NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F083906

Metagenome / Metatranscriptome Family F083906

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F083906
Family Type Metagenome / Metatranscriptome
Number of Sequences 112
Average Sequence Length 70 residues
Representative Sequence HGAPTRVYLLKAMQRSPKTGWTGLISFNDRCRDFGELREVILQARKLAVGDIEKHQRAVPTSELLAA
Number of Associated Samples 71
Number of Associated Scaffolds 112

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.79 %
% of genes near scaffold ends (potentially truncated) 91.07 %
% of genes from short scaffolds (< 2000 bps) 91.07 %
Associated GOLD sequencing projects 66
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.429 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(50.893 % of family members)
Environment Ontology (ENVO) Unclassified
(83.929 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(51.786 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 53.73%    β-sheet: 0.00%    Coil/Unstructured: 46.27%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 112 Family Scaffolds
PF02738MoCoBD_1 2.68
PF02617ClpS 0.89
PF07978NIPSNAP 0.89
PF02371Transposase_20 0.89
PF03449GreA_GreB_N 0.89
PF00583Acetyltransf_1 0.89
PF10276zf-CHCC 0.89
PF02798GST_N 0.89
PF13522GATase_6 0.89

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 112 Family Scaffolds
COG0782Transcription elongation factor, GreA/GreB familyTranscription [K] 0.89
COG2127ATP-dependent Clp protease adapter protein ClpSPosttranslational modification, protein turnover, chaperones [O] 0.89
COG3547TransposaseMobilome: prophages, transposons [X] 0.89


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.43 %
UnclassifiedrootN/A3.57 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005178|Ga0066688_10253118All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1128Open in IMG/M
3300005445|Ga0070708_100512541All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1131Open in IMG/M
3300005471|Ga0070698_102186511All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium507Open in IMG/M
3300005553|Ga0066695_10721453All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium582Open in IMG/M
3300006032|Ga0066696_11039455All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium521Open in IMG/M
3300006804|Ga0079221_10662355All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium718Open in IMG/M
3300012205|Ga0137362_10933619All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium740Open in IMG/M
3300012925|Ga0137419_11127099All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium654Open in IMG/M
3300016270|Ga0182036_10167981All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1579Open in IMG/M
3300016270|Ga0182036_10476120All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium985Open in IMG/M
3300016270|Ga0182036_10688864All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium826Open in IMG/M
3300016294|Ga0182041_12012356All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium538Open in IMG/M
3300016357|Ga0182032_10740117All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium828Open in IMG/M
3300016357|Ga0182032_10972803All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium724Open in IMG/M
