NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F083918

Metagenome Family F083918

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F083918
Family Type Metagenome
Number of Sequences 112
Average Sequence Length 51 residues
Representative Sequence MGYVEIIDGSGYLARMENDKVTIEPTSDKCMSCNDDRLIHDGKYLVCTQCHCRQ
Number of Associated Samples 87
Number of Associated Scaffolds 112

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Viruses
% of genes with valid RBS motifs 92.86 %
% of genes near scaffold ends (potentially truncated) 33.04 %
% of genes from short scaffolds (< 2000 bps) 75.00 %
Associated GOLD sequencing projects 84
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (85.714 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake
(22.321 % of family members)
Environment Ontology (ENVO) Unclassified
(66.964 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(66.964 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 53.70%    Coil/Unstructured: 46.30%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 112 Family Scaffolds
PF01844HNH 8.04
PF09723Zn-ribbon_8 5.36
PF00145DNA_methylase 3.57
PF05869Dam 3.57
PF03237Terminase_6N 1.79
PF04586Peptidase_S78 1.79
PF14279HNH_5 1.79
PF12728HTH_17 0.89
PF05065Phage_capsid 0.89
PF04860Phage_portal 0.89

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 112 Family Scaffolds
COG0270DNA-cytosine methylaseReplication, recombination and repair [L] 3.57
COG3740Phage head maturation proteaseMobilome: prophages, transposons [X] 1.79
COG4653Predicted phage phi-C31 gp36 major capsid-like proteinMobilome: prophages, transposons [X] 0.89


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.21 %
UnclassifiedrootN/A1.79 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001968|GOS2236_1100448All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage704Open in IMG/M
3300002408|B570J29032_109448246All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage771Open in IMG/M
3300002471|metazooDRAFT_1466828All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage699Open in IMG/M
3300002835|B570J40625_101763743All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage502Open in IMG/M
3300003277|JGI25908J49247_10038567All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1305Open in IMG/M
3300003277|JGI25908J49247_10117140All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage633Open in IMG/M
3300005517|Ga0070374_10169873All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1128Open in IMG/M
3300005527|Ga0068876_10390342All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage777Open in IMG/M
3300005528|Ga0068872_10199616All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1142Open in IMG/M
3300005581|Ga0049081_10189923All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage740Open in IMG/M
3300005662|Ga0078894_10154156All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2065Open in IMG/M
3300005662|Ga0078894_10210154All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1762Open in IMG/M
3300005662|Ga0078894_10953103All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage741Open in IMG/M
3300005662|Ga0078894_11398366All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage584Open in IMG/M
3300005805|Ga0079957_1003115All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage14239Open in IMG/M
3300006802|Ga0070749_10548291All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage627Open in IMG/M
3300006803|Ga0075467_10317798All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage825Open in IMG/M
3300006805|Ga0075464_10250013All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1060Open in IMG/M
3300006805|Ga0075464_11092847All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage502Open in IMG/M
3300006863|Ga0075459_1047489All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage722Open in IMG/M
