| Basic Information | |
|---|---|
| Family ID | F083813 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 112 |
| Average Sequence Length | 39 residues |
| Representative Sequence | DEQKLRSDGYREQIAEALYKGIARYAASSKGVKVASAAK |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 3.57 % |
| % of genes from short scaffolds (< 2000 bps) | 1.79 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (96.429 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.607 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.571 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.786 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.82% β-sheet: 0.00% Coil/Unstructured: 64.18% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF01850 | PIN | 8.93 |
| PF00326 | Peptidase_S9 | 8.04 |
| PF13450 | NAD_binding_8 | 3.57 |
| PF00920 | ILVD_EDD | 3.57 |
| PF07676 | PD40 | 3.57 |
| PF01402 | RHH_1 | 2.68 |
| PF16694 | Cytochrome_P460 | 2.68 |
| PF00440 | TetR_N | 1.79 |
| PF03544 | TonB_C | 1.79 |
| PF02954 | HTH_8 | 1.79 |
| PF03571 | Peptidase_M49 | 0.89 |
| PF13738 | Pyr_redox_3 | 0.89 |
| PF01022 | HTH_5 | 0.89 |
| PF00069 | Pkinase | 0.89 |
| PF05345 | He_PIG | 0.89 |
| PF07883 | Cupin_2 | 0.89 |
| PF01070 | FMN_dh | 0.89 |
| PF10009 | DUF2252 | 0.89 |
| PF03683 | UPF0175 | 0.89 |
| PF01797 | Y1_Tnp | 0.89 |
| PF13304 | AAA_21 | 0.89 |
| PF06580 | His_kinase | 0.89 |
| PF03601 | Cons_hypoth698 | 0.89 |
| PF00486 | Trans_reg_C | 0.89 |
| PF00850 | Hist_deacetyl | 0.89 |
| PF04055 | Radical_SAM | 0.89 |
| PF01979 | Amidohydro_1 | 0.89 |
| PF11008 | DUF2846 | 0.89 |
| PF04471 | Mrr_cat | 0.89 |
| PF13091 | PLDc_2 | 0.89 |
| PF08238 | Sel1 | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG0129 | Dihydroxyacid dehydratase/phosphogluconate dehydratase | Carbohydrate transport and metabolism [G] | 7.14 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.57 |
| COG0123 | Acetoin utilization deacetylase AcuC or a related deacetylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.79 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 1.79 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.89 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.89 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.89 |
| COG2855 | Uncharacterized membrane protein YadS, UPF0324 family | Function unknown [S] | 0.89 |
| COG2886 | Predicted antitoxin, contains HTH domain | General function prediction only [R] | 0.89 |
| COG2972 | Sensor histidine kinase YesM | Signal transduction mechanisms [T] | 0.89 |
| COG3275 | Sensor histidine kinase, LytS/YehU family | Signal transduction mechanisms [T] | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 96.43 % |
| All Organisms | root | All Organisms | 3.57 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300014495|Ga0182015_10047949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3142 | Open in IMG/M |
| 3300018030|Ga0187869_10024792 | All Organisms → cellular organisms → Bacteria | 3380 | Open in IMG/M |
| 3300027905|Ga0209415_10422154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1064 | Open in IMG/M |
