| Basic Information | |
|---|---|
| Family ID | F083985 |
| Family Type | Metagenome |
| Number of Sequences | 112 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MSVAQPRSPGKPGVISELALARAQRNTVVIVDDLFSSRLLLAEI |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 77.68 % |
| % of genes near scaffold ends (potentially truncated) | 99.11 % |
| % of genes from short scaffolds (< 2000 bps) | 91.07 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.28 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (74.107 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (12.500 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.536 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.643 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.44% β-sheet: 0.00% Coil/Unstructured: 55.56% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF13411 | MerR_1 | 33.93 |
| PF00216 | Bac_DNA_binding | 12.50 |
| PF03147 | FDX-ACB | 4.46 |
| PF00072 | Response_reg | 0.89 |
| PF03484 | B5 | 0.89 |
| PF00707 | IF3_C | 0.89 |
| PF07859 | Abhydrolase_3 | 0.89 |
| PF05198 | IF3_N | 0.89 |
| PF07786 | HGSNAT_cat | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 12.50 |
| COG0072 | Phenylalanyl-tRNA synthetase beta subunit | Translation, ribosomal structure and biogenesis [J] | 5.36 |
| COG0290 | Translation initiation factor IF-3 | Translation, ribosomal structure and biogenesis [J] | 1.79 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.89 |
| COG3503 | Uncharacterized membrane protein, DUF1624 family | Function unknown [S] | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 74.11 % |
| Unclassified | root | N/A | 25.89 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10808184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 537 | Open in IMG/M |
| 3300005171|Ga0066677_10145187 | All Organisms → cellular organisms → Bacteria | 1295 | Open in IMG/M |
| 3300005177|Ga0066690_10305678 | Not Available | 1075 | Open in IMG/M |
| 3300005179|Ga0066684_10799066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 624 | Open in IMG/M |
| 3300005180|Ga0066685_10266658 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
| 3300005186|Ga0066676_11052201 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 539 | Open in IMG/M |
| 3300005332|Ga0066388_101269043 | All Organisms → cellular organisms → Bacteria | 1266 | Open in IMG/M |
| 3300005343|Ga0070687_100171881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1290 | Open in IMG/M |
| 3300005345|Ga0070692_10184496 | All Organisms → cellular organisms → Bacteria | 1211 | Open in IMG/M |
| 3300005353|Ga0070669_100266078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1369 | Open in IMG/M |
| 3300005355|Ga0070671_100292449 | All Organisms → cellular organisms → Bacteria | 1386 | Open in IMG/M |
| 3300005355|Ga0070671_101994097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 517 | Open in IMG/M |
| 3300005445|Ga0070708_101257964 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 692 | Open in IMG/M |
| 3300005459|Ga0068867_101290797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → Candidatus Contendobacter → Candidatus Contendobacter odensis → Candidatus Contendobacter odensis Run_B_J11 | 673 | Open in IMG/M |
| 3300005471|Ga0070698_101156900 | Not Available | 723 | Open in IMG/M |
| 3300005471|Ga0070698_101405746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → Candidatus Contendobacter → Candidatus Contendobacter odensis → Candidatus Contendobacter odensis Run_B_J11 | 649 | Open in IMG/M |
