| Basic Information | |
|---|---|
| Family ID | F083765 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 112 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MIELFKQPNIDWMGKAKYFFALSGILLLAGWTSIFFK |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.32 % |
| % of genes from short scaffolds (< 2000 bps) | 85.71 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (28.571 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.429 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.92% β-sheet: 0.00% Coil/Unstructured: 63.08% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF02355 | SecD_SecF | 77.68 |
| PF07549 | Sec_GG | 13.39 |
| PF02699 | YajC | 3.57 |
| PF01702 | TGT | 1.79 |
| PF04893 | Yip1 | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG0341 | Preprotein translocase subunit SecF | Intracellular trafficking, secretion, and vesicular transport [U] | 91.07 |
| COG0342 | Preprotein translocase subunit SecD | Intracellular trafficking, secretion, and vesicular transport [U] | 91.07 |
| COG1862 | Protein translocase subunit YajC | Intracellular trafficking, secretion, and vesicular transport [U] | 3.57 |
| COG0343 | Queuine/archaeosine tRNA-ribosyltransferase | Translation, ribosomal structure and biogenesis [J] | 1.79 |
| COG1549 | Archaeosine tRNA-ribosyltransferase, contains uracil-DNA-glycosylase and PUA domains | Translation, ribosomal structure and biogenesis [J] | 1.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005172|Ga0066683_10429579 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 813 | Open in IMG/M |
| 3300005533|Ga0070734_10752648 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300005552|Ga0066701_10707656 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300006059|Ga0075017_101194515 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 595 | Open in IMG/M |
| 3300007255|Ga0099791_10216650 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300007255|Ga0099791_10356184 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300007258|Ga0099793_10022155 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2621 | Open in IMG/M |
| 3300007258|Ga0099793_10066773 | All Organisms → cellular organisms → Bacteria | 1617 | Open in IMG/M |
| 3300007265|Ga0099794_10088417 | All Organisms → cellular organisms → Bacteria | 1535 | Open in IMG/M |
| 3300007265|Ga0099794_10335881 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300009012|Ga0066710_102881381 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300009088|Ga0099830_10345711 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
| 3300009089|Ga0099828_10319930 | All Organisms → cellular organisms → Bacteria | 1397 | Open in IMG/M |
| 3300009137|Ga0066709_104072692 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300009143|Ga0099792_10399353 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300009698|Ga0116216_10146657 | All Organisms → cellular organisms → Bacteria | 1451 | Open in IMG/M |
| 3300009792|Ga0126374_10192837 | All Organisms → cellular organisms → Bacteria | 1281 | Open in IMG/M |
| 3300010303|Ga0134082_10321658 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300010358|Ga0126370_12610340 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300010359|Ga0126376_10153400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1849 | Open in IMG/M |
| 3300012189|Ga0137388_10281709 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1520 | Open in IMG/M |
| 3300012202|Ga0137363_10030823 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3703 | Open in IMG/M |
| 3300012203|Ga0137399_10146395 | All Organisms → cellular organisms → Bacteria | 1882 | Open in IMG/M |
| 3300012205|Ga0137362_10499188 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
