| Basic Information | |
|---|---|
| Family ID | F083805 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 112 |
| Average Sequence Length | 41 residues |
| Representative Sequence | PEQRRQYAVALAEELLQFERPMPVMDNYDLLLANTKGAIQ |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.90 % |
| % of genes near scaffold ends (potentially truncated) | 96.43 % |
| % of genes from short scaffolds (< 2000 bps) | 98.21 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.643 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog (31.250 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.500 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.429 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.76% β-sheet: 0.00% Coil/Unstructured: 63.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF01695 | IstB_IS21 | 94.64 |
| PF04011 | LemA | 0.89 |
| PF09363 | XFP_C | 0.89 |
| PF02899 | Phage_int_SAM_1 | 0.89 |
| PF02518 | HATPase_c | 0.89 |
| PF08808 | RES | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 94.64 |
| COG1704 | Magnetosome formation protein MamQ, lipoprotein antigen LemA family | Cell wall/membrane/envelope biogenesis [M] | 0.89 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.89 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.89 |
| COG5654 | Predicted toxin component of a toxin-antitoxin system, contains RES domain | Defense mechanisms [V] | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.64 % |
| Unclassified | root | N/A | 5.36 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001356|JGI12269J14319_10266937 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300001867|JGI12627J18819_10383795 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300005541|Ga0070733_11085835 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300005617|Ga0068859_100522417 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
| 3300005618|Ga0068864_101047996 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300006894|Ga0079215_10452970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 781 | Open in IMG/M |
| 3300009137|Ga0066709_103809423 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300009520|Ga0116214_1447453 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300009548|Ga0116107_1202244 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300009628|Ga0116125_1177688 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300009638|Ga0116113_1188944 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300009644|Ga0116121_1108855 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300010049|Ga0123356_12485670 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300010361|Ga0126378_11470465 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300010362|Ga0126377_13024956 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300010379|Ga0136449_101041577 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
| 3300010429|Ga0116241_11275727 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300012202|Ga0137363_10535930 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300012228|Ga0137459_1234289 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300014491|Ga0182014_10188639 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
| 3300014499|Ga0182012_10531130 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 762 | Open in IMG/M |
| 3300014501|Ga0182024_12054570 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300014501|Ga0182024_12626213 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300014657|Ga0181522_10399621 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300014657|Ga0181522_10536326 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300014658|Ga0181519_10455775 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300014839|Ga0182027_10678979 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