| 3300005545|Ga0070695_100950225 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300005548|Ga0070665_100175952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2141 | Open in IMG/M |
| 3300005549|Ga0070704_100176002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1707 | Open in IMG/M |
| 3300005553|Ga0066695_10182332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1313 | Open in IMG/M |
| 3300005557|Ga0066704_11048052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Magnetococcales → unclassified Magnetococcales → Magnetococcales bacterium | 503 | Open in IMG/M |
| 3300005561|Ga0066699_10687391 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 730 | Open in IMG/M |
| 3300005561|Ga0066699_11083505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 553 | Open in IMG/M |
| 3300005564|Ga0070664_102158603 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
| 3300005566|Ga0066693_10371986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → Candidatus Contendobacter → Candidatus Contendobacter odensis → Candidatus Contendobacter odensis Run_B_J11 | 578 | Open in IMG/M |
| 3300005574|Ga0066694_10147509 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
| 3300005576|Ga0066708_10069832 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2019 | Open in IMG/M |
| 3300005615|Ga0070702_100151849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1488 | Open in IMG/M |
| 3300005764|Ga0066903_101457647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1289 | Open in IMG/M |
| 3300005764|Ga0066903_101545599 | Not Available | 1255 | Open in IMG/M |
| 3300005764|Ga0066903_101751956 | All Organisms → cellular organisms → Bacteria | 1185 | Open in IMG/M |
| 3300005764|Ga0066903_104815843 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 717 | Open in IMG/M |
| 3300005836|Ga0074470_10733243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales | 6342 | Open in IMG/M |
| 3300006796|Ga0066665_11169342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 586 | Open in IMG/M |
| 3300006796|Ga0066665_11256932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → Candidatus Contendobacter → Candidatus Contendobacter odensis → Candidatus Contendobacter odensis Run_B_J11 | 567 | Open in IMG/M |
| 3300006806|Ga0079220_11393041 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 594 | Open in IMG/M |
| 3300009137|Ga0066709_102653166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 669 | Open in IMG/M |
| 3300009143|Ga0099792_11212778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa → unclassified Thiocapsa → Thiocapsa sp. KS1 | 512 | Open in IMG/M |
| 3300009147|Ga0114129_10573221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1465 | Open in IMG/M |
| 3300009148|Ga0105243_11060839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 816 | Open in IMG/M |
| 3300009156|Ga0111538_14075314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300010304|Ga0134088_10377086 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 690 | Open in IMG/M |
| 3300010323|Ga0134086_10128879 | Not Available | 912 | Open in IMG/M |
| 3300010343|Ga0074044_10921059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 572 | Open in IMG/M |
| 3300010359|Ga0126376_10393142 | All Organisms → cellular organisms → Bacteria | 1246 | Open in IMG/M |