3300006863|Ga0075459_1056076All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage665Open in IMG/M
3300007538|Ga0099851_1103838All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1081Open in IMG/M
3300007542|Ga0099846_1234941All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage639Open in IMG/M
3300007734|Ga0104986_1077All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage10561Open in IMG/M
3300007734|Ga0104986_1647All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage20835Open in IMG/M
3300008448|Ga0114876_1061062All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1648Open in IMG/M
3300008450|Ga0114880_1037479All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2125Open in IMG/M
3300008450|Ga0114880_1040326All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2030Open in IMG/M
3300008450|Ga0114880_1107505All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1068Open in IMG/M
3300009158|Ga0114977_10359031All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage819Open in IMG/M
3300009183|Ga0114974_10555808All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage638Open in IMG/M
3300009183|Ga0114974_10712351All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage544Open in IMG/M
3300010374|Ga0114986_1061508All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage678Open in IMG/M
3300010885|Ga0133913_11788465All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1539Open in IMG/M
3300011113|Ga0151517_1491All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage14375Open in IMG/M
3300011113|Ga0151517_1739All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage10802Open in IMG/M
3300011114|Ga0151515_10663All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage14512Open in IMG/M
3300011116|Ga0151516_10653All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage16079Open in IMG/M
3300013004|Ga0164293_10142411All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1790Open in IMG/M
(restricted) 3300013126|Ga0172367_10655771All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage557Open in IMG/M
(restricted) 3300013130|Ga0172363_10667441All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage653Open in IMG/M
(restricted) 3300013131|Ga0172373_10302313All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1030Open in IMG/M
(restricted) 3300013131|Ga0172373_10435393All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage810Open in IMG/M
(restricted) 3300013132|Ga0172372_10407065All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage928Open in IMG/M
(restricted) 3300013132|Ga0172372_10762302All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage604Open in IMG/M
(restricted) 3300013137|Ga0172375_10441856All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage885Open in IMG/M
(restricted) 3300014720|Ga0172376_10387392All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage807Open in IMG/M
(restricted) 3300014720|Ga0172376_10732355All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage532Open in IMG/M
(restricted) 3300014720|Ga0172376_10781407All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage511Open in IMG/M
3300014811|Ga0119960_1004957All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1025Open in IMG/M
3300017736|Ga0181365_1100921All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage699Open in IMG/M
3300017754|Ga0181344_1019923All Organisms → cellular organisms → Bacteria2089Open in IMG/M
3300017761|Ga0181356_1145466All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage738Open in IMG/M
3300017774|Ga0181358_1040236All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1798Open in IMG/M
3300017778|Ga0181349_1043054All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1787Open in IMG/M
3300017785|Ga0181355_1396665All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage500Open in IMG/M
