Basic Information | |
---|---|
Family ID | F083995 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 112 |
Average Sequence Length | 47 residues |
Representative Sequence | MESVVNSEVRELCKAVSQEQDSERLKRLLDELLSVLDERQLLASLL |
Number of Associated Samples | 77 |
Number of Associated Scaffolds | 112 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 77.68 % |
% of genes near scaffold ends (potentially truncated) | 23.21 % |
% of genes from short scaffolds (< 2000 bps) | 76.79 % |
Associated GOLD sequencing projects | 69 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.67 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (66.071 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (36.607 % of family members) |
Environment Ontology (ENVO) | Unclassified (41.964 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (57.143 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Mixed | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.41% β-sheet: 0.00% Coil/Unstructured: 44.59% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.67 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 112 Family Scaffolds |
---|---|---|
PF00072 | Response_reg | 11.61 |
PF01022 | HTH_5 | 2.68 |
PF13432 | TPR_16 | 1.79 |
PF01475 | FUR | 1.79 |
PF13620 | CarboxypepD_reg | 1.79 |
PF14067 | LssY_C | 1.79 |
PF00837 | T4_deiodinase | 1.79 |
PF06537 | DHOR | 1.79 |
PF13354 | Beta-lactamase2 | 0.89 |
PF14378 | PAP2_3 | 0.89 |
PF01435 | Peptidase_M48 | 0.89 |
PF04187 | Cofac_haem_bdg | 0.89 |
PF01315 | Ald_Xan_dh_C | 0.89 |
PF08327 | AHSA1 | 0.89 |
PF02954 | HTH_8 | 0.89 |
PF04616 | Glyco_hydro_43 | 0.89 |
PF02518 | HATPase_c | 0.89 |
PF14361 | RsbRD_N | 0.89 |
PF09360 | zf-CDGSH | 0.89 |
PF03928 | HbpS-like | 0.89 |
PF01584 | CheW | 0.89 |
PF02739 | 5_3_exonuc_N | 0.89 |
PF00027 | cNMP_binding | 0.89 |
PF02614 | UxaC | 0.89 |
PF02201 | SWIB | 0.89 |
PF02441 | Flavoprotein | 0.89 |
PF07681 | DoxX | 0.89 |
PF06983 | 3-dmu-9_3-mt | 0.89 |
PF17189 | Glyco_hydro_30C | 0.89 |
PF14066 | DUF4256 | 0.89 |
PF00127 | Copper-bind | 0.89 |
PF08281 | Sigma70_r4_2 | 0.89 |
PF00583 | Acetyltransf_1 | 0.89 |
PF01177 | Asp_Glu_race | 0.89 |
PF00149 | Metallophos | 0.89 |
PF00294 | PfkB | 0.89 |
COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
---|---|---|---|
COG0735 | Fe2+ or Zn2+ uptake regulation protein Fur/Zur | Inorganic ion transport and metabolism [P] | 1.79 |
COG3488 | Uncharacterized conserved protein with two CxxC motifs, DUF1111 family | General function prediction only [R] | 1.79 |
COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 0.89 |
COG1904 | Glucuronate isomerase | Carbohydrate transport and metabolism [G] | 0.89 |
COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.89 |
COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 0.89 |
COG3016 | Putative heme-binding protein PhuW | General function prediction only [R] | 0.89 |
COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 0.89 |
COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.89 |
COG5531 | DNA-binding SWIB/MDM2 domain | Chromatin structure and dynamics [B] | 0.89 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 66.07 % |
Unclassified | root | N/A | 33.93 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001593|JGI12635J15846_10106666 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2000 | Open in IMG/M |