| 3300010376|Ga0126381_101713262 | Not Available | 908 | Open in IMG/M |
| 3300010379|Ga0136449_100992547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1353 | Open in IMG/M |
| 3300010397|Ga0134124_11400078 | Not Available | 725 | Open in IMG/M |
| 3300012096|Ga0137389_10601473 | Not Available | 945 | Open in IMG/M |
| 3300012351|Ga0137386_10326539 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1104 | Open in IMG/M |
| 3300012354|Ga0137366_10216146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1428 | Open in IMG/M |
| 3300012355|Ga0137369_10007129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 11261 | Open in IMG/M |
| 3300012358|Ga0137368_10024979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosospira → Nitrosospira multiformis | 5544 | Open in IMG/M |
| 3300012363|Ga0137390_11273864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 681 | Open in IMG/M |
| 3300012927|Ga0137416_10730604 | Not Available | 871 | Open in IMG/M |
| 3300012931|Ga0153915_12750491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 575 | Open in IMG/M |
| 3300014166|Ga0134079_10142465 | Not Available | 959 | Open in IMG/M |
| 3300014325|Ga0163163_11487027 | Not Available | 739 | Open in IMG/M |
| 3300014745|Ga0157377_10020904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3435 | Open in IMG/M |
| 3300014969|Ga0157376_12763481 | Not Available | 531 | Open in IMG/M |
| 3300017961|Ga0187778_10213334 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
| 3300017975|Ga0187782_10698633 | Not Available | 782 | Open in IMG/M |
| 3300018058|Ga0187766_10264205 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
| 3300018064|Ga0187773_10098103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1440 | Open in IMG/M |
| 3300018064|Ga0187773_11147495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 519 | Open in IMG/M |
| 3300018075|Ga0184632_10231658 | Not Available | 810 | Open in IMG/M |
| 3300018085|Ga0187772_10316531 | Not Available | 1072 | Open in IMG/M |
| 3300018433|Ga0066667_10521955 | Not Available | 981 | Open in IMG/M |
| 3300018468|Ga0066662_12952397 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 505 | Open in IMG/M |
| 3300019881|Ga0193707_1110301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 812 | Open in IMG/M |
| 3300021344|Ga0193719_10456514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → Candidatus Contendobacter → Candidatus Contendobacter odensis → Candidatus Contendobacter odensis Run_B_J11 | 519 | Open in IMG/M |
| 3300021432|Ga0210384_11279190 | Not Available | 638 | Open in IMG/M |
| 3300026550|Ga0209474_10161735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1451 | Open in IMG/M |
| 3300027587|Ga0209220_1116099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 699 | Open in IMG/M |
| 3300027660|Ga0209736_1197237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → Candidatus Contendobacter → Candidatus Contendobacter odensis → Candidatus Contendobacter odensis Run_B_J11 | 523 | Open in IMG/M |
| 3300027715|Ga0208665_10236036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 575 | Open in IMG/M |
| 3300027727|Ga0209328_10250369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → Candidatus Contendobacter → Candidatus Contendobacter odensis → Candidatus Contendobacter odensis Run_B_J11 | 529 | Open in IMG/M |
| 3300027829|Ga0209773_10367390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 599 | Open in IMG/M |