| 3300017988|Ga0181520_10900084 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300017996|Ga0187891_1161335 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300018009|Ga0187884_10274086 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300018034|Ga0187863_10099962 | All Organisms → cellular organisms → Bacteria | 1626 | Open in IMG/M |
| 3300018034|Ga0187863_10295054 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300018034|Ga0187863_10824398 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300018037|Ga0187883_10597340 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300018043|Ga0187887_10345247 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300018465|Ga0190269_11722497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 530 | Open in IMG/M |
| 3300020021|Ga0193726_1248287 | Not Available | 722 | Open in IMG/M |
| 3300021329|Ga0210362_1291560 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300021420|Ga0210394_10445124 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
| 3300021477|Ga0210398_10421551 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
| 3300022518|Ga0224548_1032153 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300022872|Ga0224526_1066176 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300023091|Ga0224559_1074523 | All Organisms → cellular organisms → Bacteria | 1294 | Open in IMG/M |
| 3300023254|Ga0224524_1016670 | All Organisms → cellular organisms → Bacteria | 1551 | Open in IMG/M |
| 3300024240|Ga0224522_1074299 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300025434|Ga0208690_1011206 | All Organisms → cellular organisms → Bacteria | 1790 | Open in IMG/M |
| 3300025914|Ga0207671_11143061 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300025918|Ga0207662_10214507 | All Organisms → cellular organisms → Bacteria | 1251 | Open in IMG/M |
| 3300025945|Ga0207679_11092226 | Not Available | 732 | Open in IMG/M |
| 3300025990|Ga0208527_1026772 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300026095|Ga0207676_10279311 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1516 | Open in IMG/M |
| 3300028268|Ga0255348_1035260 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300028379|Ga0268266_11235845 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300028560|Ga0302144_10308163 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300028574|Ga0302153_10066065 | All Organisms → cellular organisms → Bacteria | 1217 | Open in IMG/M |
| 3300028648|Ga0268299_1098891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 824 | Open in IMG/M |
| 3300028745|Ga0302267_10339059 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300028765|Ga0302198_10241012 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300028774|Ga0302208_10085675 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300028775|Ga0302231_10234448 | Not Available | 767 | Open in IMG/M |
| 3300028788|Ga0302189_10227570 | Not Available | 770 | Open in IMG/M |
| 3300028795|Ga0302227_10125415 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300028798|Ga0302222_10148914 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300028854|Ga0302268_1116486 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300028866|Ga0302278_10220342 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300028873|Ga0302197_10182410 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300028873|Ga0302197_10269037 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300028873|Ga0302197_10453819 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300028874|Ga0302155_10275887 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300028874|Ga0302155_10415122 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300028909|Ga0302200_10137216 | All Organisms → cellular organisms → Bacteria | 1281 | Open in IMG/M |