3300002568|C688J35102_119997970 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 840 | Open in IMG/M |
3300002915|JGI25387J43893_1055238 | Not Available | 569 | Open in IMG/M |
3300004081|Ga0063454_100146917 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
3300004153|Ga0063455_100350397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 841 | Open in IMG/M |
3300005174|Ga0066680_10254590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1116 | Open in IMG/M |
3300005174|Ga0066680_10570623 | Not Available | 710 | Open in IMG/M |
3300005176|Ga0066679_10360993 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
3300005176|Ga0066679_10429898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 864 | Open in IMG/M |
3300005186|Ga0066676_10253246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1151 | Open in IMG/M |
3300005435|Ga0070714_100004504 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10503 | Open in IMG/M |
3300005435|Ga0070714_100178359 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1932 | Open in IMG/M |
3300005435|Ga0070714_100260113 | All Organisms → cellular organisms → Bacteria | 1607 | Open in IMG/M |
3300005435|Ga0070714_100310853 | All Organisms → cellular organisms → Bacteria | 1471 | Open in IMG/M |
3300005435|Ga0070714_102106441 | Not Available | 550 | Open in IMG/M |
3300005435|Ga0070714_102145733 | Not Available | 544 | Open in IMG/M |
3300005435|Ga0070714_102190189 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
3300005436|Ga0070713_101037749 | Not Available | 791 | Open in IMG/M |
3300005445|Ga0070708_100001889 | All Organisms → cellular organisms → Bacteria | 16086 | Open in IMG/M |
3300005445|Ga0070708_100575611 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1062 | Open in IMG/M |
3300005447|Ga0066689_10536340 | Not Available | 739 | Open in IMG/M |
3300005529|Ga0070741_10046934 | All Organisms → cellular organisms → Bacteria | 5360 | Open in IMG/M |
3300005529|Ga0070741_10198386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1957 | Open in IMG/M |
3300005534|Ga0070735_10000161 | All Organisms → cellular organisms → Bacteria | 79336 | Open in IMG/M |
3300005537|Ga0070730_10175760 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1439 | Open in IMG/M |
3300005553|Ga0066695_10388652 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 868 | Open in IMG/M |
3300005557|Ga0066704_11006528 | Not Available | 514 | Open in IMG/M |
3300005560|Ga0066670_10489097 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
3300005575|Ga0066702_10672499 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300005586|Ga0066691_10276998 | Not Available | 987 | Open in IMG/M |
3300005598|Ga0066706_10199432 | Not Available | 1536 | Open in IMG/M |
3300006028|Ga0070717_10012367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 6505 | Open in IMG/M |
3300006028|Ga0070717_10482858 | Not Available | 1119 | Open in IMG/M |
3300006028|Ga0070717_10614563 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
3300006796|Ga0066665_10218458 | All Organisms → cellular organisms → Bacteria | 1490 | Open in IMG/M |
3300006893|Ga0073928_10000074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 223501 | Open in IMG/M |