3300016357|Ga0182032_11188632All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium656Open in IMG/M
3300016387|Ga0182040_10467466All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1002Open in IMG/M
3300016387|Ga0182040_11034745All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium686Open in IMG/M
3300016404|Ga0182037_11865455All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium538Open in IMG/M
3300017955|Ga0187817_11127436All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium504Open in IMG/M
3300020581|Ga0210399_10583368All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium926Open in IMG/M
3300021478|Ga0210402_10106245All Organisms → cellular organisms → Bacteria → Proteobacteria2526Open in IMG/M
3300027651|Ga0209217_1181711All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium572Open in IMG/M
3300027783|Ga0209448_10091307All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1021Open in IMG/M
3300029636|Ga0222749_10442077All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium695Open in IMG/M
3300031543|Ga0318516_10642210All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium604Open in IMG/M
3300031543|Ga0318516_10850287All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium514Open in IMG/M
3300031545|Ga0318541_10113445All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1466Open in IMG/M
3300031546|Ga0318538_10448310All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium699Open in IMG/M
3300031561|Ga0318528_10720601All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium534Open in IMG/M
3300031572|Ga0318515_10713929All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium530Open in IMG/M
3300031573|Ga0310915_10229604All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1303Open in IMG/M
3300031668|Ga0318542_10318345All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium798Open in IMG/M
3300031680|Ga0318574_10857748All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium532Open in IMG/M
3300031681|Ga0318572_10131996Not Available1433Open in IMG/M
3300031682|Ga0318560_10203591Not Available1058Open in IMG/M
3300031719|Ga0306917_10077779All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2319Open in IMG/M
3300031719|Ga0306917_10168810All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1637Open in IMG/M
3300031723|Ga0318493_10103185Not Available1433Open in IMG/M
3300031744|Ga0306918_10344963All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas coralli1154Open in IMG/M
3300031744|Ga0306918_10537529All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium915Open in IMG/M
3300031753|Ga0307477_10139591All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1691Open in IMG/M
3300031763|Ga0318537_10237383All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium677Open in IMG/M
3300031768|Ga0318509_10563229All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium635Open in IMG/M
3300031768|Ga0318509_10594605All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium616Open in IMG/M
3300031768|Ga0318509_10635466All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium594Open in IMG/M
3300031771|Ga0318546_10324856All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1068Open in IMG/M
3300031781|Ga0318547_10546953All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium716Open in IMG/M