| 3300028909|Ga0302200_10157024 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
| 3300029883|Ga0311327_10873700 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300029907|Ga0311329_10517912 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300029915|Ga0311358_10135294 | All Organisms → cellular organisms → Bacteria | 2401 | Open in IMG/M |
| 3300029919|Ga0302141_1050321 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300029922|Ga0311363_10677359 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300029943|Ga0311340_10707567 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300029953|Ga0311343_10473855 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
| 3300029956|Ga0302150_10093001 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
| 3300029956|Ga0302150_10106961 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300029986|Ga0302188_10157353 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300029986|Ga0302188_10245156 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300029986|Ga0302188_10387171 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300029998|Ga0302271_10178415 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300030051|Ga0302195_10411678 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300030058|Ga0302179_10549950 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300030399|Ga0311353_10432912 | All Organisms → cellular organisms → Bacteria | 1177 | Open in IMG/M |
| 3300030503|Ga0311370_10406796 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1708 | Open in IMG/M |
| 3300030507|Ga0302192_10156174 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300030507|Ga0302192_10201459 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300030508|Ga0302185_10172325 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300030688|Ga0311345_10526899 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
| 3300030688|Ga0311345_10546548 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300030737|Ga0302310_10381355 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300030838|Ga0311335_11317521 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300030943|Ga0311366_10453204 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
| 3300030943|Ga0311366_10469223 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
| 3300031057|Ga0170834_102164960 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
| 3300031234|Ga0302325_12360080 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300031236|Ga0302324_101711555 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300031259|Ga0302187_10508864 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300031261|Ga0302140_11196357 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300031524|Ga0302320_11013363 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300031708|Ga0310686_100709815 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300031708|Ga0310686_116583978 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300031880|Ga0318544_10076028 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
| 3300032272|Ga0316189_11080327 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300032783|Ga0335079_12213133 | Not Available | 524 | Open in IMG/M |
| 3300032805|Ga0335078_10766985 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
