| Basic Information | |
|---|---|
| Family ID | F083860 |
| Family Type | Metagenome |
| Number of Sequences | 112 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MDRKQLMKTYVLFVAALGAAALAQSLRTLNLAHVDPLMLVILIGLAAAA |
| Number of Associated Samples | 81 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.11 % |
| % of genes from short scaffolds (< 2000 bps) | 71.43 % |
| Associated GOLD sequencing projects | 75 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.536 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (16.964 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.357 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (52.679 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.25% β-sheet: 0.00% Coil/Unstructured: 46.75% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF00082 | Peptidase_S8 | 80.36 |
| PF02729 | OTCace_N | 2.68 |
| PF01865 | PhoU_div | 2.68 |
| PF13487 | HD_5 | 0.89 |
| PF01061 | ABC2_membrane | 0.89 |
| PF01266 | DAO | 0.89 |
| PF13432 | TPR_16 | 0.89 |
| PF01384 | PHO4 | 0.89 |
| PF00005 | ABC_tran | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG1392 | Phosphate transport regulator YkaA, distantly related to PhoU, UPF0111/DUF47 family | Inorganic ion transport and metabolism [P] | 2.68 |
| COG0306 | Phosphate/sulfate permease | Inorganic ion transport and metabolism [P] | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.54 % |
| Unclassified | root | N/A | 4.46 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_109475906 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300002907|JGI25613J43889_10226383 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300005172|Ga0066683_10166527 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1357 | Open in IMG/M |
| 3300005180|Ga0066685_10070050 | All Organisms → cellular organisms → Bacteria | 2296 | Open in IMG/M |
| 3300005180|Ga0066685_10088832 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2050 | Open in IMG/M |
| 3300005180|Ga0066685_10621628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 743 | Open in IMG/M |
| 3300005330|Ga0070690_101394921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 564 | Open in IMG/M |
| 3300005336|Ga0070680_100965710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 735 | Open in IMG/M |
| 3300005445|Ga0070708_100969664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 797 | Open in IMG/M |
| 3300005445|Ga0070708_101624133 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 601 | Open in IMG/M |
| 3300005446|Ga0066686_10397751 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 941 | Open in IMG/M |
| 3300005458|Ga0070681_10278255 | All Organisms → cellular organisms → Bacteria | 1584 | Open in IMG/M |
| 3300005467|Ga0070706_100069181 | All Organisms → cellular organisms → Bacteria | 3265 | Open in IMG/M |
| 3300005467|Ga0070706_100166032 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2061 | Open in IMG/M |
| 3300005467|Ga0070706_100887797 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 824 | Open in IMG/M |
| 3300005468|Ga0070707_100485170 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1197 | Open in IMG/M |
| 3300005471|Ga0070698_101331299 | Not Available | 668 | Open in IMG/M |