3300009090|Ga0099827_10291054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1380 | Open in IMG/M |
3300009093|Ga0105240_10019317 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 9107 | Open in IMG/M |
3300009093|Ga0105240_12200434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
3300009137|Ga0066709_102074419 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
3300010371|Ga0134125_10020387 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7392 | Open in IMG/M |
3300011270|Ga0137391_10489216 | Not Available | 1043 | Open in IMG/M |
3300012198|Ga0137364_11158541 | Not Available | 580 | Open in IMG/M |
3300012199|Ga0137383_10061354 | Not Available | 2700 | Open in IMG/M |
3300012199|Ga0137383_10111622 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1990 | Open in IMG/M |
3300012199|Ga0137383_10475171 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 916 | Open in IMG/M |
3300012199|Ga0137383_10524083 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 868 | Open in IMG/M |
3300012199|Ga0137383_10891136 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
3300012199|Ga0137383_10966859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
3300012200|Ga0137382_10218959 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1312 | Open in IMG/M |
3300012200|Ga0137382_11073449 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
3300012201|Ga0137365_10706731 | Not Available | 737 | Open in IMG/M |
3300012202|Ga0137363_10339186 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1241 | Open in IMG/M |
3300012202|Ga0137363_11015779 | Not Available | 704 | Open in IMG/M |
3300012202|Ga0137363_11262728 | Not Available | 626 | Open in IMG/M |
3300012203|Ga0137399_10100664 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2234 | Open in IMG/M |
3300012204|Ga0137374_10020247 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7554 | Open in IMG/M |
3300012206|Ga0137380_10108905 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2532 | Open in IMG/M |
3300012209|Ga0137379_10117671 | Not Available | 2556 | Open in IMG/M |
3300012209|Ga0137379_11352473 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
3300012210|Ga0137378_10324250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1432 | Open in IMG/M |
3300012211|Ga0137377_10445103 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1234 | Open in IMG/M |
3300012211|Ga0137377_11513900 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
3300012211|Ga0137377_11701928 | Not Available | 552 | Open in IMG/M |
3300012349|Ga0137387_11014240 | Not Available | 595 | Open in IMG/M |
3300012350|Ga0137372_10062878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3226 | Open in IMG/M |
3300012350|Ga0137372_10166056 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1791 | Open in IMG/M |
3300012356|Ga0137371_11451369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
3300012359|Ga0137385_11208837 | Not Available | 617 | Open in IMG/M |
3300012582|Ga0137358_10260693 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1179 | Open in IMG/M |
3300012917|Ga0137395_10983186 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
3300012923|Ga0137359_10005842 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10176 | Open in IMG/M |