| 3300034130|Ga0370494_043540 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 31.25% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 8.93% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 6.25% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 5.36% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 4.46% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 4.46% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.57% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.68% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.79% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.79% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.79% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.79% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 0.89% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.89% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.89% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.89% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.89% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.89% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.89% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.89% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.89% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.89% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.89% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009548 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 | Environmental | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010429 | AD_USRAca | Engineered | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012228 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT700_2 | Environmental | Open in IMG/M |
| 3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
| 3300014499 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300017996 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300021329 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.625 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300022518 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 20-24 | Environmental | Open in IMG/M |
| 3300022872 | Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T-25 | Environmental | Open in IMG/M |
| 3300023091 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 30-34 | Environmental | Open in IMG/M |
| 3300023254 | Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T75 | Environmental | Open in IMG/M |
| 3300024240 | Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T25 | Environmental | Open in IMG/M |
| 3300025434 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025990 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028268 | Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T-25.v5 | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028560 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300028574 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300028648 | Activated sludge microbial communities from bioreactor in Nijmegen, Gelderland, Netherland - NOB reactor | Engineered | Open in IMG/M |
| 3300028745 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_3 | Environmental | Open in IMG/M |
| 3300028765 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300028774 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E2_3 | Environmental | Open in IMG/M |
| 3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300028788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300028795 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1 | Environmental | Open in IMG/M |
| 3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300028854 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_1 | Environmental | Open in IMG/M |
| 3300028866 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028873 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300028874 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_1 | Environmental | Open in IMG/M |
| 3300028909 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_1 | Environmental | Open in IMG/M |
| 3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029919 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_2 | Environmental | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029953 | II_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029956 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_2 | Environmental | Open in IMG/M |