3300018416|Ga0181553_10180054All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1236Open in IMG/M
3300018420|Ga0181563_10166650All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1370Open in IMG/M
3300019784|Ga0181359_1074769All Organisms → Viruses → Predicted Viral1278Open in IMG/M
3300019784|Ga0181359_1233783All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage569Open in IMG/M
3300020074|Ga0194113_10461230All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage920Open in IMG/M
3300020172|Ga0211729_10044257All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage16003Open in IMG/M
3300020179|Ga0194134_10039661All Organisms → cellular organisms → Bacteria2729Open in IMG/M
3300020183|Ga0194115_10039912All Organisms → Viruses → Predicted Viral3136Open in IMG/M
3300020183|Ga0194115_10045823All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2829Open in IMG/M
3300020513|Ga0208090_1016813All Organisms → Viruses → Predicted Viral1099Open in IMG/M
3300020548|Ga0208856_1003091All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3994Open in IMG/M
3300021093|Ga0194123_10494108Not Available544Open in IMG/M
3300021424|Ga0194117_10480065All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage558Open in IMG/M
3300021961|Ga0222714_10201641All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1149Open in IMG/M
3300021963|Ga0222712_10029291All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4393Open in IMG/M
3300022179|Ga0181353_1087098All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage782Open in IMG/M
3300022198|Ga0196905_1172244All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage550Open in IMG/M
3300022407|Ga0181351_1032478All Organisms → cellular organisms → Bacteria2220Open in IMG/M
3300022407|Ga0181351_1059422All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1576Open in IMG/M
3300022748|Ga0228702_1111384All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage632Open in IMG/M
3300022752|Ga0214917_10028567All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4262Open in IMG/M
3300022752|Ga0214917_10029077All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4206Open in IMG/M
3300022752|Ga0214917_10073706All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2128Open in IMG/M
3300022752|Ga0214917_10150341All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1232Open in IMG/M
3300022752|Ga0214917_10169538All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1123Open in IMG/M
3300022752|Ga0214917_10454751All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage509Open in IMG/M
3300023179|Ga0214923_10334854All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage805Open in IMG/M
3300025283|Ga0208048_1103593All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage599Open in IMG/M
3300025635|Ga0208147_1043348All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1163Open in IMG/M
3300025896|Ga0208916_10205237All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage854Open in IMG/M
3300027697|Ga0209033_1251706Not Available509Open in IMG/M
3300027733|Ga0209297_1080633All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1421Open in IMG/M
3300027785|Ga0209246_10136696All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage963Open in IMG/M
3300027785|Ga0209246_10329605All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage583Open in IMG/M
3300027798|Ga0209353_10353858All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage612Open in IMG/M
3300027804|Ga0209358_10278531All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage830Open in IMG/M
3300028025|Ga0247723_1066679All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage980Open in IMG/M
3300028027|Ga0247722_10079967All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1226Open in IMG/M