| 3300030520|Ga0311372_12745146 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 11.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.61% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.14% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 7.14% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 6.25% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 6.25% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.25% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.36% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.46% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.46% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 2.68% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.68% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.68% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.68% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.79% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.79% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.79% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.79% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.79% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.89% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.89% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004474 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004973 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 19 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005873 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
| 3300009641 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011081 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 60 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300022733 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU3 | Environmental | Open in IMG/M |
| 3300025439 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025453 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300026004 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_302 (SPAdes) | Environmental | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030019 | II_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12636J13339_10515651 | 3300001154 | Forest Soil | SSPTDEQKLRSDGYREQVAEALYQGIARYAAGSHGIKVASAQR* |
| JGI12627J18819_102168601 | 3300001867 | Forest Soil | SSPTDEQKLRSDGYREQIAEALYRGIARYAASSGKGVKVASAAK* |
| Ga0062387_1010971941 | 3300004091 | Bog Forest Soil | DEQKLRSDGYREQIAEALYRGIARYAAWARGVKVASAVK* |
| Ga0062389_1030141961 | 3300004092 | Bog Forest Soil | SSPTDEQKLRSDGYREQIAEALYKGIARYAAASRSVKVASAGK* |
| Ga0062386_1008702522 | 3300004152 | Bog Forest Soil | SPTDEQKLRSDGYREQIAEALYKGIARYAASKTVKVASAAK* |
| Ga0068968_14408542 | 3300004474 | Peatlands Soil | FVSSPTDERKLRVDSYREQIAEALFQGIAQYAAASREVKVASAGR* |
| Ga0072322_12280632 | 3300004973 | Peatlands Soil | VSSPTDERKLRVDSYREQIAEALFQGIAQYAAASREVKVASAGR* |
| Ga0070735_100251605 | 3300005534 | Surface Soil | LRSDGYREQIAEALYRGIARYAANSHGVKIASAGK* |
| Ga0068857_1009496122 | 3300005577 | Corn Rhizosphere | QSDGYREKIAEALYRGIARYAASSRGLRLASAAK* |
| Ga0070761_107740342 | 3300005591 | Soil | EQKLRSDGYREEIAEALYRGIARYAASSHGVKVASAGK* |
| Ga0070762_100335411 | 3300005602 | Soil | QKLRSDGYREQIAEALYKGIARYAASSHGVKMAAK* |