| 3300027885|Ga0209450_10252935 | Not Available | 1261 | Open in IMG/M |
| 3300027979|Ga0209705_10004501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 7474 | Open in IMG/M |
| 3300028380|Ga0268265_12592297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 513 | Open in IMG/M |
| 3300028743|Ga0302262_10103045 | Not Available | 979 | Open in IMG/M |
| 3300029989|Ga0311365_10192413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1756 | Open in IMG/M |
| 3300029989|Ga0311365_11119520 | Not Available | 679 | Open in IMG/M |
| 3300031057|Ga0170834_107748889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 625 | Open in IMG/M |
| 3300031232|Ga0302323_101312095 | Not Available | 811 | Open in IMG/M |
| 3300031668|Ga0318542_10079292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1553 | Open in IMG/M |
| 3300031720|Ga0307469_10390487 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
| 3300031740|Ga0307468_100022080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2837 | Open in IMG/M |
| 3300031779|Ga0318566_10084511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1546 | Open in IMG/M |
| 3300031820|Ga0307473_10149033 | All Organisms → cellular organisms → Bacteria | 1327 | Open in IMG/M |
| 3300031835|Ga0318517_10075737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1450 | Open in IMG/M |
| 3300031846|Ga0318512_10445765 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300031918|Ga0311367_11886725 | Not Available | 579 | Open in IMG/M |
| 3300031954|Ga0306926_12081431 | Not Available | 636 | Open in IMG/M |
| 3300032018|Ga0315272_10699380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 516 | Open in IMG/M |
| 3300032059|Ga0318533_10884357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 655 | Open in IMG/M |
| 3300032074|Ga0308173_11949258 | Not Available | 554 | Open in IMG/M |
| 3300032076|Ga0306924_12281618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 549 | Open in IMG/M |
| 3300032174|Ga0307470_10047342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2177 | Open in IMG/M |
| 3300032174|Ga0307470_10449531 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 926 | Open in IMG/M |
| 3300032177|Ga0315276_11262606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa → unclassified Thiocapsa → Thiocapsa sp. KS1 | 776 | Open in IMG/M |
| 3300032180|Ga0307471_101260691 | Not Available | 902 | Open in IMG/M |
| 3300032205|Ga0307472_100964524 | Not Available | 795 | Open in IMG/M |
| 3300032256|Ga0315271_10078494 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2461 | Open in IMG/M |
| 3300032256|Ga0315271_11633635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 554 | Open in IMG/M |
| 3300032256|Ga0315271_11724942 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 538 | Open in IMG/M |
| 3300032275|Ga0315270_11049347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → Candidatus Contendobacter → Candidatus Contendobacter odensis → Candidatus Contendobacter odensis Run_B_J11 | 541 | Open in IMG/M |
| 3300032770|Ga0335085_11217382 | Not Available | 799 | Open in IMG/M |
| 3300033414|Ga0316619_11229219 | Not Available | 662 | Open in IMG/M |
| 3300034169|Ga0370480_0141212 | Not Available | 825 | Open in IMG/M |