| 3300029986 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_1 | Environmental | Open in IMG/M |
| 3300029998 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N1_1 | Environmental | Open in IMG/M |
| 3300030051 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_2 | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030507 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_2 | Environmental | Open in IMG/M |
| 3300030508 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_2 | Environmental | Open in IMG/M |
| 3300030688 | II_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031259 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_3 | Environmental | Open in IMG/M |
| 3300031261 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1 | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300032272 | Coastal sediment microbial communities from Maine, United States - Lowes Cove worm burrow | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300034130 | Peat soil microbial communities from wetlands in Alaska, United States - Collapse_03_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12269J14319_102669372 | 3300001356 | Peatlands Soil | EQRRRYAVALAEELQQYERPMPVMDDYDLLLANTTGGVQ* |
| JGI12627J18819_103837951 | 3300001867 | Forest Soil | QHAVALAEELLQFERPMPVMDNYDLLLANTTGAIH* |
| Ga0070733_110858352 | 3300005541 | Surface Soil | RRRSAIALAEELTEFERPMPVMDEYDLLLNDTAGGIQ* |
| Ga0068859_1005224171 | 3300005617 | Switchgrass Rhizosphere | DGEQRRQYAIALAEELSAFERPMPEMHEYDLLLSNPVGGVQ* |
| Ga0068864_1010479962 | 3300005618 | Switchgrass Rhizosphere | RQYAIALAEELSAFERPMPEMHEYDLLLSNPVGGVQ* |
| Ga0079215_104529701 | 3300006894 | Agricultural Soil | PEQRRQYAIALAEELAEFERPMPVMDDYDLLLTDPTGGIQ* |
| Ga0066709_1038094232 | 3300009137 | Grasslands Soil | RQYAITRAEELQQFERPMPTLAEYDLLLANGKGGIQ* |
| Ga0116214_14474532 | 3300009520 | Peatlands Soil | PEQRRRYAVALAEELQQYERPMPVMDDYDLLLANTTGGVQ* |
| Ga0116107_12022442 | 3300009548 | Peatland | LHLLRMPDPEQRRQYAVALAEELQQYERPMPVMDNYDLLLTSATGAIQ* |
| Ga0116125_11776882 | 3300009628 | Peatland | AVLHLLRMPDPEQRHQYAVALAEELQQYERPMPVMDNYDLLLANTTGAIQ* |
| Ga0116113_11889442 | 3300009638 | Peatland | MHLLRMPDPEQRRQHAVALAEELLQFELPMPVMDNYDLLLANTTGAIH* |
| Ga0116121_11088551 | 3300009644 | Peatland | QHALALAEELLQFERPMPVMDNYDLLLANATGGIH* |
| Ga0123356_124856702 | 3300010049 | Termite Gut | LHLLRMPDAEQRRQLAVALAEELLQFERPMPVMDNYDLLLANPKGAIQ* |
| Ga0126378_114704652 | 3300010361 | Tropical Forest Soil | PEERRRHAIALTEELAEFERPMPVMDEYDLLLNDTPGGIQ* |
| Ga0126377_130249561 | 3300010362 | Tropical Forest Soil | RRRYAVALAAELVQFERPMPAMDEYDQLLSQAPGGIQ* |
| Ga0136449_1010415772 | 3300010379 | Peatlands Soil | RRYALDLADELVQFERPMPVMDDYDLLLADATGGIQ* |
| Ga0116241_112757271 | 3300010429 | Anaerobic Digestor Sludge | VQRQQYALALAEELAQFERPAPGVDEYDLLLADAAGGLQ* |
| Ga0137363_105359302 | 3300012202 | Vadose Zone Soil | MPDQEERRCYAIALAKELAEFERPMPAMDEYDLLLKDTPGGIQ* |
| Ga0137459_12342892 | 3300012228 | Soil | LHMPDAEQRRQYAIALAEELQEYERPMPTLTEYDLLLADGEGGIRS* |
| Ga0182014_101886391 | 3300014491 | Bog | AVALAEELQQYERPMPVMDNYDLLLADNTTGAIQ* |
| Ga0182012_105311301 | 3300014499 | Bog | HAVALAEELLQFERPMPVMDNYDLLLANTTGAIQ* |
| Ga0182024_120545701 | 3300014501 | Permafrost | MHLLRMPDPEQRRQYAVALAEELLQFERPMPVMDNYDLLLANTTRAIQ* |
| Ga0182024_126262131 | 3300014501 | Permafrost | LHLLRMPDPEQRHQYAVALAEELLPFERPMPVMDEYDLLLANTTGGIQ* |
| Ga0181522_103996211 | 3300014657 | Bog | MPDPEERRCYAIALAEELAEFERPMPVMDEYDLLLKDTPGGIQ* |
| Ga0181522_105363262 | 3300014657 | Bog | LHILHMPDPEQRRQYAVALAEELQQYERPMPVMDNYDLLLTSTTGAIQ* |
| Ga0181519_104557752 | 3300014658 | Bog | QYAVALAEELQQYERPMPVMDNYDLLLAANATGAIQ* |
| Ga0182027_106789793 | 3300014839 | Fen | LRMPDPEQRRQYAVSLAEELQQYERPMPVMDNYDLLLAANTTGAIQ* |