3300029930|Ga0119944_1000438All Organisms → cellular organisms → Bacteria7290Open in IMG/M
3300029933|Ga0119945_1002516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2690Open in IMG/M
3300031707|Ga0315291_10939354All Organisms → cellular organisms → Bacteria735Open in IMG/M
3300031758|Ga0315907_10279833All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1375Open in IMG/M
3300031772|Ga0315288_10741697All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage918Open in IMG/M
3300031787|Ga0315900_10347108All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1200Open in IMG/M
3300031951|Ga0315904_10711617All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage842Open in IMG/M
3300031951|Ga0315904_11416783All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage517Open in IMG/M
3300031963|Ga0315901_10936430All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage612Open in IMG/M
3300031999|Ga0315274_10479713All Organisms → Viruses → Predicted Viral1414Open in IMG/M
3300032093|Ga0315902_10275262All Organisms → Viruses → Predicted Viral1615Open in IMG/M
3300032116|Ga0315903_10221768All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1660Open in IMG/M
3300033816|Ga0334980_0008165All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4606Open in IMG/M
3300033992|Ga0334992_0056786All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2206Open in IMG/M
3300034022|Ga0335005_0206321All Organisms → Viruses → Predicted Viral1216Open in IMG/M
3300034061|Ga0334987_0044265All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3752Open in IMG/M
3300034104|Ga0335031_0088037All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2201Open in IMG/M
3300034106|Ga0335036_0089082All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2283Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake22.32%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater21.43%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous9.82%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake8.93%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater6.25%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater6.25%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake4.46%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment3.57%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater1.79%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater1.79%
AquaticEnvironmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic1.79%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.79%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.79%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment1.79%
LakeEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake0.89%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic0.89%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.89%
AquaticEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic0.89%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater0.89%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.89%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface0.89%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001968Marine microbial communities from Lake Gatun, Panama - GS020EnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300002471Freshwater microbial communities from San Paulo Zoo lake, Brazil - MAY 2013EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003277Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SDEnvironmentalOpen in IMG/M
3300005517Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)EnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005528Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaGEnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006863Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNAEnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007542Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaGEnvironmentalOpen in IMG/M