3300012923|Ga0137359_10022775 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5331 | Open in IMG/M |
3300012923|Ga0137359_10088546 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2726 | Open in IMG/M |
3300012923|Ga0137359_10986417 | Not Available | 723 | Open in IMG/M |
3300012923|Ga0137359_11551755 | Not Available | 550 | Open in IMG/M |
3300012925|Ga0137419_10743775 | Not Available | 798 | Open in IMG/M |
3300012929|Ga0137404_11903820 | Not Available | 554 | Open in IMG/M |
3300012988|Ga0164306_11961979 | Not Available | 509 | Open in IMG/M |
3300013770|Ga0120123_1175688 | Not Available | 514 | Open in IMG/M |
3300018431|Ga0066655_10641375 | Not Available | 718 | Open in IMG/M |
3300018431|Ga0066655_11104132 | Not Available | 555 | Open in IMG/M |
3300018433|Ga0066667_10698566 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
3300018433|Ga0066667_11456640 | Not Available | 603 | Open in IMG/M |
3300018468|Ga0066662_10116989 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1935 | Open in IMG/M |
3300018468|Ga0066662_10963568 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
3300018482|Ga0066669_10420008 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1139 | Open in IMG/M |
3300019887|Ga0193729_1136940 | Not Available | 897 | Open in IMG/M |
3300019996|Ga0193693_1028633 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 986 | Open in IMG/M |
3300020579|Ga0210407_10128195 | All Organisms → cellular organisms → Bacteria | 1945 | Open in IMG/M |
3300021168|Ga0210406_10066048 | All Organisms → cellular organisms → Bacteria | 3123 | Open in IMG/M |
3300021403|Ga0210397_10719203 | Not Available | 768 | Open in IMG/M |
3300022467|Ga0224712_10629219 | Not Available | 525 | Open in IMG/M |
3300022557|Ga0212123_10000189 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 211163 | Open in IMG/M |
3300025922|Ga0207646_10136104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2212 | Open in IMG/M |
3300025928|Ga0207700_10273907 | Not Available | 1449 | Open in IMG/M |
3300025928|Ga0207700_10957185 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 766 | Open in IMG/M |
3300025929|Ga0207664_10207179 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1695 | Open in IMG/M |
3300025929|Ga0207664_10575020 | Not Available | 1011 | Open in IMG/M |
3300025929|Ga0207664_10610265 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
3300025949|Ga0207667_12016374 | Not Available | 537 | Open in IMG/M |
3300026300|Ga0209027_1005191 | All Organisms → cellular organisms → Bacteria | 4899 | Open in IMG/M |
3300026332|Ga0209803_1366357 | Not Available | 502 | Open in IMG/M |
3300026538|Ga0209056_10099360 | All Organisms → cellular organisms → Bacteria | 2380 | Open in IMG/M |
3300026551|Ga0209648_10001881 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 17152 | Open in IMG/M |
3300027846|Ga0209180_10761716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
3300027882|Ga0209590_10371185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 923 | Open in IMG/M |
3300027908|Ga0209006_11190435 | Not Available | 596 | Open in IMG/M |
3300027986|Ga0209168_10000145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 78375 | Open in IMG/M |
