| Basic Information | |
|---|---|
| Family ID | F083857 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 112 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MAQLGQFALALAFVVTAYSIVASLVGIRFKNDKLIASGRNA |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 97.32 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (80.357 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil (12.500 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.214 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.643 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.52% β-sheet: 0.00% Coil/Unstructured: 43.48% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF03100 | CcmE | 88.39 |
| PF00676 | E1_dh | 2.68 |
| PF13462 | Thioredoxin_4 | 2.68 |
| PF07884 | VKOR | 0.89 |
| PF16694 | Cytochrome_P460 | 0.89 |
| PF14489 | QueF | 0.89 |
| PF08281 | Sigma70_r4_2 | 0.89 |
| PF00155 | Aminotran_1_2 | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG2332 | Cytochrome c biogenesis protein CcmE | Posttranslational modification, protein turnover, chaperones [O] | 88.39 |
| COG0567 | 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes | Energy production and conversion [C] | 2.68 |
| COG1071 | TPP-dependent pyruvate or acetoin dehydrogenase subunit alpha | Energy production and conversion [C] | 2.68 |
| COG4243 | Vitamin K epoxide reductase (VKOR) family protein, predicted involvement in disulfide bond formation | General function prediction only [R] | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.36 % |
| Unclassified | root | N/A | 19.64 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000787|JGI11643J11755_11307939 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300000789|JGI1027J11758_12788165 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1224 | Open in IMG/M |
| 3300000956|JGI10216J12902_120850426 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
| 3300002558|JGI25385J37094_10097946 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 875 | Open in IMG/M |
| 3300004463|Ga0063356_102048087 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300005332|Ga0066388_104273469 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300005332|Ga0066388_108595033 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300005347|Ga0070668_102148459 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300005354|Ga0070675_100690376 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300005447|Ga0066689_10510825 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
| 3300005459|Ga0068867_100177949 | All Organisms → cellular organisms → Bacteria | 1689 | Open in IMG/M |
| 3300005554|Ga0066661_10315229 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300005559|Ga0066700_10885789 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300005578|Ga0068854_102273543 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300005713|Ga0066905_100124287 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1807 | Open in IMG/M |
| 3300005719|Ga0068861_102137810 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300005764|Ga0066903_103511173 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300005834|Ga0068851_10953348 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300006032|Ga0066696_10573768 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300006845|Ga0075421_100364046 | All Organisms → cellular organisms → Bacteria | 1744 | Open in IMG/M |
| 3300006852|Ga0075433_11865589 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300006854|Ga0075425_102284496 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300006937|Ga0081243_1369351 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300009233|Ga0103856_10105431 | Not Available | 537 | Open in IMG/M |
| 3300009249|Ga0103862_1048169 | Not Available | 595 | Open in IMG/M |