3300007734Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015JanEnvironmentalOpen in IMG/M
3300008448Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigsEnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300009158Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaGEnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300010374Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S-1-Day17EnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300011113Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015SepEnvironmentalOpen in IMG/M
3300011114Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016FebEnvironmentalOpen in IMG/M
3300011116Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015NovEnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013126 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10mEnvironmentalOpen in IMG/M
3300013130 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2EnvironmentalOpen in IMG/M
3300013131 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10mEnvironmentalOpen in IMG/M
3300013132 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5mEnvironmentalOpen in IMG/M
3300013137 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1mEnvironmentalOpen in IMG/M
3300014720 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35mEnvironmentalOpen in IMG/M
3300014811Aquatic viral communities from ballast water - Michigan State University - AB_ballast waterEnvironmentalOpen in IMG/M
3300017736Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.NEnvironmentalOpen in IMG/M
3300017754Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.DEnvironmentalOpen in IMG/M
3300017761Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017774Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017778Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300020172Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1EnvironmentalOpen in IMG/M
3300020179Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0mEnvironmentalOpen in IMG/M
3300020183Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surfaceEnvironmentalOpen in IMG/M
3300020513Freshwater microbial communities from Lake Mendota, WI - 20JUL2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020548Freshwater microbial communities from Lake Mendota, WI - 13JUL2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021093Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015023 Mahale A surfaceEnvironmentalOpen in IMG/M
3300021424Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surfaceEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022179Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.NEnvironmentalOpen in IMG/M
3300022198Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022407Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300022748Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MGEnvironmentalOpen in IMG/M
3300022752Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BBEnvironmentalOpen in IMG/M
3300023179Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510EnvironmentalOpen in IMG/M
3300025283Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L (SPAdes)EnvironmentalOpen in IMG/M
3300025635Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027697Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027733Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027785Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027798Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027804Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes)EnvironmentalOpen in IMG/M
3300028025Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FCEnvironmentalOpen in IMG/M
3300028027Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 3H_FCEnvironmentalOpen in IMG/M
3300029930Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727EnvironmentalOpen in IMG/M