| Ga0070763_102843252 | 3300005610 | Soil | DEQKLRSDGYREQIAEALYRGIARYAAASHGVKVASAGK* |
| Ga0070763_103145571 | 3300005610 | Soil | PTDEQKLRSDGYREEIAEALYKGIARYAATSKNVKIASAGK* |
| Ga0070764_106508743 | 3300005712 | Soil | DEQKLRSDGYREQIAEALYRGIARYAAGSRGVKVASAGK* |
| Ga0075287_10630832 | 3300005873 | Rice Paddy Soil | DEQKLRTDGYREQIAEALYRGIARYAGSSRAVKVATAAK* |
| Ga0070766_104281263 | 3300005921 | Soil | KLRSDGYREQIAEALYKGIARYAAASRSVKVASAAK* |
| Ga0075019_103974751 | 3300006086 | Watersheds | TDEQKLRSDGYREQIAEALYKGIARYAATSHGVKVASAAK* |
| Ga0075030_1003326114 | 3300006162 | Watersheds | DEQKLRSDGYREQIAEALYKGIARYAASSKGVKVASAAK* |
| Ga0075030_1011018982 | 3300006162 | Watersheds | LRSDGYREQIAEALYKGIARYASSSKGVKVASAAK* |
| Ga0075030_1016477491 | 3300006162 | Watersheds | QKLRSDGYREQIAEALYKGIARYASSSKGVKVASAAK* |
| Ga0073928_100500833 | 3300006893 | Iron-Sulfur Acid Spring | PTDERKLRNDGYREQVAEALYKGIARYAASSHGIKVASARR* |
| Ga0073928_101175201 | 3300006893 | Iron-Sulfur Acid Spring | PTDERKLRNDGYREQVAEALYKGIARYAASSHGIKVASARH* |
| Ga0102924_12239751 | 3300007982 | Iron-Sulfur Acid Spring | QKLRSDGYREQIAEALYRGIARYAAASRGVKVASVTK* |
| Ga0099829_109919791 | 3300009038 | Vadose Zone Soil | DEQKLRSDGYREQIAEALYKGIARYAAASRGVKVASVK* |
| Ga0099830_113048271 | 3300009088 | Vadose Zone Soil | KLRSDGYREQIAEALYKGIARYAAGSRGVKVAAR* |
| Ga0116128_11414241 | 3300009518 | Peatland | QKLRSDGYREQVAEALYKGIARYAASSHGIKVASARR* |
| Ga0116225_13262573 | 3300009524 | Peatlands Soil | STDEQKLRSDGYREQIAEALYKGIARYAASSRGVKVASAGK* |
| Ga0116111_10892951 | 3300009616 | Peatland | KLRSDGYREQIAEALYRGIARYAATSHSVKVASAAK* |
| Ga0116120_12316092 | 3300009641 | Peatland | KLRSDGYREQIAEALYRGIARYAASSRGVKMASAAK* |
| Ga0116135_10065735 | 3300009665 | Peatland | RSDGYREQIAEALYKGIARYAVASHGVKMASAAK* |
| Ga0116215_13305501 | 3300009672 | Peatlands Soil | TDEQKLRSYGYREQIAEALYKGIARYAASSKGVKVASAGR* |
| Ga0116101_10196771 | 3300009759 | Peatland | QKLRSDGYREQIAEALYKGIARYAASSRGVKVASAAK* |
| Ga0126384_113689422 | 3300010046 | Tropical Forest Soil | TDEQKLRSDGYREQIAEALYRGIARYAASSKGVKMASAAK* |
| Ga0126379_127405662 | 3300010366 | Tropical Forest Soil | SFVSSPADERHLQSTTYREQIAEALYKGIAHYAAASIHMKLASVR* |
| Ga0136449_1009002331 | 3300010379 | Peatlands Soil | VSFVSSPTDEQKLRSDGYREQVAEALYKGIARYAASSHGINVASARR* |
| Ga0136449_1034622462 | 3300010379 | Peatlands Soil | VSFVSSPTDEQKLRSDGYREQVAEALYKGIARYAASSHGIKVASARR* |
| Ga0138575_11231501 | 3300011081 | Peatlands Soil | EVSFVSSPTDERKLRVDSYREQIAEALFQGIAQYAAASREVKVASAGR* |
| Ga0137393_107330731 | 3300011271 | Vadose Zone Soil | EQKLRSDGYREQIAEALYKGIARYAAGSRSVKVASVK* |
| Ga0137384_109694953 | 3300012357 | Vadose Zone Soil | QKLRSDGYREQIAEALYKGIARYAASSHAVKVAAR* |
| Ga0137398_106656181 | 3300012683 | Vadose Zone Soil | TDEQRLRSDGYREQIAEALYRGIARYAANSRSVKMASARNK* |
| Ga0137395_101825121 | 3300012917 | Vadose Zone Soil | PTDERKLRNDGYREQIAEALYRGIARYAANSHAVKVASVGK* |
| Ga0137395_103677602 | 3300012917 | Vadose Zone Soil | RSDGYREQIAEALYKGIARYAAGSRSVKVASAAK* |
| Ga0137419_100450793 | 3300012925 | Vadose Zone Soil | EQRLRSDGYREQIADALYKGIARYAASSRGVKVASAAK* |
| Ga0126369_107741491 | 3300012971 | Tropical Forest Soil | QKLRSDGYREQIAEALYRGIARYAAGSKGVKMASAAK* |