| 3300009553|Ga0105249_12026013 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300009597|Ga0105259_1114652 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
| 3300010043|Ga0126380_10149225 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium RIFCSPLOWO2_12_FULL_68_9 | 1494 | Open in IMG/M |
| 3300010114|Ga0127460_1042533 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300010124|Ga0127498_1110833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300010358|Ga0126370_11121603 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 726 | Open in IMG/M |
| 3300010361|Ga0126378_13155152 | Not Available | 524 | Open in IMG/M |
| 3300010376|Ga0126381_100555975 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1627 | Open in IMG/M |
| 3300010398|Ga0126383_12740059 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300010399|Ga0134127_11288919 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 799 | Open in IMG/M |
| 3300010399|Ga0134127_12236273 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300010400|Ga0134122_10293789 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1392 | Open in IMG/M |
| 3300010401|Ga0134121_13078922 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300010403|Ga0134123_10987049 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300010403|Ga0134123_11060956 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 831 | Open in IMG/M |
| 3300010895|Ga0138113_180862 | Not Available | 568 | Open in IMG/M |
| 3300011119|Ga0105246_10193212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1577 | Open in IMG/M |
| 3300011119|Ga0105246_10400844 | Not Available | 1139 | Open in IMG/M |
| 3300011120|Ga0150983_11150957 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300012199|Ga0137383_10033856 | All Organisms → cellular organisms → Bacteria | 3603 | Open in IMG/M |
| 3300012201|Ga0137365_10742134 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 717 | Open in IMG/M |
| 3300012212|Ga0150985_109375800 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300012212|Ga0150985_110887181 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300012372|Ga0134037_1070346 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300012379|Ga0134058_1256864 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300012382|Ga0134038_1144828 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300012384|Ga0134036_1067579 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300012385|Ga0134023_1109083 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300012390|Ga0134054_1131351 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300012391|Ga0134035_1149053 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300012395|Ga0134044_1172122 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
| 3300012396|Ga0134057_1328350 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300012397|Ga0134056_1128688 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| 3300012469|Ga0150984_113090227 | Not Available | 670 | Open in IMG/M |
| 3300012519|Ga0157352_1098583 | Not Available | 515 | Open in IMG/M |
| 3300012685|Ga0137397_10686245 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 761 | Open in IMG/M |
| 3300012948|Ga0126375_10416696 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 976 | Open in IMG/M |
| 3300012971|Ga0126369_12148724 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
| 3300014154|Ga0134075_10382246 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300014325|Ga0163163_10183681 | All Organisms → cellular organisms → Bacteria | 2139 | Open in IMG/M |
| 3300014325|Ga0163163_11282649 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 795 | Open in IMG/M |
| 3300015372|Ga0132256_102338712 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