| 3300005536|Ga0070697_100392485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1203 | Open in IMG/M |
| 3300005546|Ga0070696_100165750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1630 | Open in IMG/M |
| 3300005555|Ga0066692_10149200 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1434 | Open in IMG/M |
| 3300006845|Ga0075421_100003517 | All Organisms → cellular organisms → Bacteria | 18760 | Open in IMG/M |
| 3300006845|Ga0075421_100277280 | All Organisms → cellular organisms → Bacteria | 2046 | Open in IMG/M |
| 3300006847|Ga0075431_100008203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 10438 | Open in IMG/M |
| 3300006852|Ga0075433_10256979 | All Organisms → cellular organisms → Bacteria | 1549 | Open in IMG/M |
| 3300006852|Ga0075433_10343930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1318 | Open in IMG/M |
| 3300006852|Ga0075433_10656555 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 919 | Open in IMG/M |
| 3300006854|Ga0075425_101132404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 890 | Open in IMG/M |
| 3300006876|Ga0079217_10814167 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300006894|Ga0079215_10043521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1697 | Open in IMG/M |
| 3300006894|Ga0079215_10981511 | Not Available | 618 | Open in IMG/M |
| 3300006969|Ga0075419_10002822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 11132 | Open in IMG/M |
| 3300006969|Ga0075419_10082192 | All Organisms → cellular organisms → Bacteria | 2052 | Open in IMG/M |
| 3300007004|Ga0079218_10574289 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1021 | Open in IMG/M |
| 3300007255|Ga0099791_10010250 | All Organisms → cellular organisms → Bacteria | 3910 | Open in IMG/M |
| 3300007265|Ga0099794_10133829 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1253 | Open in IMG/M |
| 3300009012|Ga0066710_100109371 | All Organisms → cellular organisms → Bacteria | 3727 | Open in IMG/M |
| 3300009012|Ga0066710_100321160 | All Organisms → cellular organisms → Bacteria | 2277 | Open in IMG/M |
| 3300009012|Ga0066710_100390021 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2072 | Open in IMG/M |
| 3300009012|Ga0066710_102933441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 667 | Open in IMG/M |
| 3300009100|Ga0075418_10673106 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1115 | Open in IMG/M |
| 3300009147|Ga0114129_10063864 | All Organisms → cellular organisms → Bacteria | 5139 | Open in IMG/M |
| 3300009147|Ga0114129_10322962 | All Organisms → cellular organisms → Bacteria | 2052 | Open in IMG/M |
| 3300009147|Ga0114129_10326760 | All Organisms → cellular organisms → Bacteria | 2038 | Open in IMG/M |
| 3300009147|Ga0114129_10366221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1906 | Open in IMG/M |
| 3300009162|Ga0075423_10459873 | All Organisms → cellular organisms → Bacteria | 1338 | Open in IMG/M |
| 3300010336|Ga0134071_10438165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 669 | Open in IMG/M |
| 3300010399|Ga0134127_10355882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1432 | Open in IMG/M |
| 3300010399|Ga0134127_12013076 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300010399|Ga0134127_12717928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 575 | Open in IMG/M |