3300028536|Ga0137415_10072676 | All Organisms → cellular organisms → Bacteria | 3300 | Open in IMG/M |
3300030991|Ga0073994_12184225 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1016 | Open in IMG/M |
3300031962|Ga0307479_10881474 | Not Available | 868 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 36.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.39% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 9.82% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 8.93% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.04% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.46% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.57% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.68% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.68% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.79% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.79% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.79% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.89% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.89% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.89% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.89% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.89% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300002915 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
3300019996 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a2 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12635J15846_101066662 | 3300001593 | Forest Soil | MESVVNSEVRELCEAVSQEEDSERLESLLDELLSALDERQLMASLL* |
C688J35102_1199979702 | 3300002568 | Soil | MEAVINSEVRELCMALSQEQDSERLKRLLDELLTVLDERQLLASLL* |
JGI25387J43893_10552382 | 3300002915 | Grasslands Soil | MDAVLNPEVRELCKAVSQEEDSDRLKSLLDELLTILDERQLVASLL* |
Ga0063454_1001469173 | 3300004081 | Soil | MEAVINSEVRELCKAVSQEQDSERLKRLLDELLTVLDERQLL |
Ga0063455_1003503971 | 3300004153 | Soil | GRVMEAMINSDIRQLCRAVSEEQDSNQISALLDELQRVLDERQERTLLF* |
Ga0066680_102545903 | 3300005174 | Soil | MESSVNSDVRELCKAVSEEQDSERMKALLDELLRVLEERQLLAALF* |
Ga0066680_105706231 | 3300005174 | Soil | MESGLNPDVRELCKAVSEEQDSERMKALLDELLGILEERQLLAALF* |
Ga0066679_103609932 | 3300005176 | Soil | MDAVLNPEVRELCKAVSQEEDSDRLKRLLDELLTILDERQLVASLL* |
Ga0066679_104298982 | 3300005176 | Soil | MESGINSDVRELCKAVSEEVDSERIKVLLDELLRILDERQLLAALF* |
Ga0066676_102532463 | 3300005186 | Soil | KTMEAVINSEVRELCKAVSQEQDSERLKRLLDELLTVLDERQLLASLL* |
Ga0070714_1000045047 | 3300005435 | Agricultural Soil | MEGGYAGVKLMEPVVNSEVRELCKAVSQEEDSERLKSLLDELLTVLDERQLLASLL* |
Ga0070714_1001783591 | 3300005435 | Agricultural Soil | AMEPVVNSEVRELCRAVSQEQDSERLKRLLDELLTTLDERQLLASLL* |
Ga0070714_1002601131 | 3300005435 | Agricultural Soil | GGSKSMECIVNPEVRELCRAVSQEQDSERLKRLLDELLTVLDERQLLASLL* |
Ga0070714_1003108532 | 3300005435 | Agricultural Soil | MEPVVNSEVRQLCRAVSQEQDSERLKRLLDELLTVLDERQLLASLL* |
Ga0070714_1021064412 | 3300005435 | Agricultural Soil | MESVVNVNSEVRELCRAVSQEQDSERLKRLLDELLTALDERQLLASLL* |
Ga0070714_1021457331 | 3300005435 | Agricultural Soil | MEPVVNSEVRELCKAVSQERDSERLKRLLDELLTVLDERQLLASLL* |
Ga0070714_1021901892 | 3300005435 | Agricultural Soil | MPCNMEGGAGVKIMESVVHSEVNSEVRELCKAVSQEEDPEQMESLLDELLSMLDERQLMASLL* |
Ga0070713_1010377491 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | EGGYAGVKLMEPVVNSEVRELCKAVSQEEDSERLKSLLDELLTVLDERQLLASLL* |