| 3300015373|Ga0132257_102533959 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300015373|Ga0132257_102774916 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300015374|Ga0132255_104857661 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300015374|Ga0132255_105467699 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300016294|Ga0182041_11813777 | Not Available | 566 | Open in IMG/M |
| 3300018083|Ga0184628_10025043 | All Organisms → cellular organisms → Bacteria | 2957 | Open in IMG/M |
| 3300019263|Ga0184647_1176834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300019361|Ga0173482_10237528 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300020064|Ga0180107_1079573 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300020067|Ga0180109_1311072 | Not Available | 542 | Open in IMG/M |
| 3300021080|Ga0210382_10418005 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300021560|Ga0126371_11456371 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 814 | Open in IMG/M |
| 3300021560|Ga0126371_13361594 | Not Available | 540 | Open in IMG/M |
| 3300022195|Ga0222625_1801673 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300022722|Ga0242657_1252404 | Not Available | 506 | Open in IMG/M |
| 3300022724|Ga0242665_10297161 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300022726|Ga0242654_10217668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300022756|Ga0222622_10483538 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300025324|Ga0209640_11085527 | Not Available | 611 | Open in IMG/M |
| 3300025898|Ga0207692_10461718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 801 | Open in IMG/M |
| 3300025905|Ga0207685_10312191 | Not Available | 781 | Open in IMG/M |
| 3300025926|Ga0207659_10607424 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 933 | Open in IMG/M |
| 3300025935|Ga0207709_10967785 | Not Available | 694 | Open in IMG/M |
| 3300025960|Ga0207651_10339408 | All Organisms → cellular organisms → Bacteria | 1262 | Open in IMG/M |
| 3300026035|Ga0207703_10937562 | Not Available | 829 | Open in IMG/M |
| 3300026324|Ga0209470_1246410 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 719 | Open in IMG/M |
| 3300026332|Ga0209803_1254700 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300027909|Ga0209382_11057828 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 841 | Open in IMG/M |
| 3300031058|Ga0308189_10417210 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300031081|Ga0308185_1050623 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300031093|Ga0308197_10176637 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
| 3300031099|Ga0308181_1143102 | Not Available | 554 | Open in IMG/M |
| 3300031114|Ga0308187_10409509 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300031421|Ga0308194_10252350 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300031677|Ga0307480_1017671 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300032138|Ga0315338_1204277 | Not Available | 576 | Open in IMG/M |
| 3300032145|Ga0315304_1128249 | Not Available | 668 | Open in IMG/M |
| 3300032145|Ga0315304_1141529 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
| 3300034661|Ga0314782_139870 | Not Available | 584 | Open in IMG/M |
| 3300034664|Ga0314786_027661 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 955 | Open in IMG/M |
| 3300034665|Ga0314787_104668 | Not Available | 529 | Open in IMG/M |
| 3300034666|Ga0314788_172593 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300034666|Ga0314788_176924 | Not Available | 537 | Open in IMG/M |
| 3300034671|Ga0314796_156198 | Not Available | 537 | Open in IMG/M |