| 3300010399|Ga0134127_12832250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 564 | Open in IMG/M |
| 3300010403|Ga0134123_12818057 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 555 | Open in IMG/M |
| 3300012189|Ga0137388_10984791 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 778 | Open in IMG/M |
| 3300012203|Ga0137399_10707127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 848 | Open in IMG/M |
| 3300012204|Ga0137374_10077691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 3234 | Open in IMG/M |
| 3300012208|Ga0137376_10142651 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2056 | Open in IMG/M |
| 3300012211|Ga0137377_10017083 | All Organisms → cellular organisms → Bacteria | 6313 | Open in IMG/M |
| 3300012211|Ga0137377_10620137 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1018 | Open in IMG/M |
| 3300012351|Ga0137386_10559816 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 823 | Open in IMG/M |
| 3300012353|Ga0137367_10792461 | Not Available | 658 | Open in IMG/M |
| 3300012355|Ga0137369_10738644 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300012360|Ga0137375_10516549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1013 | Open in IMG/M |
| 3300012532|Ga0137373_10034302 | All Organisms → cellular organisms → Bacteria | 4888 | Open in IMG/M |
| 3300012685|Ga0137397_10170554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1616 | Open in IMG/M |
| 3300015245|Ga0137409_10354174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1279 | Open in IMG/M |
| 3300015358|Ga0134089_10371927 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 606 | Open in IMG/M |
| 3300017997|Ga0184610_1243359 | Not Available | 599 | Open in IMG/M |
| 3300018027|Ga0184605_10128045 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1134 | Open in IMG/M |
| 3300018028|Ga0184608_10393374 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300018052|Ga0184638_1242720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 623 | Open in IMG/M |
| 3300018071|Ga0184618_10068586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1332 | Open in IMG/M |
| 3300018072|Ga0184635_10390652 | Not Available | 528 | Open in IMG/M |
| 3300018076|Ga0184609_10166752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1018 | Open in IMG/M |
| 3300018076|Ga0184609_10280982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 779 | Open in IMG/M |
| 3300018078|Ga0184612_10370058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 724 | Open in IMG/M |
| 3300022694|Ga0222623_10027033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 2164 | Open in IMG/M |
| 3300022694|Ga0222623_10161008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 873 | Open in IMG/M |
| 3300022694|Ga0222623_10166339 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 858 | Open in IMG/M |
| 3300025167|Ga0209642_10312983 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 891 | Open in IMG/M |
| 3300025904|Ga0207647_10516849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 665 | Open in IMG/M |
| 3300025907|Ga0207645_10820423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 632 | Open in IMG/M |