3300031796|Ga0318576_10270628All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium802Open in IMG/M
3300031797|Ga0318550_10213319All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium935Open in IMG/M
3300031797|Ga0318550_10406443All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300031798|Ga0318523_10664773All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium512Open in IMG/M
3300031799|Ga0318565_10621078All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium519Open in IMG/M
3300031835|Ga0318517_10546484All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium521Open in IMG/M
3300031859|Ga0318527_10079662All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1323Open in IMG/M
3300031879|Ga0306919_10097661All Organisms → cellular organisms → Bacteria2060Open in IMG/M
3300031879|Ga0306919_10261262All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1305Open in IMG/M
3300031880|Ga0318544_10239380All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium702Open in IMG/M
3300031890|Ga0306925_10298169All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1734Open in IMG/M
3300031890|Ga0306925_10350032All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1587Open in IMG/M
3300031890|Ga0306925_10651164All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1107Open in IMG/M
3300031890|Ga0306925_10660882All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1098Open in IMG/M
3300031890|Ga0306925_10844612All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium946Open in IMG/M
3300031890|Ga0306925_12069542All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium534Open in IMG/M
3300031893|Ga0318536_10571578All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium566Open in IMG/M
3300031896|Ga0318551_10047542All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2152Open in IMG/M
3300031896|Ga0318551_10326806All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium865Open in IMG/M
3300031910|Ga0306923_10510529All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1358Open in IMG/M
3300031910|Ga0306923_10668710All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1159Open in IMG/M
3300031910|Ga0306923_10683238All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1144Open in IMG/M
3300031910|Ga0306923_10979458All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium920Open in IMG/M
3300031910|Ga0306923_12288928All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium539Open in IMG/M
3300031910|Ga0306923_12477125All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium512Open in IMG/M
3300031912|Ga0306921_10187745All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2423Open in IMG/M
3300031912|Ga0306921_11300377All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium804Open in IMG/M
3300031942|Ga0310916_10416022All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1144Open in IMG/M
3300031942|Ga0310916_10838447Not Available773Open in IMG/M
3300031945|Ga0310913_11058078All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium567Open in IMG/M
3300031946|Ga0310910_10503580All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium961Open in IMG/M
