Populus Rhizosphere | MHALVVRATIHNADRTREVLNSQVLPQASGAPGFKAGYWTWPTGE |
| Ga0075423_126436721 | 3300009162 | Populus Rhizosphere | MHALVVRATIHNADRTREVLNSQVLPQASGAPGFKAGYWTWPTGEGELN |
| Ga0105242_100780691 | 3300009176 | Miscanthus Rhizosphere | MHALVVRLIIHDADRTREVLDSQVVPQVSGAPGFQTGYWRWSSGGGEL |
| Ga0134080_103805391 | 3300010333 | Grasslands Soil | MYALVVRVTIHNADRTREVLNSQVVPQVSGAPGFTAGYWTWATGGGGDERSLDDHL* |
| Ga0126379_123993231 | 3300010366 | Tropical Forest Soil | MHAVVVRVNIHNADRTREVLNSQVVPQVSGAPGFEAGY |
| Ga0134128_100776161 | 3300010373 | Terrestrial Soil | MHALVVRVTIHNADRTREVLNSQVVPQVSGAPGFKTGYWTWTTGGGETNGLSMV |
| Ga0134128_123331411 | 3300010373 | Terrestrial Soil | MHALVVRVTIHNADRTREVLNSQVVPQVSGAPGFKTGHWTWITGGGE |
| Ga0105239_126897381 | 3300010375 | Corn Rhizosphere | MHAVVVRVTIHNADRTRQVLTGQVVPQVSGATGFK |
| Ga0134121_123849611 | 3300010401 | Terrestrial Soil | MHALVVRLIIHDADRTREVLDSQVVPQVSGAPGFQTGYWTWASGGGELKGSR* |
| Ga0138514_1000043551 | 3300011003 | Soil | MHALVVQVTIHNADRTREVLNSQVVPQVSGAPGFKTGYWTWTTGGGETNGLS |
| Ga0120174_10437611 | 3300012008 | Permafrost | MHALVVRVTIHDVDRTREVLNSQVVPQASGAPGFKAGYWTWSTGGGES |
| Ga0137383_112823441 | 3300012199 | Vadose Zone Soil | MHALVVRVTIDDADRTREVLKTQVVPQASGAPGFKTGYWTW |
| Ga0137383_112830332 | 3300012199 | Vadose Zone Soil | MHALVVRVTIHNADRTREVLNSQVVPQVSGAPGFKTGYWTWTTGGE |
| Ga0137374_104789973 | 3300012204 | Vadose Zone Soil | MHALVVHVTIHNADRTRELLNSQVVPQVSGAPGFK |
| Ga0137380_112981881 | 3300012206 | Vadose Zone Soil | MHALVVRVTIHNADRTREVLNNQVVPQVSGAPGFKTGYWTWPTGGGELNGLS |
| Ga0137381_117438481 | 3300012207 | Vadose Zone Soil | MHAVVVRVTIHNADRTREVLNSQVVPQVSGAPGFKSGYWTWSTDGGQLNGLSMVI |
| Ga0157306_100733052 | 3300012912 | Soil | MHALVVRVTIHNADRTREVLNGQVVPGISGAPGFKTGYWTW |
| Ga0164300_103387111 | 3300012951 | Soil | MHAVVVRVTIHNADRTREVLNGRVVPQVSGAPGFKAGYWTWSTG |
| Ga0164298_107039951 | 3300012955 | Soil | MHAVVVRVTIHNADRTREVLNSQVVPQVSGAPGFKTGYWTWSTGDGQLNGLAMS |
| Ga0164299_104052464 | 3300012958 | Soil | MHALVVRVTIHNADRTRRVLNSQVVPRVSAAPGFKAGYWTWAAGVG |
| Ga0164301_103920691 | 3300012960 | Soil | MHALVVRVTIHNDDRTREVLNSQVVPQVSGAPGFKTGYWTWTTG |
| Ga0164308_121858372 | 3300012985 | Soil | MHAVVVRVTIHNADRTREVLNSQVVPQVSGAPGFKAGYWTWATGGGE |
| Ga0164306_112270053 | 3300012988 | Soil | MHAVVVRVTIHNADRTREVLNSQVVPQVSGAPGFKTGYWTWSTG |
| Ga0164305_103176871 | 3300012989 | Soil | MHALVVRVTIHNVDRTREALNSRVVPQVSSAPGFKTGYWTWAT |
| Ga0120150_10235891 | 3300013294 | Permafrost | MHAVVVRVTIHNADRTRDVLNDQVVPQVSGASGFKAGYWTWSTSGGGTNGLSM |