Ga0070708_1000018898 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MESGSSEIRELCKAVSQEEDSERMKLLLDELLRVLDERELVASLL* |
Ga0070708_1005756112 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MESVVVSSDVRELCRAVSEEEDSKRMKVLLDELLRVLDEHQLLAALF* |
Ga0066689_105363402 | 3300005447 | Soil | MESSVNSDVRELCKAVSEEQDSERMKALLDELLRVLDERQLLAALF* |
Ga0070741_100469345 | 3300005529 | Surface Soil | MSDTAVNSELREICKAVSEEKDSERMAALVDELLRLLDERQLALSLL* |
Ga0070741_101983863 | 3300005529 | Surface Soil | MESVINSEVRELCRAVSQEQDAERLKRLLDELLSALDERQLVASLL* |
Ga0070735_1000016147 | 3300005534 | Surface Soil | MESVVNSEVRELCRAVSQEQDSERLKTLLDELLTVLDERQLLASLL* |
Ga0070730_101757603 | 3300005537 | Surface Soil | MDSVVNSEVRELCRAVSQEQDSERLKRLLDELLTVLDERQLLASLL* |
Ga0066695_103886522 | 3300005553 | Soil | MESGLNSDVRELCKAVSEEQDSERMKALLDELLGILEERQLLAALF* |
Ga0066704_110065282 | 3300005557 | Soil | VGVVSSDVRELCKAVSQEEDSERMKAFLNELLRVLDERQLLAALL* |
Ga0066670_104890972 | 3300005560 | Soil | MESVVNSEVRELCRAVSQEQDSERLKRLLDELLTVLDERQLLASLL* |
Ga0066702_106724992 | 3300005575 | Soil | SVVNSEVRELCRAVSLEQDSERLRRLLDELLTVLDERQLLASLL* |
Ga0066691_102769981 | 3300005586 | Soil | MESGINSDVRELCKAVSEEVDSERMKVLLDELLRILDERQLLAALF* |
Ga0066706_101994321 | 3300005598 | Soil | CKAVSEEQDSERMKALLDELLGILEERQLLAALF* |
Ga0070717_100123671 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MESGSSEIRELCKAVSQEEDSERMKVLLDELLRVLDERELVASLL* |
Ga0070717_104828582 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MEAVPVNSDVRQLCKAVSEEEDSKQMMVLLDELLRVLDERQENALLL* |
Ga0070717_106145633 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MEAMAVSSDVRQLCKAVSEEQDSKQVTLLLGELLRVLEERQETALLL* |
Ga0066665_102184582 | 3300006796 | Soil | MESVVNSDVRELCKAVSEEEDSERMNFLLDELLRVLDERQLVAALL* |
Ga0073928_1000007450 | 3300006893 | Iron-Sulfur Acid Spring | MMEPMVNSEVRELCKAVSQEEDSERLKSLLDELLTALDERQLVASLL* |
Ga0099827_102910542 | 3300009090 | Vadose Zone Soil | MESVVVSSDVRELCKAVSEEEDSKRMKVLLDELLRVLDEHQLLAALF* |
Ga0105240_1001931712 | 3300009093 | Corn Rhizosphere | MESVVNSEVRELCRAVSQEQDSERLKRLLDELLTALDERQLLASLL* |
Ga0105240_122004341 | 3300009093 | Corn Rhizosphere | MYVGAKNMEPVVNSEVRQLCRAVSQEQDSERLKRLLDELLTVLDERQLLASLL* |
Ga0066709_1020744192 | 3300009137 | Grasslands Soil | MQELGDMESVVNSEVRESCKAVSEEEDSERMKFLLDELLRVLDESELVAASL* |
Ga0134125_100203873 | 3300010371 | Terrestrial Soil | MEPVVNSEVRELCRAVSQERDSERLKRLLDELLTVLDERQLLASLL* |
Ga0137391_104892162 | 3300011270 | Vadose Zone Soil | MEGDKSRRREIMESGSSEIRELCKAVSQEEDSERMKLLLDELLRVLDERELVASLL* |
Ga0137364_111585412 | 3300012198 | Vadose Zone Soil | MESNLNSDVRELCKAVSEEQDSERMKALLDELLRVLDERQLLAALF* |
Ga0137383_100613542 | 3300012199 | Vadose Zone Soil | MESGSSEIRKLCKAVSQEEDSERMKLLLDELLRVLDERELVASLL* |
Ga0137383_101116221 | 3300012199 | Vadose Zone Soil | RSMEPVTNSDVRELCKAVSQEEDSERMKVLLDELLRVLDERQLLAALF* |
Ga0137383_104751712 | 3300012199 | Vadose Zone Soil | MEPVTNSDVRELCKAVSEEEDSERMKVLLDELLRVLDERQLLAALF* |
Ga0137383_105240832 | 3300012199 | Vadose Zone Soil | MESGLNSDVRELCKAVSEEQDSERMKVLLDELLGILEERQLLAALF* |
Ga0137383_108911362 | 3300012199 | Vadose Zone Soil | VSSDVRELCKAVSEEEDSKRMKVLLDELLRVLDEHQLLAALF* |
Ga0137383_109668592 | 3300012199 | Vadose Zone Soil | MEPVTNSDVRELCKAVSQEEDSERMKVLLDELLRVLDERQLLAALF* |