| 3300025910|Ga0207684_10710449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 854 | Open in IMG/M |
| 3300025917|Ga0207660_10063773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2658 | Open in IMG/M |
| 3300025917|Ga0207660_10827874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 755 | Open in IMG/M |
| 3300025923|Ga0207681_11379635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 592 | Open in IMG/M |
| 3300025934|Ga0207686_10262318 | All Organisms → cellular organisms → Bacteria | 1267 | Open in IMG/M |
| 3300025938|Ga0207704_10582056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 914 | Open in IMG/M |
| 3300025960|Ga0207651_10353332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1238 | Open in IMG/M |
| 3300026075|Ga0207708_10751906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 837 | Open in IMG/M |
| 3300026323|Ga0209472_1038457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2130 | Open in IMG/M |
| 3300026324|Ga0209470_1000848 | All Organisms → cellular organisms → Bacteria | 23844 | Open in IMG/M |
| 3300026324|Ga0209470_1047217 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2096 | Open in IMG/M |
| 3300026343|Ga0209159_1051230 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2028 | Open in IMG/M |
| 3300026540|Ga0209376_1200317 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 908 | Open in IMG/M |
| 3300027695|Ga0209966_1065744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 789 | Open in IMG/M |
| 3300027873|Ga0209814_10215767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 830 | Open in IMG/M |
| 3300027875|Ga0209283_10021690 | All Organisms → cellular organisms → Bacteria | 3944 | Open in IMG/M |
| 3300027875|Ga0209283_10117872 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1747 | Open in IMG/M |
| 3300027880|Ga0209481_10043699 | All Organisms → cellular organisms → Bacteria | 2060 | Open in IMG/M |
| 3300027886|Ga0209486_10041269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2272 | Open in IMG/M |
| 3300027886|Ga0209486_10162610 | All Organisms → cellular organisms → Bacteria | 1238 | Open in IMG/M |
| 3300027886|Ga0209486_10542558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 729 | Open in IMG/M |
| 3300027909|Ga0209382_10021960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7734 | Open in IMG/M |
| 3300027909|Ga0209382_10333929 | All Organisms → cellular organisms → Bacteria | 1702 | Open in IMG/M |
| 3300028796|Ga0307287_10088284 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1166 | Open in IMG/M |
| 3300028819|Ga0307296_10268569 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 929 | Open in IMG/M |
| 3300028828|Ga0307312_10294875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1055 | Open in IMG/M |
| 3300028828|Ga0307312_10306093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1035 | Open in IMG/M |
| 3300028881|Ga0307277_10048989 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1719 | Open in IMG/M |
| 3300028884|Ga0307308_10267021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 820 | Open in IMG/M |
| 3300032180|Ga0307471_102418096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 664 | Open in IMG/M |