| 3300034676|Ga0314801_116771 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 12.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 6.25% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 5.36% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 4.46% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.57% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.57% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.57% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.68% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 1.79% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.79% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.79% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.79% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.79% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.89% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.89% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.89% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.89% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.89% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.89% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.89% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.89% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006937 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A01 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300009233 | Microbial communities of water from Amazon river, Brazil - RCM9 | Environmental | Open in IMG/M |
| 3300009249 | Microbial communities of water from Amazon river, Brazil - RCM15 | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009597 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT299 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010114 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010124 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010895 | Grasslands soil microbial communities from Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012372 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012379 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012382 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012384 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012385 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012390 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012391 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012395 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012396 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012397 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012519 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610 | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300019263 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300020064 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT27_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020067 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT47_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031081 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_159 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031099 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031677 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032138 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - ASW #8 | Environmental | Open in IMG/M |
| 3300032145 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_1000m_313 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034661 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034664 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034665 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034666 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034671 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034676 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11643J11755_113079393 | 3300000787 | Soil | MAQVGQFALALAFVVTAYSIAASLIGIRLKNDKLIASGRNAAVAAF |
| JGI1027J11758_127881651 | 3300000789 | Soil | MAAQIGQFALALAWVVTAYSVMASILGIRYKHDKLIAS |
| JGI10216J12902_1208504261 | 3300000956 | Soil | MAAQIGQFALALAWVVTAYSVLASSLGIRYKHDKLIASGRNAA |
| JGI25385J37094_100979461 | 3300002558 | Grasslands Soil | MAQLGQFALALAFVVTAYSIIASLIGIRLKHDNLIASGRNAA |
| Ga0063356_1020480873 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MAAQLGQFALALAWVTAAYSVVASLLGIRFKHDKLIASGRNA |
| Ga0066388_1042734692 | 3300005332 | Tropical Forest Soil | MAQVGQFALALAFVVSAYSVIASLVGIRLKNDKIIASGKHAAIATFLCVTL |
| Ga0066388_1085950331 | 3300005332 | Tropical Forest Soil | MVQVGQFALALAFVVTAYSIIASLVGIRLKNDKLIDSGKRAAIGTFICITLAI |
| Ga0070668_1021484592 | 3300005347 | Switchgrass Rhizosphere | MAQFGQFALAIAFIVAIYAIVASVIGIRSRNDKLIASGRNA |
| Ga0070675_1006903761 | 3300005354 | Miscanthus Rhizosphere | MAQVGQFALALAFVVTAYSIAASLIGIRLKNDKLIASGRN |
| Ga0066689_105108253 | 3300005447 | Soil | MAQIGQFALALAWVVTAYSIVASLLGIRLKHDNLIASGRNAA |
| Ga0068867_1001779494 | 3300005459 | Miscanthus Rhizosphere | MGQVGQFSLALAFVVTIYSIAASLLGIRIKNDRLIASGRNAAVAVF |
| Ga0066661_103152293 | 3300005554 | Soil | MAQLGQFALALAWVVTAYSIVASLLGIRLKHDNLIASG |
| Ga0066700_108857892 | 3300005559 | Soil | MAAQLGQFALAVAWVVTAYSVIASLLGIRLKNDKLIASGRNAALGAALC |
| Ga0068854_1022735431 | 3300005578 | Corn Rhizosphere | MAAQLGQFALALAWVTAAYSVVASLLGIRFKYDKLIASGRNAAIGTAVGITTAIACLGYL |
| Ga0066905_1001242871 | 3300005713 | Tropical Forest Soil | MAAQLGQFALALAWVVTAYSVVASILGIRLKHDKLIASGR |
| Ga0068861_1021378102 | 3300005719 | Switchgrass Rhizosphere | MAAQLGQFALALAWVVTAYSVVASVLGIRLKHDKLIASGRNA |
| Ga0066903_1035111731 | 3300005764 | Tropical Forest Soil | MAQVGQFALALAFVVTAYSIAASLIGIRLKNDKLIA |
| Ga0068851_109533482 | 3300005834 | Corn Rhizosphere | MGQVGQFALALAFVVTIYSIAASLLGIRIKNDKLIASGRNAAVAVFVLISTAIG |
| Ga0066696_105737681 | 3300006032 | Soil | MAAQLGQFALALAWVATAYSVVASILGIRFKHDKLIASGR |
| Ga0075421_1003640461 | 3300006845 | Populus Rhizosphere | MAQVGQFALALAFVVTVYSIAASLIGIRLKNDKLIASGR |
| Ga0075433_118655891 | 3300006852 | Populus Rhizosphere | MAQIGQFALALAFVVTVYSIVASIIGIRFKHDKLIASGR |
| Ga0075425_1022844961 | 3300006854 | Populus Rhizosphere | MAQVGQFALALAFVVSAYSVVASLIGIRIKNDKIIASGKHAAIATFLCIT |
| Ga0081243_13693511 | 3300006937 | Tropical Rainforest Soil | MAAQLGQFALALAWVVTAYSIVASILGIRLKHDKLIASGRNAA |
| Ga0103856_101054312 | 3300009233 | River Water | MAQFGQFALALAFVVTLYSIAASLIGIRFRNDKLIASGRNAAV |
| Ga0103862_10481691 | 3300009249 | River Water | MAQFGQFALALAFVVTLYSIAASLIGIRFRNDKLIASGRNAAVGNFLAISAAFATL |
| Ga0105249_120260131 | 3300009553 | Switchgrass Rhizosphere | MGQVGQFSLALAFVVTIYSIAASLLGIRIKNDRLIASGRN |
| Ga0105259_11146521 | 3300009597 | Soil | MAAQLGQFALALAWVVTVYSVIASLLGIRLKHDKLIAS |
| Ga0126380_101492253 | 3300010043 | Tropical Forest Soil | MAAQFGQFALALAWVVTAYSVVASILGIRLKHDKLIASGR |
| Ga0127460_10425332 | 3300010114 | Grasslands Soil | MAAQFGQFALALAWVVTAYSVVASVLGIRFKHDKLIASGRNAALAATAS |
| Ga0127498_11108331 | 3300010124 | Grasslands Soil | MAQIGQFALALAFVVTVYSIAASLIGIRVKHDKLIASGRNAAVGT |
| Ga0126370_111216031 | 3300010358 | Tropical Forest Soil | MAAQLGQFALALAWVVTAYSIVASILGIRFKNDKLI |
| Ga0126378_131551521 | 3300010361 | Tropical Forest Soil | MAAQIGQFALALAWVVTAYSIVASLLGIRLKNDNLIASG |
| Ga0126381_1005559751 | 3300010376 | Tropical Forest Soil | MAAQIGQFALALAWVVTAYSIIASLVGIRFKNDSLIASGRNAA |
| Ga0126383_127400592 | 3300010398 | Tropical Forest Soil | MAAQLGQFALALAWVVSAYSVVASILGIRLKHDKL |
| Ga0134127_112889191 | 3300010399 | Terrestrial Soil | MAQVGQFSLALAFIVAVYSIVASLVGIRTRNDKLIASGRN |
| Ga0134127_122362731 | 3300010399 | Terrestrial Soil | MAQVGQFALALAFVVTAYSIAASLIGIRLKNDKLIASGRNAAVATF |
| Ga0134122_102937893 | 3300010400 | Terrestrial Soil | MMAAQIGQFALALAWVVTAYSVVASILGIRFKHDKLIASGR |
| Ga0134121_130789222 | 3300010401 | Terrestrial Soil | MMAAQIGQFALALAWVVTAYSVVASILGIRFKHDKLIASGRNAAIGAFACI |