Ga0137382_102189592 | 3300012200 | Vadose Zone Soil | MESGINSDVRELCKAVSEEEDSARMKALLDELLRILEERQLLAALF* |
Ga0137382_110734492 | 3300012200 | Vadose Zone Soil | SGINSDVRELCKAVSEEEDSERMKVLLDELLRVLDERQLLAALF* |
Ga0137365_107067311 | 3300012201 | Vadose Zone Soil | MESVVVSSDLRQLCKAVSEEQDSKRLKALLDELLRVLDEHRLLAALF* |
Ga0137363_103391863 | 3300012202 | Vadose Zone Soil | MESVPATSDVRELCKAVSQEEDSEQMMVLVDELLRVLDERQQGVTLL* |
Ga0137363_110157792 | 3300012202 | Vadose Zone Soil | MEAVAVSSDVRQLCKAVSEEEDSKQMMVLLDELLRVLDERQENALLL* |
Ga0137363_112627282 | 3300012202 | Vadose Zone Soil | MEAVVSPDVRQLCKAVSEEEDSKKVTFLLDELLRILEERQESTLWL* |
Ga0137399_101006643 | 3300012203 | Vadose Zone Soil | MEAVVSPDVRQLCKAVSEEEDSKKVTFLLDELLRVLEERQESTLLL* |
Ga0137374_100202479 | 3300012204 | Vadose Zone Soil | MESVVVSSDVRELCKAVSEEEDSKRLKALLDELLRVLDEHRLLAALF* |
Ga0137380_101089053 | 3300012206 | Vadose Zone Soil | MESSLNSDVRELCKAVSEEQDSERMKALLDELLRVLDERQLLAALF* |
Ga0137379_101176715 | 3300012209 | Vadose Zone Soil | MEGDKSRRQEIMESGSSEIRELCKAVSQEEDSERMKLLLDELLRVLDERELVASLL* |
Ga0137379_113524732 | 3300012209 | Vadose Zone Soil | MESGLNSDVRELCKAVSEEQDSERMKVLLDELLRVLDERQLLAALF* |
Ga0137378_103242501 | 3300012210 | Vadose Zone Soil | NVTFFEIVQGGRSMEPVTNSDVRELCKAVSEEEDSERMKVLLDELLRVLDERQLLAALF* |
Ga0137377_104451032 | 3300012211 | Vadose Zone Soil | VESGLNSDVRELCKAVSEEQDSERMKVLLDELLGILEERQLLAALF* |
Ga0137377_115139001 | 3300012211 | Vadose Zone Soil | DVRELCKAVSEEEDSARMKALLDELLRILEERQLLAALF* |
Ga0137377_117019281 | 3300012211 | Vadose Zone Soil | GVVSSDVRELCKAVSEEENPGRMKLLLDALYDVLDERQLVASLL* |
Ga0137387_110142401 | 3300012349 | Vadose Zone Soil | MESGLNSDVRELCKAVSEEQDSERMKALLDELLGILEERQLLAA |
Ga0137372_100628784 | 3300012350 | Vadose Zone Soil | YREAEVMESVVVSSDVRELCKAVSEEEDSKRMKVLLDELLRVLDEHQLLAALF* |
Ga0137372_101660562 | 3300012350 | Vadose Zone Soil | MESGLNSDVRELCKAVSEEQDSERMKVLLDELLRLLDERQLLAALF* |
Ga0137371_114513691 | 3300012356 | Vadose Zone Soil | VMESVVVSSDVRELCKAVSEEEDSKRMKVLLDELLRVLDEHQLLAALF* |
Ga0137385_112088371 | 3300012359 | Vadose Zone Soil | MESGLNPDVRELCKAVSEEQDSERVKALLDELLGILEERQLLAALF* |
Ga0137358_102606932 | 3300012582 | Vadose Zone Soil | MESVPASSDVRELCKAVSQEEDSEQMMVLVDELIRVLDERQQGVDLL* |
Ga0137395_109831861 | 3300012917 | Vadose Zone Soil | EVMESVVVSSDVRELCKAVSEEEDSKRMKVLLDELLRVLDEHQLLAALF* |
Ga0137359_100058422 | 3300012923 | Vadose Zone Soil | MDAVPVSSDVRQLCKAVSEEEDSKQMMVLLDELLRVLDERQENALLL* |
Ga0137359_100227753 | 3300012923 | Vadose Zone Soil | MESGINSDVRELCKAVSEEQDSVRMKALLDELLRILEERQLLAALF* |
Ga0137359_100885461 | 3300012923 | Vadose Zone Soil | IMESVPASSDVRELCKAVSQEEDSEQMMVLVDELLRVLDERQQGVTFSA* |
Ga0137359_109864171 | 3300012923 | Vadose Zone Soil | MESVPASSDVRELCKAVSQEEDSEQMMVLVDELLRVLDERQQGVTFSA |
Ga0137359_115517552 | 3300012923 | Vadose Zone Soil | MESGINSDVRELCKAVSEEEDSDRMKVLLDELLRVLD |
Ga0137419_107437751 | 3300012925 | Vadose Zone Soil | MESLHTSFDVRELCKAVSEEKNPEQMMVLVDELIRVLDERQQSAAFL* |
Ga0137404_119038201 | 3300012929 | Vadose Zone Soil | MESVVVSSDVRELCKAVSEEEDSKRLKALLDELLRVLDEHQLLAALF* |
Ga0164306_119619791 | 3300012988 | Soil | ESIVNPEVRELCRAVSQEQDSERLKRLLDELLTVLDERQLLASLL* |
Ga0120123_11756881 | 3300013770 | Permafrost | MESVVSSDVRELCKAVSEEEDSERMKLLLDELLRVLDERQLVAVLL* |