3300031946|Ga0310910_10842435All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium721Open in IMG/M
3300031946|Ga0310910_11089102All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium622Open in IMG/M
3300031947|Ga0310909_10206376All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1634Open in IMG/M
3300031947|Ga0310909_10866033All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium743Open in IMG/M
3300031954|Ga0306926_10088512All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3779Open in IMG/M
3300031954|Ga0306926_10555827All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1405Open in IMG/M
3300031962|Ga0307479_10585013All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1098Open in IMG/M
3300031962|Ga0307479_11006772All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium802Open in IMG/M
3300031962|Ga0307479_11408223All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium656Open in IMG/M
3300031981|Ga0318531_10102880All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium1259Open in IMG/M
3300031981|Ga0318531_10291338All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium737Open in IMG/M
3300032001|Ga0306922_10092481All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium3189Open in IMG/M
3300032001|Ga0306922_11571045All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium655Open in IMG/M
3300032001|Ga0306922_12029123All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium559Open in IMG/M
3300032025|Ga0318507_10151022All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium993Open in IMG/M
3300032035|Ga0310911_10400036All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium794Open in IMG/M
3300032035|Ga0310911_10789111All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium549Open in IMG/M
3300032039|Ga0318559_10327736All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium712Open in IMG/M
3300032042|Ga0318545_10246482All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium641Open in IMG/M
3300032051|Ga0318532_10247924All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium632Open in IMG/M
3300032054|Ga0318570_10113243All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1194Open in IMG/M
3300032055|Ga0318575_10701174All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium512Open in IMG/M
3300032059|Ga0318533_10435193All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium959Open in IMG/M
3300032060|Ga0318505_10314404All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium739Open in IMG/M
3300032063|Ga0318504_10542982All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium557Open in IMG/M
3300032076|Ga0306924_10087268All Organisms → cellular organisms → Bacteria → Proteobacteria3507Open in IMG/M
3300032261|Ga0306920_100066878All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales5259Open in IMG/M
3300032261|Ga0306920_100075202All Organisms → cellular organisms → Bacteria → Proteobacteria4956Open in IMG/M
3300032261|Ga0306920_100936838All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1264Open in IMG/M
3300032261|Ga0306920_103984039All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium536Open in IMG/M
3300033289|Ga0310914_10194342All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1810Open in IMG/M