| Ga0181531_100413521 | 3300014169 | Bog | DEQKLRSDGYREQIAEALYKGIARYAAGSRGVKMAAR* |
| Ga0182015_100479491 | 3300014495 | Palsa | PTDEQKLRSDGYREQIAEALYKGIARYAAGSRGVKVASAGK* |
| Ga0182024_102734561 | 3300014501 | Permafrost | KLRSDGYREQIAEALYKGIARYAATSHGVKVASAAK* |
| Ga0181516_102331501 | 3300014655 | Bog | SSPTDEQKLRSDGYREQIAEALYKGIARYAASSHSVRVASVGK* |
| Ga0132258_100819328 | 3300015371 | Arabidopsis Rhizosphere | TDEQKLRSDGYREQIAEALYRGIARYASNSKGVKMASAAK* |
| Ga0132256_1021750762 | 3300015372 | Arabidopsis Rhizosphere | PTDEQKLRSDGYREQIAEALYKGIARYAANSRNVKVASARK* |
| Ga0187818_100090181 | 3300017823 | Freshwater Sediment | DEQKLRSDGYREQVAEALYKGIARYAASSRGIRVVSARR |
| Ga0187849_12628531 | 3300017929 | Peatland | PTDEQKLRSDGYREQVAEALYKGIARYAASSHGIKVASARR |
| Ga0187853_103518432 | 3300017940 | Peatland | GQKLRSDGYREQVAEALYKGIARYAASSHGIKVASARR |
| Ga0187781_105865612 | 3300017972 | Tropical Peatland | SSPTDEQKLRSDGYREEIAEALYRGIARYEASTHAVKLASAGK |
| Ga0187782_110180632 | 3300017975 | Tropical Peatland | VSSPTDEQKLRSDGYREQIAEAIYKGIARYAADSKNVKVASN |
| Ga0187782_114459552 | 3300017975 | Tropical Peatland | TDEQKLRSDGYREEIAEALYHGIARYAAANSKGAKLAAK |
| Ga0187881_104741691 | 3300018024 | Peatland | SSPTDEQKLRSDGYREEIAEALYKGIARYAANSRGTKVASAAK |
| Ga0187869_100247921 | 3300018030 | Peatland | QKLRSDGYREQIAEALYRGIARYAASSRGVKMASAAK |
| Ga0187863_101020921 | 3300018034 | Peatland | KLRSDGYREQIAEALYRGIARYAASSHGVKVASAGK |
| Ga0187863_103124051 | 3300018034 | Peatland | TDEQKLRSDGYREQIAEALYRGIARYAASSHGVKVASAWK |
| Ga0187784_109154301 | 3300018062 | Tropical Peatland | DEQKLRSDGYREEIAEALYKGIARYAASSKGVKLASAGK |
| Ga0187772_112957262 | 3300018085 | Tropical Peatland | EQKLRSDGYREQIAEALYRGMARYAANSHGVKMASAAK |
| Ga0187769_100854635 | 3300018086 | Tropical Peatland | PTDEQKLRSDGYREQVAEALYKGIARYAASSRGIRVVSARR |
| Ga0187769_103788843 | 3300018086 | Tropical Peatland | EQKLRSDGYREQVAEALYKGIARYAASSRGIKIVSARR |
| Ga0187771_116209641 | 3300018088 | Tropical Peatland | KLRSDGYREQIAEALYKGIARYEATAHPVKMASAAR |
| Ga0210399_113568181 | 3300020581 | Soil | LRSDMYREQIAEALYHGIARYAASDKGAKVASAAK |
| Ga0210388_108616531 | 3300021181 | Soil | KLRSDGYREQIAEALYKGIARYAASSKGIKVASTGK |
| Ga0210388_109404321 | 3300021181 | Soil | HRRTKLRSDGYREQIAEALYRGIARYAAASKGVKVAAK |
| Ga0210385_103300722 | 3300021402 | Soil | QKLRSDGYREQIAEALYRGIARYAAASHGVKVASAGK |
| Ga0210397_114909601 | 3300021403 | Soil | KLRSDMYREQIAEALYHGIARYAASDKGAKVASAAK |
| Ga0210383_112816902 | 3300021407 | Soil | SSPTDEQKLRSDGYREQIAEALYKGIARYAAASRAVKVASAGK |
| Ga0210391_100524751 | 3300021433 | Soil | SSPTDEQKLRSDGYREQIAEALYKGIARYAAASRSVKVASVTK |
| Ga0210391_100570501 | 3300021433 | Soil | PTDEQKLRSDGYREQIAEALYKGIARYAAGSRGVKVASAGK |
| Ga0210391_100658986 | 3300021433 | Soil | DEQKRRSDGYREQIAEALYKGIARYAASSRGVKVASAAK |
| Ga0182009_108219531 | 3300021445 | Soil | KLQSDGYREKIAEALYKGIARYAISSRGVKMAAKQVASRASQ |
| Ga0224562_10017851 | 3300022733 | Soil | KLRSDGYREEIAEALYKGIAHYAANSRGVKVASAAKQ |
| Ga0208323_10443371 | 3300025439 | Peatland | SPTDEQQLRNDGYREQIAEALYKGIARYAAGSRGVKVASAAK |
| Ga0208455_10623781 | 3300025453 | Peatland | SPTDGQKLRSDGYREQVAEALYKGIARYAASSHGIKVASARR |