3300029933Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727_2EnvironmentalOpen in IMG/M
3300031707Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031772Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300031999Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20EnvironmentalOpen in IMG/M
3300032093Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300033816Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005EnvironmentalOpen in IMG/M
3300033992Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035EnvironmentalOpen in IMG/M
3300034022Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058EnvironmentalOpen in IMG/M
3300034061Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028EnvironmentalOpen in IMG/M
3300034104Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120EnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
GOS2236_110044823300001968MarineMMGFVEIIDGSGYLARLENDQVTIEASTDKCMACNDDRLLHDGKYLVCTQCHCRQ*
B570J29032_10944824613300002408FreshwaterMGYLEIVDGSGYQARFENDKITIEPTTDKCMSCNDDRLLHDGKYLVCTQCHCRQ*
metazooDRAFT_146682813300002471LakeMGYVEIIDGSGYLARLENNKITIEPTNDKCMACNDDRLMHDGTYLVCTQCRCIQ*
B570J40625_10176374323300002835FreshwaterMGYVEIIDGSGYLARLENDKITIEPTNDKCMACNDDRLMHDGTY
JGI25908J49247_1003856743300003277Freshwater LakeMGYVEILDGSHYLARVENDKVTIELTKDRCVSCNDDRLLHDGQYLVCAICHCRQ*
JGI25908J49247_1011714013300003277Freshwater LakeMGYVEILDGSHYLARLENDKVTIEPTIDRCVSCNDDRLLHDGQYLVCAICHCRQ*
Ga0070374_1016987323300005517Freshwater LakeMGYVEILDGSHYLARLENDKVTIEPTMDRCVSCNDDRLLHDGQYLVCAICHCRQ*
Ga0068876_1039034223300005527Freshwater LakeMGYVEIIDGSGYQARLENDKITIEPTDDKCMACNDDRLLHDGQYLVCTQCHCRQ
Ga0068872_1019961623300005528Freshwater LakeMGYVEIIDGSGYQARLENDKITIEPTDDKCMACNDDRLLHDGQYLVCTQCHCRQ*
Ga0049081_1018992323300005581Freshwater LenticMGYVEIIDGSGYLARLENDKITIEPTNDKCMACNDDRLMHDGTYLVCTQC
Ga0078894_1015415623300005662Freshwater LakeMGYVEIIDGSGYLARMENDKVTIEPTLDKCMSCNDDRLIHDGKYLVCTQCHCRQ*
Ga0078894_1021015423300005662Freshwater LakeMGYVEIIDGSGYLARMENDKVTIEPTLDKCMSCNDDRLIHDGKHLVCTQCHCRQ*
Ga0078894_1095310323300005662Freshwater LakeMGYVEIIDGSGYLARLEDGKTTIEPTSDKCMSCNDD
Ga0078894_1139836623300005662Freshwater LakeMGYVEIIDGSGYLARLENNKVTIEPTTDRCVSCNDDRLIHSGNFLVCTICHCRQ*
Ga0079957_100311533300005805LakeMGYLEIVDGSGYQARFEDDKITIEPTTDKCMSCNDDRLLHDGKYLVCTQCHCRQ*
Ga0070749_1054829123300006802AqueousMGYVEIIDGSGYQARLENDKITIEPTDDKCMACNDDRLLHDGNYLVCTQCHCRQ*
Ga0075467_1031779823300006803AqueousMGYVEIIDGSGYLARFENNKVTIEPTTDRCVSCNDDRLIHSGNFLVCTICHCRQ*
Ga0075464_1025001323300006805AqueousMGYVEIIDGSGYLARMENDKVTIEPTLDKCMSCNDDRLIHDGKHLVCTQCHGRQ*
Ga0075464_1109284733300006805AqueousYVEIIDGSGYLARLEDGKTTIEPTSDKCMSCNDDRLMHDGKYLVCTQCHCRQ*
Ga0075459_104748913300006863AqueousMGYVEIIDGSGYLARMENDKVTIEPTSDKCMSCNDDRLIHDGKYLVCTQCHCRQ*
Ga0075459_105607623300006863AqueousMGYVEIIDGSGYLARLENNKVTIEPTTDRCVSCNDDRLIHSGNFLVCTQCHCRQ*
Ga0099851_110383833300007538AqueousMSYVEIIDGSGYLARLENNKVTIEPTTDRCVSCNDDRLIHSGNFLVCTICHCRQ*
Ga0099846_123494123300007542AqueousMGFVEIIDGSGYLARLENDQVTIEPTDDKCMACNDDRLLHDGNYLVCTQCHCRQ*
Ga0104986_1077183300007734FreshwaterMGFVEIIDGSGYLARLENDQITIEPTDDKCMACNDDRLIHDGNYLVCTQCHCRQ*
Ga0104986_1647173300007734FreshwaterMMGYVEIIDGSGYLARLENDQITIESTDDKCMACNDDRLIHDGNYLVCTQCHCRQ*
Ga0114876_106106243300008448Freshwater LakeMGFVEIIDGSGYLARLENDQITIEPSDDKCMACNDDRLIHDGNYLVCTQCHCRQ*
Ga0114880_103747923300008450Freshwater LakeMGYVEILDGSHYLARVENDKVTIEPTMDRCVSCNDDRLLHDGQYLVCAICHCRQ*
Ga0114880_104032633300008450Freshwater LakeMGYVEIIDGSGYLARLENNKVTIEPTTDRCISCNDDRLIHSGNFLVCTICHCRQ*
Ga0114880_110750543300008450Freshwater LakeSGYLARLEDGKTTIEPTSDKCMSCNDDRLMHDGKYLVCTQCHCRQ*
Ga0114977_1035903123300009158Freshwater LakeMGYVEILDGSHYLARVENDKVTIEPTKDRCVSCNDDRLLHDGQYLVCSQCHCRQ*
Ga0114974_1055580813300009183Freshwater LakeMGYVEILDGSHYLARVENDKVTIEPTKDRCVSCNDDRLLHDGQY