| 3300034176|Ga0364931_0166788 | Not Available | 713 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.50% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.14% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.25% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.25% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 5.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.36% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.36% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.46% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 4.46% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.57% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.57% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.79% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.79% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.79% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.79% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.89% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.89% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.89% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.89% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.89% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.89% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.89% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.89% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.89% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.89% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.89% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.89% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027715 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
| 3300027979 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028743 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_4 | Environmental | Open in IMG/M |
| 3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032018 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middle | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
| 3300034169 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_15 | Environmental | Open in IMG/M |
| 3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_108081841 | 3300001593 | Forest Soil | MRAAHPRNPGKSAVVSELAHARAQRNTVLIIDDLFSSRLLLAEIVRQIDGKLNLELF |
| Ga0066677_101451871 | 3300005171 | Soil | MRAVHPRNIGKSAVVSELAQARAQRNTVLIIDDLFSSRLLLAEIVRQIDGKLNLE |
| Ga0066690_103056784 | 3300005177 | Soil | MRAVHPRNIGKSAVVSELAQARAQRNTVLIIDDLFSSRLLLAEIVRQIDGK |
| Ga0066684_107990661 | 3300005179 | Soil | MSLAQRTSGKGIISELALARAQRNTVVIVDDLFSSRLLLAEIVRQIDGRL |
| Ga0066685_102666584 | 3300005180 | Soil | MSLAQSRTPGKSGGVGVISELALARAQRNTVLIIDDLFSSRLLIAEIVRQIDGKLNLE |
| Ga0066676_110522011 | 3300005186 | Soil | MAAAQPRFSPHTVGVGSVSELALARAQRNTVLIIDDLFSSRLLLAEIVRQID |
| Ga0066388_1012690431 | 3300005332 | Tropical Forest Soil | MSVAHHRHTEKTGVVAELALARAQRNTVVIIDDLFSSRLLLAEIVRQIDGKLNL |
| Ga0070687_1001718815 | 3300005343 | Switchgrass Rhizosphere | MTSAQQRPNHKSPVVSELAMARAQRNTVMIIDDLFSSRLLLAEIVRQIDG |
| Ga0070692_101844961 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSAQQRPNHKSPVVSELAMARAQRNTVMIIDDLFSSRLLLAEIVRQIDGKLNLELF |
| Ga0070669_1002660785 | 3300005353 | Switchgrass Rhizosphere | MTSAQQRPNHKSPVVSELAMARAQRNTVMIIDDLFSSRLLLAEIVRQIDGKLNL |
| Ga0070671_1002924491 | 3300005355 | Switchgrass Rhizosphere | MSALPSRPTQGTGVISELALARAQRNTVLIVDDLFSSRLLIAEIVRQ |
| Ga0070671_1019940971 | 3300005355 | Switchgrass Rhizosphere | MSALQSRPAPNTGVISELALARAQRNTVLIIDDLFSSRLLLAEIVRQIDP |