| Ga0134123_109870491 | 3300010403 | Terrestrial Soil | MAAQLGQFALALAWVTAAYSVVASLLGIRFKHDKL |
| Ga0134123_110609563 | 3300010403 | Terrestrial Soil | MTAQLGQFALALAWVVTAYSVVASLLGIRFKHDKLIASA |
| Ga0138113_1808621 | 3300010895 | Grasslands Soil | MAQIGQFALALAWVVTAYSIVASLLGIRLKHDNLIASGRNA |
| Ga0105246_101932124 | 3300011119 | Miscanthus Rhizosphere | MGQVGQFALALAFVVTIYSIAASLLGIRIKNDKLIA |
| Ga0105246_104008443 | 3300011119 | Miscanthus Rhizosphere | MAQLGQFALALAFIVTAYAIVASLVGIRARNDKLIASGRNAAI |
| Ga0150983_111509571 | 3300011120 | Forest Soil | MVQVGQFALALALVVTVYSIVASLVGIRLKNDKLIDSGKRAAIGTFICITVAIGSLAY |
| Ga0137383_100338561 | 3300012199 | Vadose Zone Soil | MAQLGQFALALAFVVTAYSIVASLVGIRFKNDKLIDSGRNAAVGAFVCVTTTFVC |
| Ga0137365_107421341 | 3300012201 | Vadose Zone Soil | MAQLGQFALALALVVTAYSIVASLIGIRFKNDKLIDSGRNAAVG |
| Ga0150985_1093758002 | 3300012212 | Avena Fatua Rhizosphere | MAAQLGQFALALAWVVTAYSVVASLLGIRFKHDKLI |
| Ga0150985_1108871811 | 3300012212 | Avena Fatua Rhizosphere | MAAQLGQFALALAWVVTAYSVVASVLGIRFKNDKLIASGRNAAIGTTICITTTI |
| Ga0134037_10703461 | 3300012372 | Grasslands Soil | MAQLGQFALALAWVVTAYSIVASLLGIRLKHDNLIASGRNA |
| Ga0134058_12568642 | 3300012379 | Grasslands Soil | MAQVGQFALALAFVVTLYSIVASLAGIRLKNDKLIA |
| Ga0134038_11448282 | 3300012382 | Grasslands Soil | MAQIGQFALALAWVVTAYSIIASLLGIRLKHDNLI |
| Ga0134036_10675792 | 3300012384 | Grasslands Soil | MAQIGQFALALAWVVTAYSIVASLLGIHLKHDKLVASGRNAALG |
| Ga0134023_11090832 | 3300012385 | Grasslands Soil | MAQLGQFALALAFVVTAYSIVASLVGIRFKNDKLIDSGRNAAVGAFVCVT |
| Ga0134054_11313512 | 3300012390 | Grasslands Soil | MAQIGQFALALAWVVTAYSVVASLLGIHLKHDKLIASGRN |
| Ga0134035_11490532 | 3300012391 | Grasslands Soil | MAQIGQFALALAWVVTAYSIVASLLGIRLKHDKLIASGRNAAIA |
| Ga0134044_11721221 | 3300012395 | Grasslands Soil | MAQLGQFALALAFVVTAYSIVASLVGIRFKNDKLIASGRNA |
| Ga0134057_13283502 | 3300012396 | Grasslands Soil | MAQLGQFALALAFVVTAYSIVASLVGIRFKNDKLIDSGRNAAVGAFVCVTT |
| Ga0134056_11286881 | 3300012397 | Grasslands Soil | MAQLGQFALALACVVTAYSVVASLIGIRFKNDKLIDSGRNAAVGVFACIT |
| Ga0150984_1130902272 | 3300012469 | Avena Fatua Rhizosphere | MAAQLGQFALALAWVVTAYAIVASILGIRFKNDKLIASGRNAALG |
| Ga0157352_10985831 | 3300012519 | Unplanted Soil | MAQFGQFSLALAFVVTIYSIVASLLGIRFKNDRLI |
| Ga0137397_106862451 | 3300012685 | Vadose Zone Soil | MAQIGQFALALAFVVTVYSIVASVIGIRFKHDKLIASVRNAAVGTFACLTTAFLCLTDL |
| Ga0126375_104166963 | 3300012948 | Tropical Forest Soil | MAAQLGQFALALAWVTAAYSVVASLLGIRFKYDKLIASGR |
| Ga0126369_121487242 | 3300012971 | Tropical Forest Soil | MAAQLGQFALALAWVVTAYSLVASIIGIRLKHDKLIASGRNAALGTTACITITIICLGYLFA |
| Ga0134075_103822462 | 3300014154 | Grasslands Soil | MAAQIGQFALALAWVVTAYSIIASLLGIRLKNDNLIASG |
| Ga0163163_101836815 | 3300014325 | Switchgrass Rhizosphere | MGQVGQFALALAFVVTIYSIAASLLGIRIKNDKLIASGRNAAVAVFVLISTAI |
| Ga0163163_112826491 | 3300014325 | Switchgrass Rhizosphere | MAAQLGQFALALAWVTAAYSVVASLLGVRFKYDKLIASGRNA |
| Ga0132256_1023387121 | 3300015372 | Arabidopsis Rhizosphere | MAAQLGQFALALAWVVSAYSVVASVLGIRIKHDKLIASGRNAAL |
| Ga0132257_1025339592 | 3300015373 | Arabidopsis Rhizosphere | MAQLGQFALALAWVVTAYSIVASLLGIRLKHDNLIASGRNAAL |
| Ga0132257_1027749162 | 3300015373 | Arabidopsis Rhizosphere | MAAQLGQFALALAWVVTAYSVVASILGIRLKHDKLIA |
| Ga0132255_1048576612 | 3300015374 | Arabidopsis Rhizosphere | MVQVGQFALALALVVTAYSIAASLIGIRTKNDKLIASGKHAAIGT |
| Ga0132255_1054676991 | 3300015374 | Arabidopsis Rhizosphere | MGQVGQFALALAFVVTIYSIAASLLGIRIKNDKLIASGRNAAVAV |
| Ga0182041_118137771 | 3300016294 | Soil | MAAQIGQFALALAWVVTAYSVVASLLGIRLKNDRLIASGRNAAL |
| Ga0184628_100250431 | 3300018083 | Groundwater Sediment | MGQVGQFALALAFVVTIYSIGASLLGIRIKNDKLIA |
| Ga0184647_11768342 | 3300019263 | Groundwater Sediment | MAQIGQFALALAFVVTAYSVIASLIGIRLKNDKIIASGKHAAIATFLCITLSIG |