| 3300033233|Ga0334722_10004961 | All Organisms → cellular organisms → Bacteria | 13623 | Open in IMG/M |
| 3300033233|Ga0334722_10046677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 3446 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 16.96% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.71% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.82% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 8.04% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 6.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.36% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.46% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.46% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.57% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.68% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.79% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.79% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.89% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.89% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300025167 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1094759062 | 3300000956 | Soil | MRQGLRPYVLFVAALGGAAVAQSLRTLSFERVDPLMLAILIGLAAAAQRMPVFLFRSS |
| JGI25613J43889_102263832 | 3300002907 | Grasslands Soil | MRQGLRIYVLFVAALGAAALAQSLRTISLSHVDPLMLLILVALAAAAQRMPVFLFRSS |
| Ga0066683_101665272 | 3300005172 | Soil | MRQGLRAYVLFVAALGALALAQSLRTLSLAHVDPLMLVILV |
| Ga0066685_100700503 | 3300005180 | Soil | MDRTQLMKTYVLFVAALGALALAQSLRTLSLAHVDPLMLAILVALAAAAQ |
| Ga0066685_100888323 | 3300005180 | Soil | MRQGLRAYVLFVAALGALALAQSLRTLSLAHVDPLMLAILVALAAAAQ |
| Ga0066685_106216281 | 3300005180 | Soil | MDRKQLMKTYVLFVAALGALALAQSLRTLSLAHVDPLMLAILIGLAAAAQ |
| Ga0070690_1013949212 | 3300005330 | Switchgrass Rhizosphere | MDRKQLMKTYVLFVAALGAAALAQSLRTLNLAHVDPLMLV |
| Ga0070680_1009657102 | 3300005336 | Corn Rhizosphere | MDRKQLMKTYVLFVAALGAAALAQSLRTLNLAHVDPLMLVILIGL |
| Ga0070708_1009696641 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MDRKQLMKTYVLFVAGLGALALAQSLRTLSLVHVDPLMLAILIALAAAAQ |
| Ga0070708_1016241331 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQGLGLYVLFVAGLGALALAQSLRTLSLVHVDPLMLAILIALAAA |
| Ga0066686_103977511 | 3300005446 | Soil | MRQGLRVYVLFVAALGALALAQSLRTLSLAHVDPLMLAILIGLAAAAQ |
| Ga0070681_102782551 | 3300005458 | Corn Rhizosphere | MRQGVRVYVLFVAALGAAALAQSLRTLNLAHVDPLMLVILIGLAAAAQRMPV |
| Ga0070706_1000691814 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MDRKQLLKTYVLFVAALGALALAQSLRTLSLVHVDPLMLAILIALAAAAQ |
| Ga0070706_1001660323 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQGLRFYVLFVAALGALALAQSLRTLSLVHVDPLMLAILIALAAAAQ |
| Ga0070706_1008877972 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQELRFYVLFVAALGAAALAQSLRTVSLAHVDPLMLAILIGLAAAAQR |
| Ga0070707_1004851701 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQGLRLYVLFVAGLGALALAQSLRTLSLVHVDPLMLAILIALAAAAQ |
| Ga0070698_1013312992 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSGLRVYVLFVAALGAAALAQSLRTLNLSHVDPLMLVILIALA |
| Ga0070697_1003924851 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MDRKQLIKTYVLFVAALGAAALAQSLRTLNLSHVDPLMLVILIALAAAA |
| Ga0070696_1001657502 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MDRKQLMKTYVLFVAALGAAALAQSLRTLNLAHVDPLMLVILIGLAAAAQRMPVFL |