| Ga0070708_1012579643 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VSAAQTRNPGKSAVVSELALARAQRNTVMIIDDLFSSRLLLAEIVRQIDGKLNL |
| Ga0068867_1012907973 | 3300005459 | Miscanthus Rhizosphere | MSALPFRSKPSTGVISELALARAQRNTVLIIDDLFSSRLLIAEIV |
| Ga0070698_1011569003 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLAQRTGKSGVIAELALARAQRNTVVIVDDLFSSRLLLAEIVRQIDGKL |
| Ga0070698_1014057462 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MNAAQARPTGVISELALARAQRNTVLIIDDLFSSRLLLAE |
| Ga0070695_1009502252 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLAKRSTGKGIISELALARAQRNTVVIIDDLFSSRLLLAEIVRQIDGKLNL |
| Ga0070665_1001759525 | 3300005548 | Switchgrass Rhizosphere | MSALQSRPAPNTGVISELALARAQRNTVLIIDDLFSSRLLLAEIV |
| Ga0070704_1001760025 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MSPLQSRSAPGTGVISELALARAQRNTVLIVDDLFSSRLLI |
| Ga0066695_101823321 | 3300005553 | Soil | MSVAQRSSGKGIISELALARAQRNTVVIVDDLFSSRLLLAEIVRQIDGKLN |
| Ga0066704_110480521 | 3300005557 | Soil | MSLAQRTGKSGVIAELALARAQRNTVVIVDDLFSS |
| Ga0066699_106873911 | 3300005561 | Soil | MRAANPRNIGKSAVVSELAQARAQRNTVLIIDDLFSSRLLLAEIVRQIDGKLNLELFD |
| Ga0066699_110835051 | 3300005561 | Soil | MSLAQRTGKSGVIAELALARAQRNTVVIVDDLFSSRLLLAEIVRQIDGKLNLE |
| Ga0070664_1021586031 | 3300005564 | Corn Rhizosphere | MTSAQQHKSPVVSELAMARAQRNTVMIIDDLFSSRLLLA |
| Ga0066693_103719861 | 3300005566 | Soil | MSAAQSRSPAKSTVVSELAMARAQRNTVLIIDDLFSS |
| Ga0066694_101475094 | 3300005574 | Soil | MRAVHPRNIGKSAVVSELAQARAQRNTVLIIDDLFSSRLLLAEIVR |
| Ga0066708_100698325 | 3300005576 | Soil | MSLAQRTGKSGVIAELALARAQRNTVVIVDDLFSSRLLLAEIVRQIDGKLNLEL |
| Ga0070702_1001518496 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MSPLQSRSAPGTGVISELALARAQRNTVLIVDDLFSSRLLIAEIVRQIDPK |
| Ga0066903_1014576475 | 3300005764 | Tropical Forest Soil | MSAPQTRAAPKNAVISELALARAQRNTVLIIDDLFSSRLLLAEIVRQID |
| Ga0066903_1015455991 | 3300005764 | Tropical Forest Soil | MIAAQQPRPSGVISELALARAQRNTVLIIDDLFSSR |
| Ga0066903_1017519561 | 3300005764 | Tropical Forest Soil | MSVAHHRHTEKTGVVAELALARAQRNTVVIIDDLFSSRLLLAEIVRQIDGKLNLELFD |
| Ga0066903_1048158433 | 3300005764 | Tropical Forest Soil | MSAVPFRSKPSTGVISELALARAQRNTVLIVDDLFSSRLLIAEIVR |
| Ga0074470_1073324310 | 3300005836 | Sediment (Intertidal) | MSALQSRPKPGMGVISELALARAQRNTVLIIDDLFSSRLLIAEIV |
| Ga0066665_111693421 | 3300006796 | Soil | MSLAQRTSGKGIISELALARAQRNTVVIVDDLFSSRLLLAEIV |
| Ga0066665_112569321 | 3300006796 | Soil | MNAVHAPRPMGVISELALARAQRNTVLIIDDLFSSRLLLAEIVRQ |
| Ga0079220_113930413 | 3300006806 | Agricultural Soil | MTSAHQRSSGKNPVVSELAMARAQRNTVMVIDDLFSSRLLL |
| Ga0066709_1026531661 | 3300009137 | Grasslands Soil | MSVPQPRNPGKAGGVISELALARAQRNTVVIVDDLFSSRLLLAEIVRQIDGKLNLE |
| Ga0099792_112127781 | 3300009143 | Vadose Zone Soil | MSAAQSRSPGKTAVVSELALARAQRNTVLIVDDLFSSRL |
| Ga0114129_105732215 | 3300009147 | Populus Rhizosphere | MSLAQRSSGKGIISELALARAQRNTVVIVDDLFSSRLLLAEIVRQ |
| Ga0105243_110608393 | 3300009148 | Miscanthus Rhizosphere | MSPLQSRSAPGTGVISELALARAQRNTVLIVDDLFSSRLLIAEIVRQIDP |
| Ga0111538_140753141 | 3300009156 | Populus Rhizosphere | MSPAQPRPASASGVVSELAFARAQRNTVMIVDDLFSSRLLLAEIV |
| Ga0134088_103770862 | 3300010304 | Grasslands Soil | MSLAQSRTPGKSGGVGVISDLALARAQRNAVLIIDDLFSSRLLIAEIVRQIDGKLNLE |
| Ga0134086_101288791 | 3300010323 | Grasslands Soil | VDLRRKFFAMSVAQRSSGKGIISELALARAQRNTVVIVDDLFSSRL |
| Ga0074044_109210593 | 3300010343 | Bog Forest Soil | MSLAQSRNAGKPGVISELALARAQRNTVVIVDDLFS |