| 3300012205|Ga0137362_11284398 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300012206|Ga0137380_11136923 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300012208|Ga0137376_11460942 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300012210|Ga0137378_10638395 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300012210|Ga0137378_11817866 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300012211|Ga0137377_10381080 | All Organisms → cellular organisms → Bacteria | 1348 | Open in IMG/M |
| 3300012349|Ga0137387_10368161 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
| 3300012381|Ga0134026_1268186 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
| 3300012582|Ga0137358_10172566 | All Organisms → cellular organisms → Bacteria | 1474 | Open in IMG/M |
| 3300012683|Ga0137398_10265573 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
| 3300012685|Ga0137397_11061441 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300012922|Ga0137394_10208253 | All Organisms → cellular organisms → Bacteria | 1671 | Open in IMG/M |
| 3300012923|Ga0137359_11407984 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300012984|Ga0164309_11265052 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300014054|Ga0120135_1052413 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300014165|Ga0181523_10043452 | All Organisms → cellular organisms → Bacteria | 2822 | Open in IMG/M |
| 3300015245|Ga0137409_10164173 | All Organisms → cellular organisms → Bacteria | 2024 | Open in IMG/M |
| 3300016294|Ga0182041_11284838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
| 3300016319|Ga0182033_10148219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1807 | Open in IMG/M |
| 3300016357|Ga0182032_10587128 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300016404|Ga0182037_11714150 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300017929|Ga0187849_1058536 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1762 | Open in IMG/M |
| 3300017955|Ga0187817_10729243 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300017973|Ga0187780_10106893 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1928 | Open in IMG/M |
| 3300017994|Ga0187822_10071732 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
| 3300018032|Ga0187788_10206870 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300018088|Ga0187771_11197066 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300020199|Ga0179592_10025824 | All Organisms → cellular organisms → Bacteria | 2634 | Open in IMG/M |
| 3300020579|Ga0210407_10083780 | All Organisms → cellular organisms → Bacteria | 2406 | Open in IMG/M |
| 3300020579|Ga0210407_10375109 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
| 3300020579|Ga0210407_10947187 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300020579|Ga0210407_11102501 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300020581|Ga0210399_10428880 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
| 3300020581|Ga0210399_11306962 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300020582|Ga0210395_10699266 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300020583|Ga0210401_10995873 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300021088|Ga0210404_10025299 | All Organisms → cellular organisms → Bacteria | 2604 | Open in IMG/M |
| 3300021088|Ga0210404_10708002 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300021168|Ga0210406_10530073 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300021168|Ga0210406_10928373 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300021181|Ga0210388_10043533 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3728 | Open in IMG/M |