| Ga0066692_101492002 | 3300005555 | Soil | MRQGLRAYVLFVAALGALALAQSLRTLSLAHVDPLMLAILVALA |
| Ga0075421_10000351723 | 3300006845 | Populus Rhizosphere | MDRKQLVKTYILFVAALGAAALAQSLRTVSFDRVDPLMLVILIGLAAAA |
| Ga0075421_1002772803 | 3300006845 | Populus Rhizosphere | MRQELRLYILFVAALGAAALAQSLRTVSFDRVDPLMLVILIGLAAAA |
| Ga0075431_1000082031 | 3300006847 | Populus Rhizosphere | MDRKQLVKTYILFVAALGAAALAQSLRTVSFDRVDPLMLVILIGL |
| Ga0075433_102569791 | 3300006852 | Populus Rhizosphere | MTTALRFYVLFVAALGAAALAQSLRTLNLAHVDPLMLVILIALAAAA |
| Ga0075433_103439301 | 3300006852 | Populus Rhizosphere | MDRKQLIKAYVLFVAALGAAALAQSLRTLNLAHVDPLMLVILIALAAAA |
| Ga0075433_106565552 | 3300006852 | Populus Rhizosphere | MRQGLRLYVLFVAGLGALALAQSLRTLSLVHVDPLMLAILIALAAAAQR |
| Ga0075425_1011324042 | 3300006854 | Populus Rhizosphere | MDRKQLMKTYVLFVAGLGALALAQSLRTLSLVHVDPLMLAILIA |
| Ga0079217_108141671 | 3300006876 | Agricultural Soil | MRQGLRFYVLFVAALGAAALAQSLRTVSFDRVDPLMLAILIGLAAAAQRMPVFLFCSSAI |
| Ga0079215_100435212 | 3300006894 | Agricultural Soil | MDRTQLMKTYVLFVAALGAAALAQSLRTVSFERVDPLMLAILIGLAAAAQ |
| Ga0079215_109815112 | 3300006894 | Agricultural Soil | MRQELRFYVLFVAALGAAALSQSLRTVCFERVDPLMLAILIGLAAAAQRMPVFLFR |
| Ga0075419_100028221 | 3300006969 | Populus Rhizosphere | MDRKQLVKTYILFVAALGAAALAQSLRTVSFDRVDPLMLVILIGLAAAAQ |
| Ga0075419_100821923 | 3300006969 | Populus Rhizosphere | MRQELRLYILFVAALGAAALAQSLRTVSFDRVDPLMLVILIGLAAAAQ |
| Ga0079218_105742892 | 3300007004 | Agricultural Soil | MRQELRFYVLFVAALGAAALAQSLRTVSFDRVDPFMLAILIGLAAAAQ |
| Ga0099791_100102505 | 3300007255 | Vadose Zone Soil | MDRKQLMKTYVLFVAGLGAVALAQSLRTLSLVHVDPLMLAILIALAA |
| Ga0099794_101338291 | 3300007265 | Vadose Zone Soil | VLFVAGLGAVALAQSLRTLSLVHVDPLMLAILIALAAA |
| Ga0066710_1001093711 | 3300009012 | Grasslands Soil | MDRKQLMKTYVLFVAALGALALAQSLRTLSLVHVDPLMLAILIGLAAAAQ |
| Ga0066710_1003211601 | 3300009012 | Grasslands Soil | MDRTQLMKTYVLFVAALGALALAQSLRTLSLAHVDPLMLAILVALAAAAQR |
| Ga0066710_1003900211 | 3300009012 | Grasslands Soil | MRQGLRVYVLFVAALGALALAQSLRTLSLAHVDPLMLAILIGLAAAAQR |
| Ga0066710_1029334411 | 3300009012 | Grasslands Soil | MDRKQLMKTYVLFVAALGALALAQSLRTLSLAHVDPLMLAILIGLAAAAQR |
| Ga0075418_106731061 | 3300009100 | Populus Rhizosphere | LYILFVAALGAAALAQSLRTVSFDRVDPLMLVILI |
| Ga0114129_100638646 | 3300009147 | Populus Rhizosphere | MDRKQLIKAYVLFVAALGAAALAQSLRTLNLAHVDPLMLVILIALAAAAQ |
| Ga0114129_103229623 | 3300009147 | Populus Rhizosphere | LYILFVAALGAAALAQSLRTVSFDRVDPLMLVILIGLAAAAQ |
| Ga0114129_103267603 | 3300009147 | Populus Rhizosphere | MTTALRFYVLFVAALGAAALAQSLRTLNLAHVDPLMLVILIALAAAAQ |
| Ga0114129_103662212 | 3300009147 | Populus Rhizosphere | MDRKQLMKTYVLFVAGLGALALAQSLRTLSLVHVDPLMLAILIALAAAAQR |
| Ga0075423_104598732 | 3300009162 | Populus Rhizosphere | MTTALRFYVLFVAALGAAALAQSLRTLNLAHVDPLMLVILIALA |
| Ga0134071_104381652 | 3300010336 | Grasslands Soil | MDRKQLMQTYVLFVAALGALALAQSLRTLSLTHVDPLMLAILIALAAAA |
| Ga0134127_103558822 | 3300010399 | Terrestrial Soil | MDRKQLMKTYVLFVAALGAAALAQSLRTLNLAHVDPLMLVILIGLAA |
| Ga0134127_120130761 | 3300010399 | Terrestrial Soil | MRQELRFYVLFVAALGAAALAQSLRTVSLAHVDPLMLAILIGLAAAAQRMPVFLFRS |
| Ga0134127_127179281 | 3300010399 | Terrestrial Soil | MDRKQLMKTYVLFVAALGAAALAQSLRTLNLAHVDPLMLVI |