| Ga0163162_114336641 | 3300013306 | Switchgrass Rhizosphere | MHALVVRVTIHNADRTREVLNSQVVPQVSGAPGFKTGYWTWMTGGGET |
| Ga0182006_10999592 | 3300015261 | Rhizosphere | MYALVVRVTIHNADRTREVLNNQVVPGISGAPGFKTGYWTWLTGGGG* |
| Ga0132258_119203384 | 3300015371 | Arabidopsis Rhizosphere | MHAVAVRATIHNADRTREVLNSQVVPLASGAPGFKAGYWTWPTGEGS* |
| Ga0132255_1008562821 | 3300015374 | Arabidopsis Rhizosphere | MHALVVRVTIHNADRTREVLNSQVVPGVSGAPGFE |
| Ga0132255_1058530271 | 3300015374 | Arabidopsis Rhizosphere | MHAVVVRVTIHNADRTREVLNSQVVPQVSGAPGFKAGYWTW |
| Ga0187777_113170011 | 3300017974 | Tropical Peatland | MHALVTHVTIHNADHTREMLTSRVVPGVSSAPGFKTGYWTWQTGGDGVNG |
| Ga0184605_103230312 | 3300018027 | Groundwater Sediment | MHALVVRVTIHNADRTREVLNSQVVPQVSGAPGFKTGYWTW |
| Ga0184605_103300821 | 3300018027 | Groundwater Sediment | MHALVVRVTIHNADRTREVLNSQVVPQVSGAPGFKTGYWTWTTGGAETNGLSM |
| Ga0187788_100331691 | 3300018032 | Tropical Peatland | MYALVVRVTIRNADRVRGTLNSQVVPQTSSAPGFKAGYWTWPTGGGALNGLAMIIF |
| Ga0066667_109147453 | 3300018433 | Grasslands Soil | MHALVVRVTIHNADHTREVLNSQVVPQVSGAPGFKTGYWTWTTGGVETN |
| Ga0190269_100443913 | 3300018465 | Soil | MHALVVRVTIHNADRTREVLNSQVVPQVSGAPGFKTGYWT |
| Ga0173479_107777002 | 3300019362 | Soil | MHALVVRAAIHNADRTREVLKSRVVPLASGAPGFKA |
| Ga0193730_11037052 | 3300020002 | Soil | MHALVVRVTIHNADRTRDVLNSQVVPQVSGAPGFKTGYWTWATGGGET |
| Ga0247801_10403141 | 3300023064 | Soil | MHALVVRVTIHNADRTRELLNSQVVPQVSGAPGFKTGYWTWPTGGG |
| Ga0207654_106470791 | 3300025911 | Corn Rhizosphere | MHALVVRVTIHNADRTREVLNSQVVPQVSGAPGFKTGYWTWTTGGGE |
| Ga0207646_100177099 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MHALVVRVTIHNPDRTREVLNSEVVPQVSGAPGFKTG |
| Ga0207686_108824081 | 3300025934 | Miscanthus Rhizosphere | MHALVVRLIIHDADRTREVLDSQVVPQVSGAPGFQTGYWT |
| Ga0207709_117198431 | 3300025935 | Miscanthus Rhizosphere | MHALVVRVTIHNADRTREMLTGQVVPQASGAPGFKTGYWTWPTGDGEL |
| Ga0207709_118604751 | 3300025935 | Miscanthus Rhizosphere | MHALVVRVTIHNADRTREVLNSQVVPQVSGAPGFKTGYWTWMTGGGETNGLSMV |
| Ga0207679_118266211 | 3300025945 | Corn Rhizosphere | MHALVVRLIIHDADRTREVLDGQVVPQVSGAPGFQTGYWTWSSGGGELKGSR |
| Ga0207640_113253271 | 3300025981 | Corn Rhizosphere | MHALVVRVTIHNADRTREVLDSQVVPQVSGAPGFKAGYWTWATGGGETNGLSMIIFD |
| Ga0209153_12788761 | 3300026312 | Soil | MHALVVRVTIHNADRTREVLNSQVVPQVSGAPGFKTGYWTWTTGG |
| Ga0209156_101609311 | 3300026547 | Soil | MYAVVIRVTIHNVDRTREVLNSQVVPQVSGAPGFKTGYWTWSTGGGESNGLSM |
| Ga0209474_105398492 | 3300026550 | Soil | MHALVTHVTIHNADATREALNSQVVPGISGAPGFKTGYWTWPTGSGASNGLAMLIF |
| Ga0209166_102183411 | 3300027857 | Surface Soil | MHAVVVRVTIHNADRTREMLNSQVVPQVSGAPGFK |