| Ga0126376_103931421 | 3300010359 | Tropical Forest Soil | MSAPQTRAAPKNAVISELALARAQRNTVLIIDDLFSSRLLLAEIVRQIDGK |
| Ga0126381_1017132623 | 3300010376 | Tropical Forest Soil | MNTAQQRAPGKPGVISELALARAQRNTVVIIDDLFSSRLLLAE |
| Ga0136449_1009925471 | 3300010379 | Peatlands Soil | MSLASSRTPGKSGVISELALARAQRNTVVIVDDLFSSRL |
| Ga0134124_114000781 | 3300010397 | Terrestrial Soil | MSALPSRPAQATGVISELALARAQRNTVLIVDDLFSSRLL |
| Ga0137389_106014734 | 3300012096 | Vadose Zone Soil | MRAAHPRNPGKSAVVSELAHARAQRNTVMIIDDLFSSRLLLAEI |
| Ga0137386_103265394 | 3300012351 | Vadose Zone Soil | MSLAQRTGKSGVIAELALARAQRNTVVIIDDLFSSRLLLAEIVRQID |
| Ga0137366_102161461 | 3300012354 | Vadose Zone Soil | MSLPQRAGKSGVIAELALARAQRNTVVIVDDLFSSRLLLAEIVR |
| Ga0137369_1000712915 | 3300012355 | Vadose Zone Soil | MSAQPRPVANSGTVSEIALARAQRNTVLIIDDLFSSRLLLAEIVRQIDGKL |
| Ga0137368_100249791 | 3300012358 | Vadose Zone Soil | MSLAQRSSGKGVISELALARAQRNTVVIVDDLFSSRLLLA |
| Ga0137390_112738641 | 3300012363 | Vadose Zone Soil | MSLAQRTGKSGVIAELALARAQRNTVVIVDDLFSSRLLLAE |
| Ga0137416_107306041 | 3300012927 | Vadose Zone Soil | MRAANPRNIGKSAVVSELAQARAQRNTVLIIDDLFSSRLLL |
| Ga0153915_127504914 | 3300012931 | Freshwater Wetlands | MNVAHRNPGRAGVISELALARAQRNTVVIIDDLFSSRLLLAEIVRQ |
| Ga0134079_101424651 | 3300014166 | Grasslands Soil | MSLAQRTSGKGIISELALARAQRNTVVIVDDLFSSRLLLAEIVRQIDGRLNLE |
| Ga0163163_114870271 | 3300014325 | Switchgrass Rhizosphere | MSALPFRSKPSTGVISELALARAQRNTVLIIDDLFS |
| Ga0157377_100209045 | 3300014745 | Miscanthus Rhizosphere | MTSAQQRPIHKSPVVSELAMARAQRNTVMIIDDLFSSRLLLA |
| Ga0157376_127634811 | 3300014969 | Miscanthus Rhizosphere | MANAQLRSASGGGNVISELALARAQRNTVLIVDDLFSSRL |
| Ga0187778_102133341 | 3300017961 | Tropical Peatland | MSTAQQRAPGKPGVISELALARAQRNTVVIIDDLFSSRLLL |
| Ga0187782_106986331 | 3300017975 | Tropical Peatland | MNLAQSRSFGSPGVISELALARAQRNTVVIIDDLFSSRLL |
| Ga0187766_102642054 | 3300018058 | Tropical Peatland | MSTAQQRTPGKPGVISELALARAQRNTVVIIDDLF |
| Ga0187773_100981031 | 3300018064 | Tropical Peatland | MSVAHHRHAEKTGVVAELALARAQRNTVVIIDDLFS |
| Ga0187773_111474951 | 3300018064 | Tropical Peatland | MILAHRSPAKAGVAELALARAQRNTVVIVDDLFSSRLLLAEIVRQIDGKLNLEL |
| Ga0184632_102316583 | 3300018075 | Groundwater Sediment | VSAAQTRNPGKSAVVSELALARAQRNTVMIIDDLFSSRLLLAEIVRQID |
| Ga0187772_103165314 | 3300018085 | Tropical Peatland | MNLAQSRSFGSPGVISELALARAQRNTVVIIDDLFSSRLLLAEIVRQIDGKLNLELF |
| Ga0066667_105219554 | 3300018433 | Grasslands Soil | MRAANPRNIGKSAVVSELAQARPHRNAVLSIDDLLS |
| Ga0066662_129523973 | 3300018468 | Grasslands Soil | MRAANPRNIGKSAVVSELAQARAQRNTVLIIDDLFSSRLLLAEIV |
| Ga0193707_11103012 | 3300019881 | Soil | MRAAHPRNPGKSAVVSELAHARAQRNTVLIIDDLFSKLSARSTAN |
| Ga0193719_104565141 | 3300021344 | Soil | VSAAQTRNPGKSAVVSELALARAQRNTVMIIDDLFSS |
| Ga0210384_112791903 | 3300021432 | Soil | MRAAHPRNPGKSAVVSELAHARAQRNTVLIIDDLFSSRLLLAEIVRQ |
| Ga0209474_101617355 | 3300026550 | Soil | MRAVHPRNIGKSAVVSELAQARAQRNTVLIIDDLFSSRLLLAEIVRQI |
| Ga0209220_11160993 | 3300027587 | Forest Soil | MSLAQRSSGKSGIISELALARAQRNTVVIIDDLFSSRLLLAEIVRQIDGKLN |
| Ga0209736_11972373 | 3300027660 | Forest Soil | MRAAHPRNPGKSAVVSELAHARAQRNTVLIIDDLFSSRLL |
| Ga0208665_102360361 | 3300027715 | Deep Subsurface | MIAAQPRPTGVISELALARAQRNTVLIIDDLFSSRLLLAEIVRQIDGKLNL |
| Ga0209328_102503692 | 3300027727 | Forest Soil | MRAAHPRNPGKSAVVSELAQARAQRNTVLIIDDLFSSRLLLAEIVRQI |