3300033289|Ga0310914_10387694All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1264Open in IMG/M
3300033289|Ga0310914_10514447All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1082Open in IMG/M
3300033289|Ga0310914_10593971All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium999Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil50.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil35.71%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.68%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.79%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.79%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.89%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.89%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.89%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300027651Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027783Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032051Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0066688_1025311823300005178SoilMQRSPKTGWTGLISFNDRCRDFGELREVILQARKLAVADIEKHQRAVPTSELLAA*
Ga0070708_10051254113300005445Corn, Switchgrass And Miscanthus RhizosphereTRVYLLKAMQRSPKTGWTGLISFNDRCRDFCELREVILQARKLAIADIEKHQRDVPTSELLAA*
Ga0070698_10218651123300005471Corn, Switchgrass And Miscanthus RhizosphereRWIKGKLHDDAGNRCLVGALRDIRDGHNLHGAPTRVYLLKAMERSSKTGWTGLISFNDRCKDFGELREVILQARKLAVADIEKHHRAVPTSELLAA*
Ga0066695_1072145323300005553SoilIRDGHNLHGTPTRVYLLKAMQRSPKTGWTGLISFNDRCRDFGELREVILQARKLAVADIEKYQRDVPTSELLAA*
Ga0066696_1103945513300006032SoilSPKTGWTGLISFNDRCRDFGELREVILQARKLAVADIEKYQRDVPTSELLAA*
Ga0079221_1066235513300006804Agricultural SoilDGAGNRCLVGALRDIRDGHNLHGAPTRVYLLKAMQRSPKTGWTGLISFNDRCRDFCELREVILQARKLAVADIEKHQRAVATSELLAA*
Ga0137362_1093361913300012205Vadose Zone SoilWIKGKLDDGAGNRCLVGALRDIRDGHNLHGTPTRVYLLKAMQRSPKTGWTGLISFNDRCRDFGELREVILQARKLAVADIEKYHRDVPTSERGLAPATAPA*
Ga0137419_1112709923300012925Vadose Zone SoilMQRSPKTGWTGLISFNDRCRDFGELREVILQARKLAVADIEQHQRAVPTSELLAA*
Ga0182036_1016798133300016270SoilCLVGALRDIRDGHNLHGAPTRAYLLKAMQRSPKPGWTGLISFNDRCRDFGELHEVILQARKLAVADTEKHKRAVPTSELLAA
Ga0182036_1047612023300016270SoilMQRSPKAGWTGLISFNDRCRDFGELREVILQARKLAVADIEKH
Ga0182036_1068886413300016270SoilRCLVGALRDLRDGHNLHSAPTRLYLLKAMQRSPKAGWTGLISFNDRCRDFGELREVILQARKLAVADIEKHQRDVPTSQLLAA
Ga0182041_1201235623300016294SoilYLLKAMQRSPKTGWTGLISFNDRCRDFGELRDVILQARKLAVADIEKHQRAVPTSELLAA
Ga0182032_1074011713300016357SoilERWIKGKLDDGAGNHCLVGALRDIRDGHNIHGAPTRVYLLKAMQGSPKTGWTGLISFYDRSRDFGELREVILQARKLAVADIAKHQCAVPTSELLAA
Ga0182032_1097280313300016357SoilPTRVYLLKAMQRSPKTGWTGLISFNDRCRDFGELREVILQARKLAVREIEKHQRAVPTSELLAT
Ga0182032_1118863213300016357SoilGALRDIRDGHNLHGAPTRVYRLKAMQRSPKTGWTGLISFNDRCRDFGELREVILQARKLAVGDIEKHQRAVPTSELLAA
Ga0182040_1046746623300016387SoilLVGALRDIREGQNLHGAPTRVYLLKAMQRSPKTGWTGLISFNDRCRDFGELREVILQARKLAVGDIEKHQRAVPTSELLAA
Ga0182040_1103474513300016387SoilCLVGALRDIRDGHNLHGAPTRAYLLKAMQRSPKPGWTGLISLNDRCRDFGELHEVILQARKLAVADIEKHQRAVPTTELLAA
Ga0182037_1186545513300016404SoilHGAPTRVYLLKAMQRSPKTGWTGLISFNDRCRDFGELREVILQARKLAVGDIEKHQRAVPTSELLAA
Ga0187817_1112743623300017955Freshwater SedimentMLLSAVTSSGLKAMQRSPKTGWTGLISFNDRCRDFGELREVILQARKLAVADIEKHQRAVPTSELLAA
Ga0210399_1058336813300020581SoilAPTRVYLLRAMQRSPKTGWTGLISFNDRCRDFGELHEVILQARKLAVADTEKHKRPVPTSELLAA