Ga0066655_106413752 | 3300018431 | Grasslands Soil | MESGLNPDVRELCKAVSEEQDSERMKALLDELLRVLDERQLLAALF |
Ga0066655_111041321 | 3300018431 | Grasslands Soil | MDAVLNPEVRELCKAVSQEEDSDRLKSLLDELLSILEQRQLVASVL |
Ga0066667_106985662 | 3300018433 | Grasslands Soil | MEAVINSEVRELCKAVSQEQDSERLKRLLDELLTVLDERQLLASLL |
Ga0066667_114566401 | 3300018433 | Grasslands Soil | MESSVNSDVRELCKAVSEEQDSERMKALLDELLRVLDERQLLAALF |
Ga0066662_101169893 | 3300018468 | Grasslands Soil | MDAVLNPEVRELCKAVSQEEDSDRLKRLLDELLTILDERQLVASLL |
Ga0066662_109635682 | 3300018468 | Grasslands Soil | MESVVNSEVRELCRAVSQEQDSERLKRLLDELLTVLDERQLLASLL |
Ga0066669_104200082 | 3300018482 | Grasslands Soil | MESGLNSDVRELCKAVSEEQDSERMKVLLDELLRVLDERQLLAALF |
Ga0193729_11369401 | 3300019887 | Soil | MEAVAVSSDVRQLCKAVSEEEDSKQMMVLLDELLRVLDERQENALLL |
Ga0193693_10286332 | 3300019996 | Soil | MEAVVSPDVRQLCKAVSEEEDSKKVTFLLDELLRVLEERQESTLLL |
Ga0210407_101281952 | 3300020579 | Soil | MEGGYAGVKLMEAVVNSEVRELCKAVSQEEDSERLKSLLDELLTVLEERQLVASLL |
Ga0210406_100660482 | 3300021168 | Soil | MEGGYAGVKLMEPVVNSEVRELCKAVSQEEDSERLKSLLDELLTVLEERQLVASLL |
Ga0210397_107192031 | 3300021403 | Soil | MEPVVNSEVRELCRAVSQERDSERLKRLLDELLTVLDERQLLASLL |
Ga0224712_106292191 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | NTMEPVVNSEVRELCKAVSQERDSERLKRLLDELLTVLDERQLLASLL |
Ga0212123_1000018949 | 3300022557 | Iron-Sulfur Acid Spring | MMEPMVNSEVRELCKAVSQEEDSERLKSLLDELLTALDERQLVASLL |
Ga0207646_101361044 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MESGSSEIRELCKAVSQEEDSERMKLLLDELLRVLDERELVASLL |
Ga0207700_102739072 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MEGGYAGVKLMEPVVNSEVRELCKAVSQEEDSERLKSLLDELLTVLDERQLLASLL |
Ga0207700_109571851 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MESVVNVNSEVRELCRAVSQEQDSERLKRLLDELLTALDERQLLASLL |
Ga0207664_102071792 | 3300025929 | Agricultural Soil | PVVNSEVRELCKAVSQEEDSERLKSLLDELLTVLDERQLLASLL |
Ga0207664_105750201 | 3300025929 | Agricultural Soil | MECIVNPEVRELCRAVSQEQDSERLKRLLDELLTVLDERQLLASLL |
Ga0207664_106102653 | 3300025929 | Agricultural Soil | VNSEVRELCKAVSQERDSERLKRLLDELLTVLDERQLLASLL |
Ga0207667_120163741 | 3300025949 | Corn Rhizosphere | MEPVVNSEVRELCKAVSQERDSERLKRLLDELLTVLDERQLLASLL |
Ga0209027_10051913 | 3300026300 | Grasslands Soil | MDAVLNPEVRELCKAVSQEEDSDRLKSLLDELLTILDERQLVASLL |
Ga0209803_13663571 | 3300026332 | Soil | MESSVNSAVRELCKAVSEEQDSERMKALLDELLRVLDERQLLAALF |
Ga0209056_100993604 | 3300026538 | Soil | MESVVNSDVRELCKAVSEEEDSERMNFLLDELLRVLDERQLVAALL |
Ga0209648_100018819 | 3300026551 | Grasslands Soil | MESGSSEIRELCKAVSQEEDSERMKVLLDELLRVLDERELVASLL |
Ga0209180_107617162 | 3300027846 | Vadose Zone Soil | DVRELCKAVSEEEDSKRMKVLLDELLRVLDEHQLLAALF |
Ga0209590_103711851 | 3300027882 | Vadose Zone Soil | MESVVVSSDVRELCKAVSEEEDSKRMKVLLDELLRVLDEHQLLAALF |
Ga0209006_111904352 | 3300027908 | Forest Soil | MESVVNSEVRELCKAVSQEQDSERLKRLLDELLSVLDERQLLASLL |
Ga0209168_1000014538 | 3300027986 | Surface Soil | MESVVNSEVRELCRAVSQEQDSERLKTLLDELLTVLDERQLLASLL |
Ga0137415_100726764 | 3300028536 | Vadose Zone Soil | MESVPASSDVRELCKAVSQEEDSEQMMVLVDELLRVLDERQQGVTLL |
Ga0073994_121842252 | 3300030991 | Soil | MEAVAVSSDVRQLCKAVSEEEDSKQIMVLLDELLRVLDERQENALLL |
Ga0307479_108814742 | 3300031962 | Hardwood Forest Soil | MESGVVSSEIRELCKAVSQEEDSERMKLLLDQLLRVLDERELVASLF |
⦗Top⦘ |