Ga0114974_1071235133300009183Freshwater LakeVEILDGSHYLARVENDKVTIEPTKDRCVSCNDDRLLHDGQYLVCSQCHCRQ*
Ga0114986_106150823300010374Deep SubsurfaceMGYVEIIDGSGYLARLEDGKTTIEPTSDKCMSCNDDRLMHDGKYLVCTQCHCRQ*
Ga0133913_1178846513300010885Freshwater LakeVEILDGSHYLARVENDKVTIEPTKDRCVSCNDDRLLHDGQYLVCAICHCRQ*
Ga0151517_1491223300011113FreshwaterMGYVEIVDGSHYLARLENDKVTIEPTIDRCVSCNDDRLLHDGQYLVCAICHCRQ*
Ga0151517_1739163300011113FreshwaterMGYVEIIDGSGYLARFENDKITIEPSGDKCMSCNDDRLMHDGKYLVCTQCHCRQ*
Ga0151515_10663223300011114FreshwaterMMGYVEIIDGSGYLARLENDKITIEPTNDKCMACNDDRLMHDGTYMVCTQCHCIQ*
Ga0151516_1065363300011116FreshwaterMGYVEIIDGSGYLARLENDKITIEPTNDKCMACNDDRLMHDGTYLVCTQCHCIQ*
Ga0164293_1014241133300013004FreshwaterMGYVEIIDGSHYLARLENDKVTIEPTMDRCVSCNDDRLLHDGQYLVCSQCNCRQ*
(restricted) Ga0172367_1065577123300013126FreshwaterMGYVEIIDGSGYRARIENDKITIEPSTDMCMSCNDDRLIHDGKYLVCTQCHCR
(restricted) Ga0172363_1066744123300013130SedimentMGYVEIIDGSGYLARIENDKITIEPSTDKCMSCNDDRLIHDGKYLVCTQCHCRQ*
(restricted) Ga0172373_1030231323300013131FreshwaterMGYVEICNGYGYLARIENDKITIEPSTDKCMSCNDDRLIHDGKYLVCTQCHCRQ*
(restricted) Ga0172373_1043539313300013131FreshwaterMGYVEIIDGSGYLARIENDKITIEPSTDMCMSCNDDRLIH
(restricted) Ga0172372_1040706513300013132FreshwaterMGYVEIIDGSGYLARIENDKITIEPSTDMCMSCNDDRLIHDGKYLVCTQCHCRQ*
(restricted) Ga0172372_1076230213300013132FreshwaterMGYVEIIDGSGYLARIENDKITIEPSTDMCMSCNDDRLIHDGKYLVCTQCHC
(restricted) Ga0172375_1044185613300013137FreshwaterMGYVEIIDGSGYLARIENDKITIEPSTDMCMSCNDDRLIHDGKYLVCTQCHCRQ
(restricted) Ga0172376_1038739213300014720FreshwaterMGYVEICNGYGYLARIENDKITIEPSTDMCMSCNDDRLIHDGKY
(restricted) Ga0172376_1073235523300014720FreshwaterMGYVEIIDGSGYLARIENDKITIEPSTDMCMSCNDD
(restricted) Ga0172376_1078140713300014720FreshwaterMGYVQIIDGSGYLARIENDKITIEPSTDMCMSCNDDR
Ga0119960_100495733300014811AquaticMGYVEIIDGSGYLARLENDKITIEPTNDKCMACNDDRLMHDGTYLVCTQCRCIQ*
Ga0181365_110092113300017736Freshwater LakeMGYVEILDGSHYLARLENDKVTIEPTIDRCVSCNDDRLLHDGQYL
Ga0181344_101992363300017754Freshwater LakeMGYVEIIDGSGYLARLEDGKTTIEPTVDKCMSCNDDRLIHDGKHLVCTQCHCRQ
Ga0181356_114546633300017761Freshwater LakeMGYVEILDGNHYLARLENDKVTIEPTMERCVSCNDDRLLHDGQYLVCAICHCRQ
Ga0181358_104023623300017774Freshwater LakeMGYVEILDGSHYLARLENDKVTIEPTIDRCVSCNDDRLLHDGQYLVCSQCDCRQ
Ga0181349_104305413300017778Freshwater LakeMGYVEILDGSHYLARVENDKVTIEPTIDRCVSCNDDRLLHDGQYLVCSQCDCRQ
Ga0181355_139666523300017785Freshwater LakeMGYLEILDGSHYLARLENDKVTIEPTMERCVSCNDDRLLHDGQYLVCAICHCRQ
Ga0181553_1018005433300018416Salt MarshMGYLEIIDGSGYLARFENDKITLEPTSDKCMACNDDRLLHDGQYLVCTQCHCRQ
Ga0181563_1016665033300018420Salt MarshMGYLEIIDGSGYLARFENDKITLEPTSDKCMACNDDRLLHDGPYLVCTQCHCRQ
Ga0181359_107476933300019784Freshwater LakeMGYVEILDGSHYLARVENDKVTIELTKDRCAICHCRQ
Ga0181359_123378323300019784Freshwater LakeMGYVEIIDGSGYLARLENDKITIEPTNDKCMACNDDRLMHDGTYLVC
Ga0194113_1046123023300020074Freshwater LakeMGFVEVIDGSGYLARFERNKVTIEPTTDRCMSCNDDRLIHDGKYLVCTQCHCRQ
Ga0211729_10044257113300020172FreshwaterMGYAEIIDGSGYLARFENDKITIEPTGDKCMSCNDDRLMHDGKYLVCTQCHCRQ
Ga0194134_1003966143300020179Freshwater LakeMGYLEVIDGSGYLARFERNKVTIEPTTDRCMSCNDDRLIHDGKYLVCTQCHCRQ
Ga0194115_1003991283300020183Freshwater LakeMGYVELIDGSGYLARFERNKVTIEPTTDRCMSCNDDRLIHDGKYLVCTQCHCRQ
Ga0194115_1004582333300020183Freshwater LakeMGYVEVIDGSGYLARFERNKVTIEPTIDRCMSCNDDRLIHDGKYLVCTQCHCRQ
Ga0208090_101681333300020513FreshwaterMGYLEIVDGSGYQARFEDDKITIEPTTDKCMSCNDDRLLHDGKYLVCTQCHC
Ga0208856_100309183300020548FreshwaterMGYLEIVDGSGYQARFEDDKITIEPTTDKCMSCNDDRLLHDGKYLVCTQCHCRQ
Ga0194123_1049410823300021093Freshwater LakeMGYVELIDGSGYLARFERNKVTIEPTTDRCMSCNDDRLIHDGKYLVC
Ga0194117_1048006513300021424Freshwater LakeMGYVELIDGSGYLARFERNKVTIEPTTDRCMSCNDDRLIHDGKYLVCTQCHCRQG
Ga0222714_1020164123300021961Estuarine WaterMGYVEIIDGSGYLARLENNKVTIEPTTDRCVSCNDDRLIHSGNFLVCTICHCRQ
Ga0222712_10029291123300021963Estuarine WaterMGYAEIIDGSGYLARFENDKITIEPSGDKCMSCNDDRLMHDGKYLVCTQCHCRQ