Ga0210402_1010624543300021478SoilIKGKLDDGAGNRCLVGALRDIRDGHNLHGTPTRVYLLKAMQQSPKIGWTGLISFNDRCRDFGELREVILQARKLAVADIEKYQRDIPTSELLAA
Ga0209217_118171113300027651Forest SoilGNRCLVGALHDIRDGHNLHGAPTRIYLLKAMQRSPKTGWTGLISFNDRCRDFGELREVILQARLLAVADIEKHQRAVATSELLAA
Ga0209448_1009130713300027783Bog Forest SoilGNRCLVGALRDIRDGHNLYGAPTRVYLLKAMQRSPKTGWTGLISFNDRCRDFGELREVILQARKLAVADIEKHQRAVPASELLAA
Ga0222749_1044207713300029636SoilRCLVGALRDIRDGHNLHGAPTRVYLLKAMQRSPKTGWTGLISFNDRCRDFGELREVILQARKLAVADIEKHQRAVATSELLAA
Ga0318516_1064221023300031543SoilLHGAPTRVYLLKAMQRSPKTGWTGLISFNDRCRDFGELREVILQARNLAVADIEKHQRAVPTSELLAA
Ga0318516_1085028713300031543SoilNRCLVGALRDIRDGHNLHGAPTRAYLLKAMQRSPKPGWTGLISFNDRCRDFGELHEVILQARKLAVADIEKHQRAVPTTELLAA
Ga0318541_1011344533300031545SoilMPRDAHSAAKAVDLRDIRDGHNLHGAPTRVYLLKAMQRSPKTGWTGLISFNDRCRDFGELHEVILQARKLAVADIEKRQRAIPTNELLAA
Ga0318538_1044831023300031546SoilGHNLHGAPTRVYLLKAMQRSPKTGWTGLISFNDRCRDFGELREVILQARKLAVREIEKHQRAVPTSELLAT
Ga0318528_1072060113300031561SoilDGHNLHGAPTRVYLLKAMQRSPKTGWTGLISFNDRCRDFGELHEVILQARKLAVADTEKHKRAVPISELLAV
Ga0318515_1071392913300031572SoilAMRRSPKTGWTGLISFNDRCRDFGELHEVILQARKLAVADIEKHQRAVPTSELLAA
Ga0310915_1022960423300031573SoilNRCLVGALRDIRDGHNLHGAPTRVYLLKAMQRSPKTGWTGLISFNDRCRDFGELHEVILQARKLAVADTEKHKRAVPTSELLAA
Ga0318542_1031834523300031668SoilMQRSPKAGWTGLISFNDRCRDFGELREVILQARKLAVADIEKHQRDVPTSQLLAA
Ga0318574_1085774813300031680SoilTRLYLLKAMQRSQKTGWTGLISFNDRCRDFGELREVILQARKLAVADIERHRRGGRTSELLAA
Ga0318572_1013199613300031681SoilLRDGHNLHSAPTRLYLLKAMQRSPKAGWTGLISFNDRCRDFGELREVILQARKLAVADIEKHQRDVPTSQLLAA
Ga0318560_1020359113300031682SoilNRCLVGALRDIREGQNLHGAPTRAYLLKAMRRSPKTGWTGLISFNDRCRDFGELHEVILQARKLAVADIEKHQRAVPTIELLAA
Ga0306917_1007777943300031719SoilRVYLLKAMQRSPKTGWTGLISFNDRCRDFGELREVILQARKLAVGDIEKHQRAVPTSELLAA
Ga0306917_1016881033300031719SoilKAMQRSLKTGWTGLISFNDRCRDFGELREVILQARKLAVADIAKHQCAVPTSELLAA
Ga0318493_1010318533300031723SoilAEGMQRSPKAGWTGLISFNDRCRDFGELREVILQARKLAVADIEKHQRDVPTSQLLAA
Ga0306918_1034496323300031744SoilYLLKAMQRSPKTGWTGLISFNDRCRDFGELREVILQARKLAVGDIEKHQRAVPTSELLAA
Ga0306918_1053752913300031744SoilWIRGKLDDGAGNRCLVGALRDLRDGHNLHSAPTRLYLLKAMQRSPKAGWTGLISFNDRCRDFGELREVILQARKLAVADIEKHQRDVPTSQLLAA
Ga0307477_1013959163300031753Hardwood Forest SoilMQRSPKTGWTGLISFNDRCRDFGELREVILQARKLAIADIEKHQHAVPTGELLAA
Ga0318537_1023738313300031763SoilDGAGNRCLVGALRDIRDGHNLHGAPTRVYLLKAMQRSPKTGWTGLISFNDRCRDFGELREVILQARKLAVREIEKHQRAVPTSELLAT
Ga0318509_1056322913300031768SoilMQRSPKAVWTGLISFNDRCRDFGELREVILQARKLAVADIEKHQRDVPT
Ga0318509_1059460513300031768SoilPKAGWTGLISFNDRCRDFGELREVILQARKLAVADIEKHQRDVPTSQLLAA
Ga0318509_1063546613300031768SoilFGALRYIRDGHNLHGALTRLYLLKAMQRSPKTGWTGLISFNDRCRDFGELREVILQARKLAVADIERHQRGGRTSELLAA
Ga0318546_1032485613300031771SoilLHGAPTRVYLLKAMQRSPKTGWTGLISFNDRCRDFGELHEVILQARKLAVADIEKRQRAIPTNELLAA
Ga0318547_1054695313300031781SoilMQRSPKAVWTGLISFNDRCRDFGELREVILQARKLAVADIEKHQRDVPTSQLLAA
Ga0318576_1027062823300031796SoilLDDSAGNRCLVGALRDIRDGHNLHGAPTRVYRLKAMQRSPKTGWTGLISFNDRCRDFGELREVILQARKLAVGDIEKHQRAVPTSELLAA
Ga0318550_1021331923300031797SoilNRCLVGALRDIRDGHNLHGAPTRVYLLKAMQRSPKTGWTGLISFNDRCRDFGELHEVILQARKLAVADIKKHQRAIPTSELLAA
Ga0318550_1040644313300031797SoilSPKTGWTGLISFYDRSRDFGELREVILQARKLAVADIAKHQCAVPTSELLAA