| Ga0173482_102375281 | 3300019361 | Soil | MGQVGQFALALAFVVTIYSIGASLLGIRIKNDKLIASGRNAAVAVFALISTAIGTL |
| Ga0180107_10795731 | 3300020064 | Groundwater Sediment | MAQLGQFSLALALVVTAYSVIASLIGIRLKNDKLIASGRNA |
| Ga0180109_13110721 | 3300020067 | Groundwater Sediment | MAQLGQFALALAFVVTAYSIVASLLGIRVKNDKLIA |
| Ga0210382_104180052 | 3300021080 | Groundwater Sediment | MAAQIGQFALALAWVVTAYSVVASILGIRFKHDKLIAS |
| Ga0126371_114563713 | 3300021560 | Tropical Forest Soil | MAAQIGQFALALAWVVTAYSVIASLLGIRLKNDNLIASGRNAALG |
| Ga0126371_133615941 | 3300021560 | Tropical Forest Soil | MVQVGQFALALAFAVTAYSIVASLVGIRLKNDKLIDSGKRAAVGTFICVTVAIGALGYL |
| Ga0222625_18016731 | 3300022195 | Groundwater Sediment | MAQLGQFALALALVVTAYSIVASLVGIRFKNDKLIDSGRN |
| Ga0242657_12524042 | 3300022722 | Soil | MFAAQLGQFALALAWVVTAYSIVASILGIRFKNDKLISSGRNAALG |
| Ga0242665_102971611 | 3300022724 | Soil | MAAQIGQFALALAWVVTAYSILASLLGIRLKNDNLIASGRNAAL |
| Ga0242654_102176681 | 3300022726 | Soil | MAAQIGQFALALAWVVTAYSVIASLIGIRLKNDNLIVSARNAAL |
| Ga0222622_104835381 | 3300022756 | Groundwater Sediment | MGQVGQFALALAFVVTIYSIAASLLGIRIKNDKLIASGRNAAIAVFVLISTAIG |
| Ga0209640_110855272 | 3300025324 | Soil | MAQVGQFALALAFIVTAYAIVASLIGIRARNDKLIASGRVA |
| Ga0207692_104617181 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MAAQIGQFALALAWVVTAYSIVASLVGIRFKNDRLIAS |
| Ga0207685_103121913 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MGQVGQFALALAFVVTIYSIASSLLGIRIKNDKLIASGRNAAVAV |
| Ga0207659_106074243 | 3300025926 | Miscanthus Rhizosphere | MAQVGQFALALAFVVTAYSIAASLIGIRLKNDKLIASGRNA |
| Ga0207709_109677851 | 3300025935 | Miscanthus Rhizosphere | MGQVGQFSLALAFVVTIYSITASLLGIRLKNDRLIAS |
| Ga0207651_103394083 | 3300025960 | Switchgrass Rhizosphere | MAAQLGQFALALAWVVTAYSVVASLLGIRFKHDKLIASGRN |
| Ga0207703_109375623 | 3300026035 | Switchgrass Rhizosphere | MGQVGQFALALAFVVTIYSIAASLLGIRIKNDKLIAS |
| Ga0209470_12464103 | 3300026324 | Soil | MAQIGQFALALAWVVTAYSIVASLLGIRLKHDNLI |
| Ga0209803_12547001 | 3300026332 | Soil | MAQIGQFALALAWVVTAYSIVASLLGIRLKHDNLIAS |
| Ga0209382_110578283 | 3300027909 | Populus Rhizosphere | MAAQLGQFALALAWVVTAYSVVASILGIRLKHDKLIASGRNAALGT |
| Ga0308189_104172101 | 3300031058 | Soil | MAQVGQFALALAFVVTAYSIIASLVGIRLRNDKIIAS |
| Ga0308185_10506231 | 3300031081 | Soil | MAAQLGQFALALAWVVTAYSVVASILGIRFKHDKLIASGRNAALGTAA |
| Ga0308197_101766371 | 3300031093 | Soil | MAAQLGQFALALAWVVTAYSVVASILGIRFKHDKLIASGRNAALGTA |
| Ga0308181_11431021 | 3300031099 | Soil | MGQVGQFALALAFVVTIYSIGASLLGIRIKNDNLIASGRNAAIAVFVLISTAIG |
| Ga0308187_104095091 | 3300031114 | Soil | MAAQLGQFALALAWVVTAYSVVASILGIRFKHDKLIA |
| Ga0308194_102523501 | 3300031421 | Soil | MVQVGQFALALAFVVTAYSIAASLIGIRSKNDKLIASGKHAAIGTFV |
| Ga0307480_10176711 | 3300031677 | Hardwood Forest Soil | MAQIGQFALALAWVVTAYSIVASLLGIRLKHDKLIA |
| Ga0315338_12042772 | 3300032138 | Seawater | MAQFGQFSLALAFVLAIYAIAASLFGIRLKNDRLISSGRNSAVAV |
| Ga0315304_11282491 | 3300032145 | Marine | MAQLGQFALALAFTVAVYAIAASLYGIRIKNDRLIASGRNAGISVFASLTIAIAC |
| Ga0315304_11415291 | 3300032145 | Marine | MAAFGQFALALGFVVTVYSIGASLLGIRLGNDRLIASGRNAGIGAFACLSSATVSL |
| Ga0314782_139870_474_584 | 3300034661 | Soil | MAQLGQFALAIAFIVAIYAIVASLIGIRSRNDKLIAS |
| Ga0314786_027661_805_954 | 3300034664 | Soil | MAQVGQFALALAFVVTAYSIAASLIGIRLKNDKLIASGRNAAVATFVCIT |
| Ga0314787_104668_2_112 | 3300034665 | Soil | MAQFGQFALAIAFIVAIYAIVASLIGIRARNDKLIAS |
| Ga0314788_172593_431_541 | 3300034666 | Soil | MAAQLGQFALALAWVTAAYSVVASLLGIRFKHDKLIA |
| Ga0314788_176924_3_125 | 3300034666 | Soil | MAQFGQFALALAFIVSAYSIIASLVGIRYRNDKLIASGRNA |
| Ga0314796_156198_429_536 | 3300034671 | Soil | MAQFGQFSLALAFVVTIYSIVASLLGIRFKNDKLIA |
| Ga0314801_116771_480_614 | 3300034676 | Soil | MAAQLGQFALALAWVVSAYSVVASLLGIRLKHDKLIASGRNAALG |
| ⦗Top⦘ |