| Ga0209773_103673901 | 3300027829 | Bog Forest Soil | MSLAQSRNPGKPGVISELALARAQRNTVVIVDDLFSSRLLLAE |
| Ga0209450_102529351 | 3300027885 | Freshwater Lake Sediment | MTPPTPLRTAPSPGTVSELAFARAQRNTVLIVDDLFSSRLLLAEIVRQIDG |
| Ga0209705_100045011 | 3300027979 | Freshwater Sediment | MSPARPRATPTPAIISEIAFVRAQRNTVIIVDDLFSSRLLLAEIVRQ |
| Ga0268265_125922971 | 3300028380 | Switchgrass Rhizosphere | MSAAQPRPAAASGVVSELAFARAQRNTVLIVDDLFSSRLLLAEIVRQI |
| Ga0302262_101030454 | 3300028743 | Fen | MSAAQAKPTGKNAVISELALARAQRNTVLIIDDLFSSRLLLA |
| Ga0311365_101924135 | 3300029989 | Fen | MSAAQAPRPTGVISELALARAQRNTVLIIDDLFSSRLLLAEI |
| Ga0311365_111195201 | 3300029989 | Fen | MSVLQPRQATSTGVISELALARAPRNTILIIDDLFSSRLLIAEIV |
| Ga0170834_1077488893 | 3300031057 | Forest Soil | MSVASARAPGKPGDVSELAHARAQRNTVLIVDDLFSSRLLLAEIVRQIDGKLNLELF |
| Ga0302323_1013120951 | 3300031232 | Fen | MSAAQAKPTGKNAVISELALARAQRNTVLIIDDLFSSRLLLAEI |
| Ga0318542_100792921 | 3300031668 | Soil | MSTAQQRAPGKPGVISELALARAQRNTVVIVDDLFSSRLLL |
| Ga0307469_103904871 | 3300031720 | Hardwood Forest Soil | MARSPGEFHMSAVPFRSKPNTGVISELALARAQRNTVLIVDDLFSSRLLIA |
| Ga0307468_1000220801 | 3300031740 | Hardwood Forest Soil | MSVAQPRSPGKPGVISELALARAQRNTVVIVDDLFSSRLLLAEIVRQIDGKLNLE |
| Ga0318566_100845111 | 3300031779 | Soil | MSTAQQRAPGKPGVISELALARAQRNTVVIVDDLFSSRLLLAEIVRQI |
| Ga0307473_101490331 | 3300031820 | Hardwood Forest Soil | MSTAQQRTPAKPGVISELALARAQRNTVVIIDDLFSSRLLLA |
| Ga0318517_100757375 | 3300031835 | Soil | MSTAQQRAPGKPGVISELALARAQRNTVVIVDDLFSSRLLLAEIVRQIDGKLNLE |
| Ga0318512_104457653 | 3300031846 | Soil | MSTAQQRAPGKPGVISELALARAQRNTVVIVDDLFSSR |
| Ga0311367_118867252 | 3300031918 | Fen | MAVAQPRSAGGGSSVISELALARAQKNTVVIVDDLF |
| Ga0306926_120814311 | 3300031954 | Soil | MSASQTRGATKNAVISELALARAQRNTVLIIDDLFSSRL |
| Ga0315272_106993801 | 3300032018 | Sediment | MAVVQPRSTSGGGSAVSELALARAQRNTVVIVDDLFSSRLL |
| Ga0318533_108843573 | 3300032059 | Soil | MNTAQQRAPGKPGVISELALARAQRNTVVIIDDLFSSRLLLAEIVRQID |
| Ga0308173_119492582 | 3300032074 | Soil | MTAVHLRSENQNNGTISELALARAQRNTVLIVDDLFS |
| Ga0306924_122816181 | 3300032076 | Soil | MSTAQQKAPGKPGVISELALARAQRNTVVIIDDLFSSRLLLAE |
| Ga0307470_100473421 | 3300032174 | Hardwood Forest Soil | MSTAQQRTPAKPGVISELALARAQRNTVVIIDDLFSSRLLLAEIVRQI |
| Ga0307470_104495311 | 3300032174 | Hardwood Forest Soil | MSAPQPRTLGKNSVISELAMARAQRNTVLIIDDLFSSRLLLAEIV |
| Ga0315276_112626063 | 3300032177 | Sediment | MSALSSRSSPNSGVISELALARAQRNTVLIIDDLF |
| Ga0307471_1012606911 | 3300032180 | Hardwood Forest Soil | MSVAQPRSPGKPGVISELALASAQRNTVVIVDDQFSRRLLLAEIVRQIDG |
| Ga0307472_1009645241 | 3300032205 | Hardwood Forest Soil | MSVAQTRSPAKPGVISELALARAQRNTVVIVDDLFSSRLLLAEIVRQIDGKLNL |
| Ga0315271_100784943 | 3300032256 | Sediment | MAVAQPRSASGGGNVISELALARAQRNTVVIVDDLFSSR |
| Ga0315271_116336353 | 3300032256 | Sediment | MSALPSRSAPNSGVISELALARAQRNTVLIIDDLFSSR |
| Ga0315271_117249421 | 3300032256 | Sediment | MSALPSRSAPSTGVISELALARAQRNTILIIDDLFISRLLIAEIVRQIDPKL |
| Ga0315270_110493471 | 3300032275 | Sediment | MSALPSRSAPSTGVISELALARAQRNTILIIDDLFSSRLLIAEIV |
| Ga0335085_112173821 | 3300032770 | Soil | MSTAQQRAPGKPGVISELALARAQRNTVVIIDDLFSSRLLLA |
| Ga0316619_112292191 | 3300033414 | Soil | MAGAQPRSAGGASGVISELALARAQRNTVLIIDDLFS |
| Ga0370480_0141212_3_152 | 3300034169 | Untreated Peat Soil | MSAAQARASGSNGVISDLALVRAQRNTILIIDDLFSSRLLLAEIVRQIDS |
| Ga0364931_0166788_1_132 | 3300034176 | Sediment | MSVAQPRSPGKPGVISELALARAQRNTVVIVDDLFSSRLLLAEI |
| ⦗Top⦘ |