| Ga0134127_128322501 | 3300010399 | Terrestrial Soil | MDRKQLMKTYVLFVAALGAAALAQSLRTLNLAHVDPL |
| Ga0134123_128180571 | 3300010403 | Terrestrial Soil | MTSGLRVYVLFVAALGAAALAQSLRTLNLAHVDPLMLVILI |
| Ga0137388_109847911 | 3300012189 | Vadose Zone Soil | VRQGLRLYVLFVAGLGAVALAQSLRTLSLVHVDPL |
| Ga0137399_107071272 | 3300012203 | Vadose Zone Soil | MDRKQLVKIFVLFVAALGAAALAQSLRTLSLERVDPLMLVILVGLAAAAQRM |
| Ga0137374_100776913 | 3300012204 | Vadose Zone Soil | MTSGLRIYVLFVAALGAAALAQSLRTLSLAHVDPLMLVILIG |
| Ga0137376_101426511 | 3300012208 | Vadose Zone Soil | MRQGLRAYVLFVAALGALALAQSLRTLSLAHVDPLMLAILVALAAAAQR |
| Ga0137377_100170838 | 3300012211 | Vadose Zone Soil | MDRTQLMKTYVLFVAALGALALAQSLRTLSLAHVDP |
| Ga0137377_106201371 | 3300012211 | Vadose Zone Soil | VTNGLRVYVLFVAALGALALAQSLRTLSLAHVDPLMLAIL |
| Ga0137386_105598162 | 3300012351 | Vadose Zone Soil | MRQGLRVYVLFVAALGALALAQSLRTLSLAHVDPL |
| Ga0137367_107924612 | 3300012353 | Vadose Zone Soil | MDRKQLVKTYVLFVAALGAAALAQSLRTLSLERVDPLML |
| Ga0137369_107386441 | 3300012355 | Vadose Zone Soil | MRLGLRIYVLFIAALGAAALAQSLRTLSLAHVDPLMLVI |
| Ga0137375_105165491 | 3300012360 | Vadose Zone Soil | MDRKQLVKTYVLFVATLGAAALAQSLRTLSLERVDPLMLAILI |
| Ga0137373_100343025 | 3300012532 | Vadose Zone Soil | MERKQLMKTYVLFVAALGAAALAQSLRTLSLAHVDPLMLVILI |
| Ga0137397_101705541 | 3300012685 | Vadose Zone Soil | MERKQLMKNYVLFVAALGAAALAQSLRTVSLEHVDPLMLLILVALAAAAQRMPVFLF |
| Ga0137409_103541741 | 3300015245 | Vadose Zone Soil | MDRTQLMKTYVLFVAALGALALAQFLRTLSLAHVVPL |
| Ga0134089_103719272 | 3300015358 | Grasslands Soil | MRQGLRVYVLFVAALGALALAQSLRTLSLAHVDPLMLAILIGL |
| Ga0184610_12433592 | 3300017997 | Groundwater Sediment | MDREQLVKIYVLFVAALGAAALAQSLRTLNLAHVDPLMLVILIALAAAAQR |
| Ga0184605_101280451 | 3300018027 | Groundwater Sediment | MRQGLRFYVLFVAALGAAALAQSLRTVSFERVDPLMLAILIG |
| Ga0184608_103933742 | 3300018028 | Groundwater Sediment | MRQGLRVYVLFVAALGAAALAQSLRTLNLAHVDPLMLVILISLAAAAQRMPVFLFR |
| Ga0184638_12427202 | 3300018052 | Groundwater Sediment | MDRKQLIKTYVLFVAALGAAALAQSLRTLNLAHVDPLMLVILIALAAAAQR |
| Ga0184618_100685862 | 3300018071 | Groundwater Sediment | MERKQVMKTYVLFVAALGAAALAQSLRTLNLAHVDPLMLVILI |
| Ga0184635_103906521 | 3300018072 | Groundwater Sediment | MTSGLRFYVLFVAALGAAALAQSLRTLNLAHVDPLMLVILIALAAAAQRMP |
| Ga0184609_101667521 | 3300018076 | Groundwater Sediment | VDRKQLIKTYVLFVAALGAAALAQSLRTLNLAHVDP |
| Ga0184609_102809822 | 3300018076 | Groundwater Sediment | MERQQLMKTYVLFVAALGAAALAQSLRTLNLAHVDPLMLAILIGLA |
| Ga0184612_103700582 | 3300018078 | Groundwater Sediment | VDRKQLIKTYVLFVAALGAAALAQSLRTVSLERVDPLMLAILIGLAA |
| Ga0222623_100270332 | 3300022694 | Groundwater Sediment | MERQQLMKTYVLFVAALGAAALAQSLRTLNLATSTR |
| Ga0222623_101610082 | 3300022694 | Groundwater Sediment | MERKQLMKTYVLFVAALGAAALAQSLRTVSLEGVDPLMLAILIGLAAAA |
| Ga0222623_101663391 | 3300022694 | Groundwater Sediment | MTSGLRIYVLFVAALGAAALAQSLRTLNLSHVDPLMLVILI |
| Ga0209642_103129832 | 3300025167 | Soil | MRQGLRFYVLFIAALGAAALAQSLRTVSFERVDPLMLAIL |
| Ga0207647_105168492 | 3300025904 | Corn Rhizosphere | MDRKQLMKTYVLFVAALGAAALAQSLRTLNLAHVDPLMLVILIALAAAAQ |
| Ga0207645_108204231 | 3300025907 | Miscanthus Rhizosphere | MDRKQLMKTYVLFVAALGAAALAQSLRTLNLAHVDPLML |