| Ga0181520_109000842 | 3300017988 | Bog | QQRQQYALALAEELAQFERPMPVMDDYDLLLAGTRGGIQ |
| Ga0187891_11613352 | 3300017996 | Peatland | RRRYALALAEDLIQFERPMPVMDEYDLLLQDTPGGIQ |
| Ga0187884_102740861 | 3300018009 | Peatland | DPEQRRQYAVALAEELQQYERPMPVMDNYDLLLTSTTGAIQ |
| Ga0187863_100999621 | 3300018034 | Peatland | MPDPEQRRQYAVSLAEELQQYERPMPVMDNYDLLLAANTTGAIQ |
| Ga0187863_102950541 | 3300018034 | Peatland | QYAVALAEELQQYERPMPVMDNYDLLLTSTTGAIQ |
| Ga0187863_108243982 | 3300018034 | Peatland | PEQRRQYAVALADELLQFERPMPVMDNYDLLLANTTGAIH |
| Ga0187883_105973401 | 3300018037 | Peatland | EQRRQYALTLAEELAQFERPMPVMDDYDLLLTGTRGGIQ |
| Ga0187887_103452471 | 3300018043 | Peatland | RQYAVSLAEELQQYERPMPVMDNYDLLLAANTTGAIQ |
| Ga0190269_117224971 | 3300018465 | Soil | RQSAIALAEELCEFERPMPTMQEYDLLLSGAGGVQ |
| Ga0193726_12482871 | 3300020021 | Soil | PEERRRYAIALAEELAEFERPMPVMDEYDLLLNNTPGGIQ |
| Ga0210362_12915601 | 3300021329 | Estuarine | MPDPEERRRHAVALADELAEYERPMPVMDDYDLLLADTPGGIQ |
| Ga0210394_104451242 | 3300021420 | Soil | HILYMPDPEQRRQYALDLADELAQFERPMPVMDDYDLLLTDTMGGIQ |
| Ga0210398_104215513 | 3300021477 | Soil | RQYDVALAEPLLQYERPMPVMDHYNLLLTTTGAIQ |
| Ga0224548_10321531 | 3300022518 | Soil | DPEQRRRYALDLADELAQFERPMPVMDDYDLLLADATGGIQ |
| Ga0224526_10661762 | 3300022872 | Soil | LHLLRMPDPEQRRQYAVALAEELQQYERPMPVMDNYDLLLANTTGAIQ |
| Ga0224559_10745231 | 3300023091 | Soil | PEQRRQYAVALAEELQQYERPMPVMDNYDLLLVASTTEAIQ |
| Ga0224524_10166702 | 3300023254 | Soil | PEQRRQYAVTLAEELQQYERPMPVMDNYDLLLANTTGAIQ |
| Ga0224522_10742991 | 3300024240 | Soil | VLHLLRMPDPEQRRQYAVALAEELQQYERPMPVMDNYDLLLAANTTGAIQ |
| Ga0208690_10112063 | 3300025434 | Peatland | AAVLHLLRMPDPEQRRQYAVSLAEELQQYERPMPVMDNYDLLLAANTTGAIQ |
| Ga0207671_111430611 | 3300025914 | Corn Rhizosphere | ERGRYAIALAEELAGFERPMPVMDEYDLLLNERPGGIQ |
| Ga0207662_102145074 | 3300025918 | Switchgrass Rhizosphere | AMNPFDAIALEEELAQFERPMPEMDEYDLLLGGIQ |
| Ga0207679_110922261 | 3300025945 | Corn Rhizosphere | GRYAIALAEELAGFERPMPVMDEYDLLLNERLGGIQ |
| Ga0208527_10267722 | 3300025990 | Rice Paddy Soil | PEQRRQHAVALAEELLQFERPMPAMDNYDLLLANTTGAIH |
| Ga0207676_102793111 | 3300026095 | Switchgrass Rhizosphere | MSRQYAIALAEELSAFERPMPEMHEYDLLLSNPVGGVQ |
| Ga0255348_10352603 | 3300028268 | Soil | HLLRMPDPEQRRQYAVALAEELQQYERPMPVMDNYDLLLANTTGAIQ |
| Ga0268266_112358452 | 3300028379 | Switchgrass Rhizosphere | TEGDPEQRRQYAVALAEELAEFERPMPVMDEYDLLLGDTPGGIQ |
| Ga0302144_103081631 | 3300028560 | Bog | DPEQRRQHAVALAEELLQFERPMPVMDNYDLLLDNTTGAIH |
| Ga0302153_100660651 | 3300028574 | Bog | RQYAVALAEELQQYERPMPVMDNYDLLLVNPTGVIQ |
| Ga0268299_10988911 | 3300028648 | Activated Sludge | ILHMPHAEQRQGHAIALAEELREFERPMPVMNDYDLLLGGATGGLR |
| Ga0302267_103390592 | 3300028745 | Bog | PDPEQRRQHAVALAEELRQFERPMPVMDNYDLLLANTTGAIH |
| Ga0302198_102410121 | 3300028765 | Bog | RQHAVALAEELRQFERPMPVMDNYDLLLANTTGAIH |
| Ga0302208_100856752 | 3300028774 | Fen | RQHAVALAEELLQFERPMPVMDNYDLLLANTTGAIH |
| Ga0302231_102344482 | 3300028775 | Palsa | MHLLRMPDPEQRRQCAVALAEELQQYERPMPVMDNYDLLLTNTTGAIQ |
| Ga0302189_102275701 | 3300028788 | Bog | SAAVLHLLRMPDPEQRRQYAVALAEELQQYERPMPVMDNYDLLLANTTGAIQ |
| Ga0302227_101254152 | 3300028795 | Palsa | RRQHAVALAEELMQFERPMPVMDNYDLLLANTTEAIH |
| Ga0302222_101489142 | 3300028798 | Palsa | EERRRYAIALAEELAEFERPMPVMDEYDLLLKDTPGGIQ |
| Ga0302268_11164861 | 3300028854 | Bog | HLLRMPDPEQRRQYAVALAEELQQYERPMPVMDNYDLLLTSTTGAIQ |
| Ga0302278_102203421 | 3300028866 | Bog | RMPDPEQRRQYAVALAEELQQYERPMPVMDNYDLLLANTTGAIQ |
| Ga0302197_101730332 | 3300028873 | Bog | DAAAVMHLLRMPDPEQRHQYAVALADELQQYERPMPVMDNYDLLLANTTGAIQ |
| Ga0302197_101824102 | 3300028873 | Bog | QRRRYAIALAEELREFERPMPTMAEYDLLLADGNGGIQ |
| Ga0302197_102690372 | 3300028873 | Bog | PDAEQRRQYAVALAEELQQYERPMPVMDNYDLLLANTAGAIQ |
| Ga0302197_104538191 | 3300028873 | Bog | MHLLRMPDPEQRRQYAVALAEELQQYERPMPVMDNYDLLLTSTTGAIQ |