Ga0318523_1066477323300031798SoilTRIYLLKAMQRSSKTGWTGLISFNDRCRDFGELREVILQARKLAVADIEKHQRAVPTTELLAA
Ga0318565_1062107823300031799SoilVYLLKAMQRSPKTGWTGLISFNDRCRDFGELHEVILQARKLAVADIEKHQRAVPTSELLA
Ga0318517_1054648423300031835SoilLHGAPTRVYLLKAMQRSPKTGWTGLISFNDRCRNFGELHEVILQARKLAVADIEKHQRAVPTSELLAA
Ga0318527_1007966213300031859SoilTRVYLLKAMQRSPKTGWTGLISFNDRCRDFGELREVIFQARNLAVADIEKHQRAVPTSELLAA
Ga0306919_1009766113300031879SoilDGAGNRCLVGALRDIRDGHNLHGAPTRVYLLKAMQRSSKPGWTGLISFNDRCRDFGELHEVILQARKLAVADIKKHQRAIPTSELLAA
Ga0306919_1026126213300031879SoilRDGHNIHGAPTRVYLLKAMQRSPKTGWTGLISFNDRCRDFGELREVILQARKLAVADIAKHQCAVPTSELLAA
Ga0318544_1023938013300031880SoilERWIRGKLDDGAGNRCLVGALRDLRDGHNLHSAPTRLYLLKAMQRSPKAGWTGLISFNDRCRDFGELREVILQARKLAVADIEKHQRDVPTSQLLAA
Ga0306925_1029816913300031890SoilAMQRSPKTGWTGLISFNDRCRDFGELRDVILQARKLAVADIEKHQRAVPTSELLAA
Ga0306925_1035003233300031890SoilLKAMQRSPKTGWTGLISFNDRCRDFGELREVILQARKLAVADIAKHQCAVPTSELLAA
Ga0306925_1065116433300031890SoilYLLKAMQRSPKTGWTGLISFNDRCRDFGELREVILQARKLAVREIEKHQRAVPTSELLAT
Ga0306925_1066088233300031890SoilDDSAGNRCLVGALRDIRDGHNLHGAPTRVYRLKAMQRSPKTGWTGLISFNDRCRDFGELREVILQARKLAVGDIEKHQRAVPTSELLAA
Ga0306925_1084461213300031890SoilTRVYLLKAMQRSPKTGWTGLISFNDRCRDFGELREVILQARKLAVGDIEKHQRAVPTNELLAA
Ga0306925_1206954213300031890SoilLVGALRDIRDGHNIHGAPTRVYLLKAMQGSPKTGWTGLISFYDRSRDFGELREVILQARKLAVADIAKHQCAVPTSELLAA
Ga0318536_1057157813300031893SoilCLVGTLRDIRDGHNLHGAPTRVYLLKAMQRSPKTGWTGLISFNDRCRDFGELHEVILQARKLAVADIKKHQRAIPTSELLAA
Ga0318551_1004754213300031896SoilAMQRSPTAGWTGLISFNDRCRDFGELREVILQARKLAVADIEKHQRDVPTSQLLAA
Ga0318551_1032680613300031896SoilRSPKTGWTGLISFNDRCRDFGELREVILQARNLAVADIEKHQRAVPTSELLAA
Ga0306923_1051052913300031910SoilAMQRSPKTGWTGLISFNDRCRDFGELREVILQARKLAVADIAKHQCAVPTSELLAA
Ga0306923_1066871023300031910SoilMQRSPKPGWTGLISFNDRCRDFGELHEVILQARKLAVADIEKHQRAVPTTELLAA
Ga0306923_1068323813300031910SoilNRCLVGALRDIRDGHNLHGAPTRVYLLKAMQRSPKTGWTGLISFNDRCRDFGELHEVILQARKLAVADIEKHQRAIPTGELLAA
Ga0306923_1097945813300031910SoilPTRVYLLKAMQRSPKTGWTGLISFNDRCRDFGELREVILQARKLAVADIQKHQRDVPTSELLAA
Ga0306923_1228892823300031910SoilIKGKLDDGAGNRCLVGALRDIRDGHNLHGAPTRVYLLKAMQRSPKTGWTGLISFNDRCRDFGELHEVILQARKLAVADTEKHKRAVPTSELLAA
Ga0306923_1247712523300031910SoilVYLLKAMQRSPKTGWTGLISFNDRCRNFGELHEVILQARKLAVADIEKHQRAVPTSELLA
Ga0306921_1018774513300031912SoilNLHGAPTRVYLLKAMQRSPKTGWTGLISFNDRCRDFGELREVILQARKLAVADIAKHQCAVPTSELLAA
Ga0306921_1130037723300031912SoilLSAKGDERSPKTGWTGLISFNDRCRDFGELREVILQARKLAVREIEKQQRAVPTSELLAA
Ga0310916_1041602213300031942SoilRVYLLKAMQRSPKTGWTGLISFNDRCRDFGELHEVILQARKLAVADIEKRQRAIPTNELLAA
Ga0310916_1083844713300031942SoilAMQGSPKTGWTGLISFYDRSRDFGELREVILQARKLAVADIAKHQCAVPTSELLAA
Ga0310913_1105807823300031945SoilQRSPKTGWTGLISFNDRCRDFGELREVILQARKLAVGDIEKHQRAVPTSELLAA
Ga0310910_1050358013300031946SoilTRVYLLKAMQRSPKTGWTGLISFNDRCRDFGELREVILQARKLTVADIEKHQRAVPTTELLAA
Ga0310910_1084243533300031946SoilGNRCLVGALRDIRDGHNLHGAPTRVYLLKAMQRSPKTGWTGLISFNDRCRDFGELREVILQARKLAVGDIEKHQRAVPTNELLAA
Ga0310910_1108910223300031946SoilIKGKLDDGAGDRCLVGALRDIRDGHNLHGAPTRVYLLKAMQRSPKTGWTGLISFNDRCRDFGELHEVILQARKLAVADIEKHQRAVPTTELLAA
Ga0310909_1020637623300031947SoilGKLDDSAGNRCLVGALRDIRDGHNLHGAPTRVYRLKAMQRSPKTGWTGLISFNDRCRDFGELREVILQARKLAVGDIEKHQRAVPTNELLAA
Ga0310909_1086603313300031947SoilGHHLHGAPTRVYLLKAMQRSPKTGWTGLISFNDRCRDFGELREVILQARKLTVADIEKHQRAVPTTELLAA