| 3300021403|Ga0210397_10654306 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300021403|Ga0210397_11104351 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300021420|Ga0210394_10289539 | All Organisms → cellular organisms → Bacteria | 1436 | Open in IMG/M |
| 3300021439|Ga0213879_10218246 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300024186|Ga0247688_1029443 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300025906|Ga0207699_10684048 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300025915|Ga0207693_10419718 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300025916|Ga0207663_11718901 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300025939|Ga0207665_10080572 | All Organisms → cellular organisms → Bacteria | 2240 | Open in IMG/M |
| 3300026314|Ga0209268_1182397 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300026326|Ga0209801_1003825 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8518 | Open in IMG/M |
| 3300026327|Ga0209266_1210268 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300026489|Ga0257160_1083821 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300026529|Ga0209806_1283298 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300026550|Ga0209474_10096106 | All Organisms → cellular organisms → Bacteria | 2004 | Open in IMG/M |
| 3300026555|Ga0179593_1241151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3580 | Open in IMG/M |
| 3300026847|Ga0207802_1017518 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300026859|Ga0207859_1019721 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300027063|Ga0207762_1008350 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1941 | Open in IMG/M |
| 3300027174|Ga0207948_1020632 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300027633|Ga0208988_1097833 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300027643|Ga0209076_1158422 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300027671|Ga0209588_1068257 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
| 3300027698|Ga0209446_1058099 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| 3300027821|Ga0209811_10117939 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300027882|Ga0209590_10780541 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300027905|Ga0209415_10135513 | All Organisms → cellular organisms → Bacteria | 2537 | Open in IMG/M |
| 3300027911|Ga0209698_10135136 | All Organisms → cellular organisms → Bacteria | 2033 | Open in IMG/M |
| 3300028536|Ga0137415_10857209 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300030844|Ga0075377_10651419 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300031720|Ga0307469_10878897 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300031744|Ga0306918_10999151 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300031769|Ga0318526_10185133 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300031796|Ga0318576_10052121 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1776 | Open in IMG/M |
| 3300031819|Ga0318568_10247834 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
| 3300031820|Ga0307473_10478993 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300031823|Ga0307478_10322493 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
| 3300031823|Ga0307478_11570104 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300031835|Ga0318517_10116785 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
| 3300031941|Ga0310912_10446063 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300032009|Ga0318563_10405123 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300032055|Ga0318575_10020906 | All Organisms → cellular organisms → Bacteria | 2741 | Open in IMG/M |
| 3300032805|Ga0335078_10083362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 4653 | Open in IMG/M |