| Ga0207684_107104491 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MDRKQLMKTYVLFVAGLGALALAQSLRTLSLVHVDPLMLAILI |
| Ga0207660_100637731 | 3300025917 | Corn Rhizosphere | MRQGVRVYVLFVAALGAAALAQSLRTLNLAHVDPLMLVIL |
| Ga0207660_108278741 | 3300025917 | Corn Rhizosphere | MDRKQLMKTYVLFVAALGAAALAQSLRTLNLAHVDPLMLVILIGLAAAA |
| Ga0207681_113796352 | 3300025923 | Switchgrass Rhizosphere | MDRKQLMKTYVLFVAALGAAALAQSLRTLNLAHVDPLMLVILIALAAAAQRMPVFLFR |
| Ga0207686_102623181 | 3300025934 | Miscanthus Rhizosphere | MTSGLRVYVLFVAALGAAALAQSLRTLNLAHVDPLM |
| Ga0207704_105820562 | 3300025938 | Miscanthus Rhizosphere | MDRKQLMKTYVLFVAALGAAALAQSLRTLNLAHVDP |
| Ga0207651_103533321 | 3300025960 | Switchgrass Rhizosphere | MDRKQLMKTYVLFVAALGAAALAQSLRTLNLAHVD |
| Ga0207708_107519062 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MDRKQLMKTYVLFVAALGAAALAQSLRTLNLAHVDPLMLVIL |
| Ga0209472_10384573 | 3300026323 | Soil | MDRTQLMKTYVLFVAALGALALAQSLRTLSLAHVDPLMLAILVALAAAAQRM |
| Ga0209470_10008481 | 3300026324 | Soil | MDRKQLMKTYVLFVAALGALALAQSLRTLSLAHVDPLMLAILIGLAAAAQRM |
| Ga0209470_10472171 | 3300026324 | Soil | MRQGLRVYVLFVAALGALALAQSLRTLSLAHVDPLMLAILIGLAAAAQRM |
| Ga0209159_10512301 | 3300026343 | Soil | MRQGLRAYVLFVAALGALALAQSLRTLSLAHVDPLMLA |
| Ga0209376_12003171 | 3300026540 | Soil | MRQGLRAYVLFVAALGALALAQSLRTLSLAHVDPLMLAILVALAAAAQRM |
| Ga0209966_10657441 | 3300027695 | Arabidopsis Thaliana Rhizosphere | MDRKQLMKTYVLFVAALGAAALAQSLRTLNLAHVDPLMLVILIGLA |
| Ga0209814_102157672 | 3300027873 | Populus Rhizosphere | MDRKQLVKTYILFVAALGAAALAQSLRTVSFDRVDPLMLVI |
| Ga0209283_100216905 | 3300027875 | Vadose Zone Soil | MDRKTLIKTYVLFVAGLGAVALAQSLRTLSLVHVD |
| Ga0209283_101178722 | 3300027875 | Vadose Zone Soil | VRQGLRLYVLFVAGLGAVALAQSLRTLSLVHVDPLMLAILIALAAA |
| Ga0209481_100436993 | 3300027880 | Populus Rhizosphere | MRQELRLYILFVAALGAAALAQSLRTVSFDRVDPLMLVILIGLAAAAQR |
| Ga0209486_100412691 | 3300027886 | Agricultural Soil | MDRTQLMKTYVLFVAALGAAALAQSLRTVSFERVDPLMLAILIGLAAAAQR |
| Ga0209486_101626101 | 3300027886 | Agricultural Soil | MRQELRFYVLFVAALGAAALAQSLRTVSFERVDPLMLAILIGLAAAAQR |
| Ga0209486_105425581 | 3300027886 | Agricultural Soil | MDRKQLVKTYVLFVAALGAAALAQSLRTVSLERVDPLMLAILIGLAAAAQR |
| Ga0209382_100219601 | 3300027909 | Populus Rhizosphere | MDRKQLVKTYILFVAALGAAALAQSLRTVSFDRVDPLMLVIL |
| Ga0209382_103339291 | 3300027909 | Populus Rhizosphere | MRQELRLYILFVAALGAAALAQSLRTVSFDRVDPLMLVILI |
| Ga0307287_100882841 | 3300028796 | Soil | MRQGLRVYVLFVAALGAAALAQSLRTLNLAHVDPLMLVILISLAAAAQR |
| Ga0307296_102685692 | 3300028819 | Soil | VYVLFVAALGAAALAQSLRTLNLSHVDPLMLVILIGLAAAA |
| Ga0307312_102948752 | 3300028828 | Soil | MERKQVMKTYVLFVAALGAAALAQSLRTLNLAHVDPLM |
| Ga0307312_103060932 | 3300028828 | Soil | MDRKQLVKTYVLFVAALGAAALAQSLRTLNLSHVDPLMLVILIGLAAAAQR |
| Ga0307277_100489891 | 3300028881 | Soil | MRQGLRFYVLFIAALGAAALAQSLRTVSFERVDPLMLAILIGLAAAAQRI |
| Ga0307308_102670212 | 3300028884 | Soil | MDRKQLVKTYVLFVAALGAAALAQSLRTLNLSHVDPLMLVILIGLAA |
| Ga0307471_1024180962 | 3300032180 | Hardwood Forest Soil | MDRKQLMKTYVLFVAALGAAALAQSLRTLSLSHVDPLMLVILI |
| Ga0334722_1000496117 | 3300033233 | Sediment | VKLGQYVLTVAALGAVVLAQSARSVSFDGVDPLMLAI |
| Ga0334722_100466774 | 3300033233 | Sediment | MGKDQDEKGQREVNRLQLYVLTVAALGAVVLAQSARSVSFDGVDPLMLAILIG |
| ⦗Top⦘ |