Ga0306926_1008851243300031954SoilTGWTGLISFNDRCRDFGELREVILQARKLAVADIAKHQCAVPTSELLAA
Ga0306926_1055582743300031954SoilMQRSSKTGWTGLISFNDRCRDFGELHEVILQARKLAVADIEKHQRAIPTGELLAA
Ga0307479_1058501323300031962Hardwood Forest SoilMQRSPKTGWTGLISFNDRCRDFGDLLEVILQARNLAVADIEKHQRAVSTSELLAA
Ga0307479_1100677223300031962Hardwood Forest SoilMQRSPKTGWTGLISFNDRCRDFGELREVILQARKLAIADIEKHQHAVPTSELLAA
Ga0307479_1140822313300031962Hardwood Forest SoilGHNLHGAPTRVYLLKAMQRSPKTGWTGLISFNDRCRDFGELHEVILQARKLAVADIEKHQRAIPTSELLAA
Ga0318531_1010288033300031981SoilAPTRLYLLKAMQRSPKAGWTGLISFNDRCRDFGELREVILQARKLAVADIEKHQRDVPTSQLLAA
Ga0318531_1029133833300031981SoilNRCLVGALRDIRDGHNLHGAPTRVYLLKAMQRSPKTGWTGLISFNDRCRDFGELHEVILQARKLAVADIEKRQRAIPTNELLAA
Ga0306922_1009248153300032001SoilSPKTGWTGLISFNDRCRDFGELREVILQARKLAVGDIEKHQRAVPTNELLAA
Ga0306922_1157104513300032001SoilLHGAPTRVYLLKAMQRSPKTGWTGLISFNDRCRDFGELHEVILQARKLAVADTEKHKRAVPTSELLAA
Ga0306922_1202912323300032001SoilERWIKGKLDDSAGNRCLVGALRDIRDGHNLHGAPTRVYRLKAMQRSPKTGWTGLISFNDRCRDFGELREVILQARKLAVGDIEKHQRAVPTSELLAA
Ga0318507_1015102213300032025SoilNRCLVGALRDIRDGHNLHGAPTRVYLLKAMQRSPKTGWTGLISFNDRCRDFGELREVILQARKLAVREIEKHQRAVPTSELLAT
Ga0310911_1040003613300032035SoilAGNRCLVGALRDLRDGHNLHSAPTRLYLLKAMQRSPKAGWTGLISFNDRCRDFGELREVILQARKLAVADIEKHQRDVPTSQLLAA
Ga0310911_1078911113300032035SoilPTRVYLLKAMQRSPKTGWTGLISFNDRCRDFGELHEVILQARKLAVADTEKHKRAVPTSELLAA
Ga0318559_1032773613300032039SoilGAGNRCLVGALRDIRDGHNLHGAPTRVYLLKAMQRSPKTGWTGLISFNDRCRDFGELREVILQARNLAVADIEKHQRAVPTSELLAA
Ga0318545_1024648213300032042SoilQRSPKTGWTGLISFNDRCRDFGELREVILQARKLAVGDIEKHQRAVPTNELLAA
Ga0318532_1024792413300032051SoilGKLDDGTGNRCLVGAMRDIRDGHNLHGAPTRVYLLKAMQRSPKTGWTGLISFNDRCRDFGELREVILQARNLAVADIEKHQRAVPTSELLAA
Ga0318570_1011324313300032054SoilYLLKAMQRSPKTGWTGLISFNDRCRDFGELREVILQARKLTVADIEKHQRAVPTTELLAA
Ga0318575_1070117413300032055SoilLVGALRDIRDGHNLHGAPTRVYLLKAMQRSSKPGWTGLISFNDRCRDFGELHEVILQARKLAVADIKKHQRAIPTSELLAA
Ga0318533_1043519313300032059SoilGAPTRAYLLKAMQRSPKPGWTGLISFNDRCRDFGELHEVILQARKLAVADIEKHQRAVPTTELLAA
Ga0318505_1031440413300032060SoilHNLHGAPTRLYLLKAMQRSPKAGWTGLISFNDRCRDFGELREVILQARKLAVADIEKHQRDVPTSQLLAA
Ga0318504_1054298213300032063SoilSKTGWTGLISFNDRCRDFGELREVILQARKLAVADIEKHQRAIPTTELLAA
Ga0306924_1008726813300032076SoilHGAPTRVYLLKAMQRSPKTGWTGLISFNDRCRDFGELHEVILQARKLAVADIEKRQRAIPTNELLAA
Ga0306920_10006687813300032261SoilDGHNLHGAPTRVYLLKAMQRSPKTGWTGLISFNDRCRDFGELREVILQARKLAVGDIEKHQRAVPTSELLAA
Ga0306920_10007520213300032261SoilLRDIRDGHNLHGAPTPIYLLKAMQRSPKTGWTGLISFNDRCRDFGELHEVILQARKLAVADIEKHQRAVPTTELLAA
Ga0306920_10093683813300032261SoilWIKGKLDDGAGNRCLVGALRDIRDGHNLHGAPTRVYLLKAMQRSPKTGWTGLISFNDRCRDFGELREVILQARKLAVREIEKHQRAVPTSELLAT
Ga0306920_10398403913300032261SoilSPKTGWTGLISFNDRCRDFGELREVILQARKLAVADIEKHQRAIPTTELLAA
Ga0310914_1019434213300033289SoilLDDGAGNHCLVGALREIRDGHNIHGAPTRVYLLKAMQRSPKTGWTGLISFNDRCRDFGELREVILQARKLAVADIAKHQCAVPTSELLAA
Ga0310914_1038769433300033289SoilSPKTGWTGLISFNDRCRDFGELHEVILQARKLAVADTEKHKRAVPISELLAV
Ga0310914_1051444713300033289SoilTRVYLLKAMQRSPKTGWTGLISFNDRCRDFGELHEVILQARKLAVADIKKHQRAIPTSELLAA
Ga0310914_1059397123300033289SoilEGQNLHGAPTRAYLLKAMRRSPKTGWTGLISFNDRCRDFGELHEVILQARKLAVADIEKHQRAVPTSELLAA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.