| Ga0268265_123145931 | 3300028380 | Switchgrass Rhizosphere | MHALVVRVTIHNADRTREVLNGQVVPGISGAPGFKTGYWTWSSGGELNGLS |
| Ga0247822_104950132 | 3300028592 | Soil | MHALVVRVTIHNADRTREVLNGQVVPGISGAPGFK |
| Ga0307311_100345843 | 3300028716 | Soil | MHALVVRVTIHNADRTREVLNSQVVPQVSGGPGFKTGYW |
| Ga0307298_100270411 | 3300028717 | Soil | MHALVVRVTIHNADRTREVLNSQVVPQVSGAPGFKT |
| Ga0307298_101830831 | 3300028717 | Soil | MHALVVRVTIHNADRTREVLNSQVVPQVSGAPGFKTGYWTWT |
| Ga0307288_100245471 | 3300028778 | Soil | MHALVVRVTIHNADRTREVLNSQVVPQVSGAPGFKTGYWTWMTGGGETNGLS |
| Ga0307282_100691933 | 3300028784 | Soil | MHALVVRVTIHNADRTRELLNSQVVPQVSGAPGFKTG |
| Ga0307287_103422321 | 3300028796 | Soil | MHALVVRVTIHNADRTREVLNSQVVPQVSGAPGFKAGYWTWATGGGETNG |
| Ga0307305_101128901 | 3300028807 | Soil | MHALVVRVTIHNADRTRELLNSQVVPQVSGAPGFKTGY |
| Ga0307305_103203531 | 3300028807 | Soil | MHALVVRVTIHNADRTREVLNSQVVPQVSGAPGFKTGYWTWTTG |
| Ga0307302_102397621 | 3300028814 | Soil | MHALVVRVTIHNADRTREMLNSQVVPQVSGAPGFKTGYWTWPTGGAAPNG |
| Ga0307296_103923212 | 3300028819 | Soil | MHALVVRVTIHNADRTREMLNSRVVPQVSGAPGFKTGYWTWPTGGAAPN |
| Ga0307312_101760724 | 3300028828 | Soil | MHALIVRVIIHNADRTREMLNSQVVPQVSGAPGFKTGYWTWSTGGGEL |
| Ga0307308_101454392 | 3300028884 | Soil | MHALVVRVTIHNADRTREVLNSQVVPQVSGAPGFKTGYWTWTTGGAET |
| Ga0318516_103058963 | 3300031543 | Soil | MHAVVVRVTIHDADRAREVLNSQVVQLASGAPGFKAGYWTWPTV |
| Ga0318574_108402542 | 3300031680 | Soil | MYALVVRVTIHNADRTREVLNNQVVPQASGAPGFKAGYWTWPTGEGELNGL |
| Ga0318502_106982122 | 3300031747 | Soil | MHALVVRVTIHNMDRTREVLNSQVVPKLSGAPGFKTGYWTWST |
| Ga0318527_101670483 | 3300031859 | Soil | MYALVVRVTIHNADRVRGRLNSEVVPQTSSAPGFKAGYWTWPTGGEELN |
| Ga0318536_106613052 | 3300031893 | Soil | MYALVVRVTIRDADRVRGRLNSEVVPQTSSAPGFKAGYWT |
| Ga0318551_105416673 | 3300031896 | Soil | MHAVVVRVTIHDADRAREVLNSQVVQLASGAPGFK |
| Ga0308175_1007674922 | 3300031938 | Soil | MHAVVIRVTINNPDRTREVLNSQVVPQVSGAPGFKTGYWTWAT |
| Ga0306922_120646013 | 3300032001 | Soil | MHAVVVRVTIHDADRAREVLNSQVVQLASGAPGFKAGYWTWPTVEGQLNALT |
| Ga0318507_104307261 | 3300032025 | Soil | MHAVVVRVTIHDADRAREVLNSQVVQLASGAPGFKAG |
| Ga0310890_102877433 | 3300032075 | Soil | MHALVVRVTIHNADRTREVLNGQVVPGISGAPGFKTGY |
| Ga0307471_1015563413 | 3300032180 | Hardwood Forest Soil | MHALIVRVTIHNADTTREVLNSQVVPQASSAPGFKTGY |
| Ga0335082_105711793 | 3300032782 | Soil | MHALVTHVTIHDADRTRELLNSQVVPAVSGAPGFQTGHWAWSTGD |
| Ga0335082_111013522 | 3300032782 | Soil | MHALVTRVTIHNADHTREMLTSQVVPQVSGAPGFKTGYWTWQTDEGELN |
| ⦗Top⦘ |