| Ga0208416_10193401 | 3300026004 | Rice Paddy Soil | QKLRTDGYREQIAEALYRGIARYAGSSRAVKVATAAK |
| Ga0207676_111015722 | 3300026095 | Switchgrass Rhizosphere | RSAEYRQQIAEALYKGIARYAATSHRASMASAAPMQ |
| Ga0209115_10928102 | 3300027567 | Forest Soil | PTDEQKLRSDGYREQIAEALYRGIARYAAASKSVKVASAAK |
| Ga0208044_11498001 | 3300027625 | Peatlands Soil | QKLRSDGYREQIAEALYKGIARYAASSRGVKVASAGK |
| Ga0209139_103140591 | 3300027795 | Bog Forest Soil | SPTDEQKLRSDGYREQIAEALYKGIARYAASSKGEKVASTGK |
| Ga0209773_102512543 | 3300027829 | Bog Forest Soil | DEQKLRSDGYREQIAEALYKGIARYAASTHSVKMASR |
| Ga0209580_106430022 | 3300027842 | Surface Soil | KLHSGGYREQIAEALYRGIARYAASSHSVKVASANK |
| Ga0209068_106308952 | 3300027894 | Watersheds | EQKLRSDGYRERIAEALYKGIARYAVASKGVKVASK |
| Ga0209415_101138491 | 3300027905 | Peatlands Soil | DEQKLRSDGYREQVAEALYKGIARYAASSHGIKVASARR |
| Ga0209415_104221542 | 3300027905 | Peatlands Soil | QKLRSDGYREQVAEALYKGIARYAASSHGIKVASARR |
| Ga0302219_100078641 | 3300028747 | Palsa | SSPTDEQKLRSDGYREQIAEALYKGIARYAAGSRGVKLAAK |
| Ga0308309_109618241 | 3300028906 | Soil | PTDEQKLRSDGYREEIAEALYKGIARYAATSKNVKIASAGK |
| Ga0311371_108410082 | 3300029951 | Palsa | VSFVSSPTDEQKLRSVGYREQVAEALYKGIARYAASSHAVKVASAQRRPESATAKQ |
| Ga0311339_113823471 | 3300029999 | Palsa | KLRSDGYREQIAEALYKGIARYAAASHGVKVASAGN |
| Ga0311348_109477111 | 3300030019 | Fen | TDETKLESPSYRQRIAEALYKGIARYMEESRRVKMASTSAAKSAAR |
| Ga0302182_101570382 | 3300030054 | Palsa | EQKLRSDGYREQIAEALYKGIARYAAASHGVKVASAGN |
| Ga0311349_107868221 | 3300030294 | Fen | QKLRSDGYREQIAEALYKGIARYAASAGRGVKVASAAK |
| Ga0311372_127451462 | 3300030520 | Palsa | TDEQKLRSDEYREQIAEALYKGIARYAASSRSVKVASAAK |
| Ga0311354_104196201 | 3300030618 | Palsa | LRSDGYREQIAEALYKGIARYAAGSRGVKMASAAK |
| Ga0310039_103615712 | 3300030706 | Peatlands Soil | KLRSDGYREQVAEALYKGIARYAASSHGIKVASARR |
| Ga0170818_1035918511 | 3300031474 | Forest Soil | TDEQKLRSDGYREQIAEALYKGIARYAAGSKGVKVASTGK |
| Ga0302326_116281911 | 3300031525 | Palsa | RLRSDGYREQVAEALYKGIARYAASFHGIKVTSARP |
| Ga0318541_107197002 | 3300031545 | Soil | QKLRSDGYREQIAEALYKGIARYASASKGVKVASVR |
| Ga0310686_1166432251 | 3300031708 | Soil | SPTDEQKLRSDGYREQIAEALYKGIARYAAGSRGVKMASAAK |
| Ga0307478_114859291 | 3300031823 | Hardwood Forest Soil | KLRSDGYRERIAEALYKGIARYAANSRGVKVASAAKR |
| Ga0318536_105318252 | 3300031893 | Soil | TDEQKLRSDGYREQIAEALYKGIARYASASKGVKVASVR |
| Ga0310916_109038221 | 3300031942 | Soil | SPADEQKLRSDGYRERIAEALYKGIARYASSKGVKMASAAK |
| Ga0307479_105735062 | 3300031962 | Hardwood Forest Soil | EQKLRTDGYREQIAEALYRGIARYAASSHSVKVASAGK |
| Ga0311301_105964711 | 3300032160 | Peatlands Soil | QKLRSDGYREQVAEALYKGIARYAASSHGINVASARR |
| Ga0311301_115288302 | 3300032160 | Peatlands Soil | VSFVSSPADEQKLRSDGYREQVAEALYKGIARYAASSHGIKVASARR |
| Ga0335078_106971801 | 3300032805 | Soil | SPADEQKLRSDGYRERIAEALYRGIAHYAVQSKGVKMASAK |
| Ga0335075_111780302 | 3300032896 | Soil | EQRLRSDGYREQIAEALYKGIARYAASSHPVKVASAGAR |
| Ga0335077_115465411 | 3300033158 | Soil | EQKLRSDGYREQIAEALYKGIARYAASSKGVKVAAR |
| Ga0310914_108994211 | 3300033289 | Soil | EQKLRSDGYREQIAEALYKGIARYASASKGVKVASVR |
| ⦗Top⦘ |