| 3300032892|Ga0335081_10869945 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
| 3300032955|Ga0335076_10468822 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300033134|Ga0335073_10856016 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300033289|Ga0310914_11691215 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 28.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 24.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.46% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.57% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.57% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.57% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.68% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.68% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.68% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.79% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.79% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.79% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.79% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.79% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.79% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.79% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.89% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.89% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.89% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012381 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300014054 | Permafrost microbial communities from Nunavut, Canada - A34_5cm_12M | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
| 3300024186 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29 | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026847 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 20 (SPAdes) | Environmental | Open in IMG/M |
| 3300026859 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 25 (SPAdes) | Environmental | Open in IMG/M |
| 3300027063 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 (SPAdes) | Environmental | Open in IMG/M |
| 3300027174 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF040 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300030844 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0066683_104295792 | 3300005172 | Soil | MIELFKQPNIDWMGKAKYFYALSGILLLAGWASILYGSGIRY |
| Ga0070734_107526481 | 3300005533 | Surface Soil | MIELFKEPNIDWMGKAKYFYALSGILLIAGWTSIF |
| Ga0066701_107076561 | 3300005552 | Soil | MIELFKQPNLDWMGKAKYFYALSGILLLAGWISIF |
| Ga0075017_1011945151 | 3300006059 | Watersheds | MIELFKQPNLDWMGKAKYFYALSGILLLAGWASIFFGSGI |
| Ga0099791_102166501 | 3300007255 | Vadose Zone Soil | MIEFFKEPNIDWMGKAKYFYALSGILLLAGWTSVFL |
| Ga0099791_103561842 | 3300007255 | Vadose Zone Soil | MIEFFKEPNIDWMGKAKYFYALSGILLLGGWTSVFL |
| Ga0099793_100221554 | 3300007258 | Vadose Zone Soil | MIELFKQPNLDWMGKAKYFYALSGILLLAGWTSIFFGS |
| Ga0099793_100667732 | 3300007258 | Vadose Zone Soil | MIELFKQPNINWMGKAKYFYALSGILLLAGWTSIIVNG |
| Ga0099794_100884171 | 3300007265 | Vadose Zone Soil | MIELFKQPNINWMGKAKYFYALSGILLLAGWTSIIVNGG |
| Ga0099794_103358812 | 3300007265 | Vadose Zone Soil | MIELFKQPNIDWMGKAKYFYALSGILLLAGWASILFGSGIRY |
| Ga0066710_1028813812 | 3300009012 | Grasslands Soil | MIELFKQPNIDWMGKAKYFFALSGILLLAGWTSIFFGSG |
| Ga0099830_103457112 | 3300009088 | Vadose Zone Soil | MLELFKQPNLNWMGKAKYFYALSGILLLAGWTSIFF |
| Ga0099828_103199301 | 3300009089 | Vadose Zone Soil | MLELFKQPNIDWMGKAKYFYALSGILLLAGWASIL |
| Ga0066709_1040726922 | 3300009137 | Grasslands Soil | MIEFFKEPNIDWMGKAKYFYALSGILLIAGVISIFL |
| Ga0099792_103993531 | 3300009143 | Vadose Zone Soil | MIEFFKEPHIDWMGKAKYFYALSAILLLAGWVSILVKG |
| Ga0116216_101466571 | 3300009698 | Peatlands Soil | MIELFKQPNIDWMGKAKYFFALSGLLLIIGWAAIFFKGGIKY |