| Ga0302155_102758872 | 3300028874 | Bog | QYAVALAEELQQYERPMPVMDNYDLLLANTTGAIQ |
| Ga0302155_104151221 | 3300028874 | Bog | LHLLRMPDPEQRRQYAVALAEELQQYERPMPVMDNYDLLLVASTTEAIQ |
| Ga0302200_101372161 | 3300028909 | Bog | PEQRRQYAVALAEELLQFERPMPVMDNYDLLLANTKGAIQ |
| Ga0302200_101570241 | 3300028909 | Bog | EQRRQHAVALAEELLQFERPMPVMDNYDLLLANTTGAIH |
| Ga0311327_108737002 | 3300029883 | Bog | DPEQRRQHAVALAEELLQFERPMPVMDNYDLLLANTTGAIH |
| Ga0311329_105179122 | 3300029907 | Bog | PDPEQRRQYAVALAEELLQFERPMPVMDNYDLLLANTKGAIQ |
| Ga0311358_101352941 | 3300029915 | Bog | RRQYAVALAEELQQYERPMPVMDNYDLLLTSTTGAIQ |
| Ga0302141_10503213 | 3300029919 | Bog | PEQRRQYAVALAEELLQFERPMPVMDNYDLLLTSTTGAIQ |
| Ga0311363_106773592 | 3300029922 | Fen | DPEQRRQYAVALAEELLQFERPMPVMDNYDLLLTSTTGAIQ |
| Ga0311340_107075671 | 3300029943 | Palsa | PEQRRQCAVALAEELQQYERPMPVMDNYDLLLTNTTGAIQ |
| Ga0311343_104738552 | 3300029953 | Bog | RMPDPEQRRQYAVALAEELQQYERPMPVMDNYDLLLATNTTGAIQ |
| Ga0302150_100930013 | 3300029956 | Bog | RMPDPEQRRQYAVALAEELLQFERPMPVMDNYDLLLANTTRAIQ |
| Ga0302150_101069611 | 3300029956 | Bog | PEQRRQHAVALAEELQQFERPMPAMDNYDLLLDNITGVIQ |
| Ga0302188_101573531 | 3300029986 | Bog | YAVSLAEELQQYERPMPVMDNYDLLLAASTTEAIQ |
| Ga0302188_102451562 | 3300029986 | Bog | EQRHQYAVALAEELRQFERPMPVMDDYDLLLTNTTGAIQ |
| Ga0302188_103871712 | 3300029986 | Bog | RQHAVALAEELQQFERPMPVMDNYDLLLANTTGAIQ |
| Ga0302271_101784152 | 3300029998 | Bog | PEQRRQHEVALAEELLQFERPMPVMDNYDLLLANTTGAIH |
| Ga0302195_104116782 | 3300030051 | Bog | QYAVALAEELLQFERPMPVMDNYDLLLANTKGAIQ |
| Ga0302179_105499502 | 3300030058 | Palsa | QYAVALAEELLQFERPMPVMDNYDLLLANTTRAIQ |
| Ga0311353_104329121 | 3300030399 | Palsa | RMPDPEQRRQHAVALAEELQQYERPMPVMDNYDLLLTNTTGAIQ |
| Ga0311370_104067963 | 3300030503 | Palsa | DPEQRRQHAVALAKELMEFERPMPVMDEYDLLLTAPTGGIQ |
| Ga0302192_101561743 | 3300030507 | Bog | QYAVALAEELQQYERPMPVMDNYDLLLVASTTEAIQ |
| Ga0302192_102014591 | 3300030507 | Bog | AVMHLLRMPDPEQRRQYAVALAEELQQYERPMPVMDNYDLLLTSTTGAIQ |
| Ga0302185_101723252 | 3300030508 | Bog | RRQYAVSLAEELQQYERPMPVMDNYDLLLAASTTEAIQ |
| Ga0311345_105268992 | 3300030688 | Bog | AAVLHLLRMPDPEQRRQYAVALAEELQQYERPMPVMDNYDLLLANTTGAIQ |
| Ga0311345_105465481 | 3300030688 | Bog | HLLRMPDPEQRRQYAVALAEELQQYERPMPVMDNYDLLLANTAGAIQ |
| Ga0302310_103813552 | 3300030737 | Palsa | VLHILHMPDPEQRRQYAVALAEELQQYERPMPVMDNYDLLLTSTTGAIQ |
| Ga0311335_113175211 | 3300030838 | Fen | EKRRQYALDLADELAQFERPMPVMDDYDLLLTEPMGGIQ |
| Ga0311366_104532043 | 3300030943 | Fen | PDPEQRRQYAVALAEELQQYERPMPVMDNYDLLLAANATGAIQ |
| Ga0311366_104692231 | 3300030943 | Fen | RQRYAIALAEELAQFERPMPVMDDYDLLLSDGAGGIQ |
| Ga0170834_1021649603 | 3300031057 | Forest Soil | SYAIALAEELAAFERPMPVMDEYDLLLKGTPGGVQ |
| Ga0302325_123600801 | 3300031234 | Palsa | KPVHLLRTPDPEQRRQHAVALAEELLQFERPMPVMNNYDLFLANTTGAIH |
| Ga0302324_1017115553 | 3300031236 | Palsa | RRHALKLAEELKAFERPMPVMDEYDQLLSDGGAIK |
| Ga0302187_105088641 | 3300031259 | Bog | HLLRTPDPEQRRQRAVALAEELQQFERPMPVMDNYDLLLVNTTGAIQ |
| Ga0302140_111963572 | 3300031261 | Bog | HQYAVALAEELQQYERPMPVMDNYDLLLANTTGAIQ |
| Ga0302320_110133632 | 3300031524 | Bog | QRRQYAVALAEELQQYERPMPVMDNYDLLLVNTTGAIQ |
| Ga0310686_1007098151 | 3300031708 | Soil | QRRQYALALAEELVQFERPMPVMDEYDLLLSDTRRDIQ |
| Ga0310686_1165839781 | 3300031708 | Soil | RQYAMSLAEELAQFERPMPVMDDYDLLLTGPAGGIQ |
| Ga0318544_100760281 | 3300031880 | Soil | PEQRRQYAVALAEELLQFERPMPVMDNYDLLLANPKGAIQ |
| Ga0316189_110803272 | 3300032272 | Worm Burrow | ILRMPDAEQRRQYAIALAEELKQFERPLPVMDDYDLLLADPAGGVQ |
| Ga0335079_122131332 | 3300032783 | Soil | QQRRQQAMALAQELVQFERPMPVMDEYDLLLSDTQGDIQ |
| Ga0335078_107669853 | 3300032805 | Soil | HMPDADERRRYAIALEAELAQFERPMPAMEEYDLLLSETPGGIQ |
| Ga0370494_043540_13_144 | 3300034130 | Untreated Peat Soil | MPDPEQRRQYAVALAEELQQYERPMPVMDNYDLLLANTTGAIQ |
| ⦗Top⦘ |