Ga0181353_108709813300022179Freshwater LakeMGYVEIIDGSGYLARLEDGKTTIEPTSDKCMSCNDDRLMHDGKYL
Ga0196905_117224423300022198AqueousMGFVEIIDGSGYLARLENDQVTIEPTDDKCMACNDDRLLHDGNYLVCTQCHCRQ
Ga0181351_103247823300022407Freshwater LakeMGYVEILDGSHYLARVENDKVTIEPTMDRCVSCNDDRLLHDGQYLVCSQCDCRQ
Ga0181351_105942223300022407Freshwater LakeMGYVEIIDGSGYLARMENDKVTIEPTLDKCMSCNDDRLIHDGKHLVCTQCHCRQ
Ga0228702_111138423300022748FreshwaterMGYVEIIDGSGYLARLENDKVTIEPTSDRCVSCNDDRLIHSGNFLVCTQCHCRQ
Ga0214917_1002856773300022752FreshwaterMGYVEIIDGSGYLARLENNKVTIEPTTDRCVSCNDDRLIHSGNFLVCTVCHCRQ
Ga0214917_1002907753300022752FreshwaterMGFLEIIDGSGYLARFENDKITLEPTSDKCMACNDDRLLHDGQYLVCTQCHCRQ
Ga0214917_1007370633300022752FreshwaterMGYLEIIDGSGYLARFENDKITIEPTSDKCMACNDDRLLHDGPYLVCTQCHCRQ
Ga0214917_1015034133300022752FreshwaterMGYLEIIDGSGYLARFENDKITLEPTTDKCMACNDDRLLHDGPYLVCTQCHCRQ
Ga0214917_1016953823300022752FreshwaterMGYLEIIDGSGYLARFENDKITLVPTSDKCMACNDDRLLHDGQYLVCSQCHCRQ
Ga0214917_1045475113300022752FreshwaterMGYLEIIDGSGYLARFENDKITLEPTSDKCMACNDDRLLHDGQY
Ga0214923_1033485413300023179FreshwaterMGYLEIIDGSGYLARFENDKITLVPTSDKCMACNDDRL
Ga0208048_110359323300025283FreshwaterMGYVEVIDGSGYLARFERNKVTIEPTTDRCMSCNDDRLIHDGKYLVCTQCHCRQ
Ga0208147_104334823300025635AqueousMGYVEIIDGSGYLARMENDKVTIEPTTDRCVSCNDDRLIHSGNFLVCTQCHCRQ
Ga0208916_1020523733300025896AqueousMGYVEIIDGSGYLARLENNKVTIEPTTDRCVSCNDDRL
Ga0209033_125170613300027697Freshwater LakeMGYVEIIDGSGYLARLENDKITIEPTNDKCMACND
Ga0209297_108063343300027733Freshwater LakeMGYVEILDGSHYLARVENDKVTIEPTKDRCVSCNDDRLLHDGQYLVCSQCHCRQ
Ga0209246_1013669613300027785Freshwater LakeMGYVEILDGSHYLARLENDKVTIEPTIDRCVSCNDDRLLHDGQYLVCAIC
Ga0209246_1032960523300027785Freshwater LakeMGYVEILDGSHYLARVENDKVTIEPTMDRCVSCNDDRLL
Ga0209353_1035385823300027798Freshwater LakeMGYLEIIDGSHYLARLENDKVTIEPTMDRCVSCNDDRLLHDGQYLVCA
Ga0209358_1027853113300027804Freshwater LakeSGYLARLENNKVTIEPTTDRCVSCNDDRLIHSGNFLVCTICHCRQ
Ga0247723_106667923300028025Deep Subsurface SedimentMGYVEIIDGSGYLARMENDKVTIEPTSDKCMSCNDDRLMHDGKYLVCTQCHCRQ
Ga0247722_1007996733300028027Deep Subsurface SedimentGSGYLARLEDGKTTIEPTSDKCMSCNDDRLMHDGKYLVCTQCHCRQ
Ga0119944_1000438143300029930AquaticMMGFVEIIDGSGYLARLENDQITIEPTDDKCMACNDDRLIHDGNYLVCTQCHCRQ
Ga0119945_100251663300029933AquaticMGFVEIIDGSGYLARLENDQITIEPTDDKCMACNDDRLIHDGNYLVCTQCHCRQ
Ga0315291_1093935433300031707SedimentMGYVEIIDGSHYLARLENDKVTIEPTMDRCVSCNDDRLLHDGQYLVCSQCDCRQ
Ga0315907_1027983323300031758FreshwaterMGYVEIIDGSGYQARLENDKITIEPTNDKCMACNDDRLLHDGQYLVCTQCHCRQ
Ga0315288_1074169713300031772SedimentMGYVEIIDGSHYLARLENDKVTIEPTMDRCVSCNDD
Ga0315900_1034710843300031787FreshwaterMGYVEIIDGSGYLARLENNKVTIEPTTDRCISCNDDRLIHSGNFLVCTICHCRQ
Ga0315904_1071161713300031951FreshwaterMGYVEIIDGSGYQARLENDKITIEPTDDKCMACNDDRLLHDGQYLVCT
Ga0315904_1141678323300031951FreshwaterMGFVEIIDGSGYLARLENDQITIEPSDDKCMACNDDRLIHDGNYLVCTQCHCRQ
Ga0315901_1093643013300031963FreshwaterMGYVEIIDGSGYQARLQNDKITIEPTTDKCMSCNDDRL
Ga0315274_1047971323300031999SedimentMGYVEILDGSHYLARLENDKVTIEPTMERCVSCNDDRLLHDGQYLVCAICHCRQ
Ga0315902_1027526253300032093FreshwaterMGYVEIIDGSGYQARLQNDKITIEPTTDKCMSCNDDRLIHDGK
Ga0315903_1022176843300032116FreshwaterMGYVEIIDGSGYQARLENDKITIEPTDDKCMACNDDRLPTVQM
Ga0334980_0008165_1203_13703300033816FreshwaterMMGFVEIIDGSGYLARLENDQVTIEPTDDKCMACNDDRLIHDGNYLVCTQCHCRQ
Ga0334992_0056786_1799_19633300033992FreshwaterMGYLEIVDGSGYQARFENDKITIEPTTDKCMSCNDDRLLHDGKYLVCTQCHCRQ
Ga0335005_0206321_1_1323300034022FreshwaterMGYVEIIDGSGYLARLEDGKTTIEPTSDKCMSCNDDRLMHDGKY
Ga0334987_0044265_1203_13673300034061FreshwaterMGFVEIIDGSGYLARLENDQVTIEPTDDKCMACNDDRLIHDGNYLVCTQCHCRQ
Ga0335031_0088037_874_10383300034104FreshwaterMGYVEIINGSGYLARLEDGKTTIEPTSDKCMSCNDDRLMHDGKYLVCTQCHCRQ
Ga0335036_0089082_1292_14563300034106FreshwaterMGYVEIIDGSHYLARLENDKVTIEPTMDRCVSCNDDRLLHDGQYLVCSQCNCRQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.