| Ga0126374_101928372 | 3300009792 | Tropical Forest Soil | MIELFKQPNIDWMGKAKYFFLLSGTLLVIGWAAIFFKGG |
| Ga0134082_103216581 | 3300010303 | Grasslands Soil | MIELFKQPNIDWMGKAKYFFVLSGILLLAGWTSIFF |
| Ga0126370_126103401 | 3300010358 | Tropical Forest Soil | MIEFFKEPNIDWMGQAKYFYALSAILLIAGWTSIFLNH |
| Ga0126376_101534001 | 3300010359 | Tropical Forest Soil | MIELFKEPNIHWMQKAKYFYGLSGLLLLVGWVSIFFGPGIRY |
| Ga0137388_102817091 | 3300012189 | Vadose Zone Soil | MIELFKQPNIDWMGKAKYFFALSGTLLVIGWAAIFLKGG |
| Ga0137363_100308231 | 3300012202 | Vadose Zone Soil | MIELFKQPNLDWMGKAKYFYALSGILLLAGWTSIFFGPG |
| Ga0137399_101463952 | 3300012203 | Vadose Zone Soil | MIELFKQPNLDWMGKAKYFYALSGILLLAGWASILFGSG |
| Ga0137362_104991881 | 3300012205 | Vadose Zone Soil | MIELFKQPNIDWMGKAKYFFALSGILLLAGWTSIFFGSGIRY |
| Ga0137362_112843981 | 3300012205 | Vadose Zone Soil | MIEFFKEPNIDWMGKAKYFYALSALLLLAGWASILFKGGI |
| Ga0137380_111369231 | 3300012206 | Vadose Zone Soil | MIELFKQPNIDWMGKAKYFYALSGILLLAGWTSIL |
| Ga0137376_114609421 | 3300012208 | Vadose Zone Soil | MIELFKQPNIDWMGKAKYFFALSGILLLAGWTSIL |
| Ga0137378_106383951 | 3300012210 | Vadose Zone Soil | MIELFKQPNIDWMGKAKYFFALSGILLLAGWTSIFFGS |
| Ga0137378_118178661 | 3300012210 | Vadose Zone Soil | MIELFKQPNIDWMGKAKYFYALSGILLLAGWTSILFGR |
| Ga0137377_103810801 | 3300012211 | Vadose Zone Soil | MIELFKQPNIDWMGKAKYFFALSGILLLAGWTSILFGS |
| Ga0137387_103681611 | 3300012349 | Vadose Zone Soil | MIELFKQPNIDWMGKAKYFYALSGILLLAGWTSILFGRGI |
| Ga0134026_12681861 | 3300012381 | Grasslands Soil | MIELFKQPNLDWMGKAKYFYALSGILLLAGWTSIFFGRGIKYGKRVG* |
| Ga0137358_101725662 | 3300012582 | Vadose Zone Soil | MIEFFKEPNIDWMGKAKYFYVLSGILLLAGWTSVFL |
| Ga0137398_102655731 | 3300012683 | Vadose Zone Soil | MIELFKQPNLDWMGKAKYFYALSGILLLAGWASILFG |
| Ga0137397_110614411 | 3300012685 | Vadose Zone Soil | MIELFKQPNLHWMDKAKYFFALSGVLLIIGWASIFFRGGMK |
| Ga0137394_102082531 | 3300012922 | Vadose Zone Soil | MIELFKQPNLDWMGKAKYFYALSGILLLAGWASIFFGSG |
| Ga0137359_114079842 | 3300012923 | Vadose Zone Soil | MIELFKQPNLDWMGKAKYFFALSGTLLLIGWASIFLKGGIKY |
| Ga0164309_112650522 | 3300012984 | Soil | MIEFFKEPNIDWMGKAKYFYVLSAILLIAGWTSIFLQ |
| Ga0120135_10524131 | 3300014054 | Permafrost | MIEHFKQPNIDWMGKAKYFYGLSALFLLMGIAAVFSQGGV |
| Ga0181523_100434521 | 3300014165 | Bog | MIELFKQPNIDWMGKAKYFFALSGLLLIIGWAAIFFKG |
| Ga0137409_101641731 | 3300015245 | Vadose Zone Soil | MIELFKQPNINWMGKAKYFYALSGILLLAGWTSIIVNGGL |
| Ga0182041_112848381 | 3300016294 | Soil | MIEFFKEPSIDWMGKAKYFYALSAILLLAGWASIFVK |
| Ga0182033_101482191 | 3300016319 | Soil | MIELFKQPDIDWMGKAKYFFALSGLLLLIGWSAIYFKGG |
| Ga0182032_105871282 | 3300016357 | Soil | MIEFFKQPNIDWMGKAKYFYALSGILLVLGWASILSK |
| Ga0182037_117141501 | 3300016404 | Soil | MIELFKQPNIDWMGKAKYFFALSGTLLVIGWAAIFLKGGIKY |
| Ga0187849_10585362 | 3300017929 | Peatland | MIELFKQPNLDWMGKAKFFFTLSGLLLLIGWSAIFLKGGIKY |
| Ga0187817_107292432 | 3300017955 | Freshwater Sediment | MIELFKQPNLDWMGKAKYFFALSGLLLVIGWATIFFKGG |
| Ga0187780_101068932 | 3300017973 | Tropical Peatland | MIELFKQPNLDWMGKAKYFFALSGILLLAGWTSIFFG |
| Ga0187822_100717322 | 3300017994 | Freshwater Sediment | MIELFKTPNIDWMGKAKYFYALSAILLIAGWTAIFLKGGPAGGGLPYSI |
| Ga0187788_102068701 | 3300018032 | Tropical Peatland | MIELFQQPNLDWMGKAKYFFALSGTLLAIGWGAILFKGGIKY |
| Ga0187771_111970661 | 3300018088 | Tropical Peatland | MIELFKQPNIDWMGKAKYFFGLSGLLLLIGWSAIYF |
| Ga0179592_100258243 | 3300020199 | Vadose Zone Soil | MIELFKQPNLDWMGKAKYFYALSGILLLAGWASILFGSGI |
| Ga0210407_100837801 | 3300020579 | Soil | MIEFFKEPNIDWMGKAKYFYALSGILLLAGWTSIFLNHGL |
| Ga0210407_103751092 | 3300020579 | Soil | MIELFKEPNIDWMGKAKYFYALSGILLIAGWASIFMNGG |
| Ga0210407_109471872 | 3300020579 | Soil | MIELFQQPNLDWMGKAKYFFALSGTLLLIGWAAIFLKGG |
| Ga0210407_111025011 | 3300020579 | Soil | MIELFKQPNIDWMGKAKYFFALSGILLLAGWTSIFFKGG |
| Ga0210399_104288802 | 3300020581 | Soil | MIELFKEPNIDWMGKAKYFYALSGILLIAGWTSII |
| Ga0210399_113069621 | 3300020581 | Soil | MIELFKQPNIDWMGKAKYFFALSGILLLAGWTSIYF |
| Ga0210395_106992662 | 3300020582 | Soil | MIEFFKEPNIDWMGKAKYFYGLSAILLIAGLISWLHEG |
| Ga0210401_109958732 | 3300020583 | Soil | MIELFKQPNIDWMGKAKYFFALSGLLLIIGWSAILFKGG |
| Ga0210404_100252991 | 3300021088 | Soil | MIELFKQPNIDWMGKAKYFFALSGILLLAGWTSIFFK |
| Ga0210404_107080022 | 3300021088 | Soil | MIEFFKEPNIDWMGKAKYFYALSGILLLAGWTSVFLNHG |
| Ga0210406_105300732 | 3300021168 | Soil | MIEFFKEPNIDWMGKAKYFYALSGILLLAGWISVFLNHG |
| Ga0210406_109283731 | 3300021168 | Soil | MIELFKEPNINWMGKAKYFYALSGILLIAGWTSIFMHGGL |
| Ga0210388_100435335 | 3300021181 | Soil | MIELFKEPKIDWMGKAKYFYALSGILLIAGWTSIF |
| Ga0210397_106543062 | 3300021403 | Soil | MIELFKQPNIDWMGKAKYFFALSGLLLIIGWSAILFKGGIKYG |
| Ga0210397_111043511 | 3300021403 | Soil | MEFFKQTNINWMGKAKYFFALSGTLLIIGIAACVH |
| Ga0210394_102895391 | 3300021420 | Soil | MIELFKQPNLDWMGKAKYFFALSGTLLLIGWASIF |
| Ga0213879_102182461 | 3300021439 | Bulk Soil | MIELFKQPNIDWMGKAKYFFALSGLLLLIGWSAILLKGGIKYGI |
| Ga0247688_10294431 | 3300024186 | Soil | MIEFFKEPNIDWMGKAKYFYGLSAILLIAGVISIYHE |
| Ga0207699_106840481 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MIEFFKEPNIDWMGKAKYFYALSAILLLAGWTSIFMNH |
| Ga0207693_104197183 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MIEFFKEPNIDWMGKAKYFYALSGILLIAGVISIFH |
| Ga0207663_117189011 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MIEFFKEPNIDWMGKAKYFYALSALLLLAGWTSISLPSIRTTV |
| Ga0207665_100805721 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MIEFFKEPNIDWMGKAKYFYALSGILLIAGVISIF |
| Ga0209268_11823972 | 3300026314 | Soil | MIELFKQPNINWMGKAKYFFVLSGILLLAGWTSIFFGRG |
| Ga0209801_10038259 | 3300026326 | Soil | MIELFKQPNIDWMGKAKYFFVLSGILLLAGWTSIFFKGGL |
| Ga0209266_12102681 | 3300026327 | Soil | MIELFKQPNIDWMGKAKYFYALSGILLLAGWTSILFGRG |
| Ga0257160_10838211 | 3300026489 | Soil | MIELFKQPNLHWMDKAKYFFALSGALLVIGWAAIFFHGGM |
| Ga0209806_12832982 | 3300026529 | Soil | MIELFKQPNIDWMGKAKYFFALSGILLLAGWTSIFFKGGLR |
| Ga0209474_100961061 | 3300026550 | Soil | MIELFKQPNINWMGKAKYFFVLSGFLLLAGWTSIFF |
| Ga0179593_12411517 | 3300026555 | Vadose Zone Soil | MIELFKQPNLDWVGKAKYFFALSGTLLIVGWASYFLSRWHEVRH |
| Ga0207802_10175182 | 3300026847 | Tropical Forest Soil | MIELFKQPNIDWMGKAKYFFALSGLLLVIGWSAIFLKGGIK |
| Ga0207859_10197212 | 3300026859 | Tropical Forest Soil | MIELFKQPNIDWMGKAKYFFALSGLLLVIGWSAILLKGGIKY |
| Ga0207762_10083501 | 3300027063 | Tropical Forest Soil | MIELFKQPNIDWMGKAKYFFALSGLLLVIGWSAILLKGGI |
| Ga0207948_10206321 | 3300027174 | Forest Soil | MIELFKQPNIDWMGKAKYFYALSGILLLAGWISILFCSGI |
| Ga0208988_10978331 | 3300027633 | Forest Soil | MIELFKQPNINWMGKAKYFYALSGILLLAGWTSII |
| Ga0209076_11584221 | 3300027643 | Vadose Zone Soil | MIELFKQPNIDWMGKAKYFYALSGILLLAGWASILF |
| Ga0209588_10682571 | 3300027671 | Vadose Zone Soil | MIELFKQPNIDWMGKAKYFFALSGILLLAGWTSIFFKGGLRY |
| Ga0209446_10580992 | 3300027698 | Bog Forest Soil | MIELFKEPNIDWMGKAKYFYALSGLLLIAGWTSIFL |
| Ga0209811_101179392 | 3300027821 | Surface Soil | MIELFKEPNIDWMGKAKYFFALSAILLIAGWISIFAK |
| Ga0209590_107805411 | 3300027882 | Vadose Zone Soil | MIELFKQPNLDWMGKAKYFYALSGILLLAGWTSIFF |
| Ga0209415_101355131 | 3300027905 | Peatlands Soil | MIELFKQPNLDWMGKAKFFFTLSGLLLLIGWSAIFLKGGIKYG |
| Ga0209698_101351361 | 3300027911 | Watersheds | MIELFKQPNLDWMGKAKYFYALSGILLLAGWASIFFGSGIRYG |
| Ga0137415_108572091 | 3300028536 | Vadose Zone Soil | MIELFKQPNINWMGKAKYFYALSGILLLAGWTSIIVN |
| Ga0075377_106514192 | 3300030844 | Soil | MIELFKQPNIDWMGKAKYFFLLSGTLLVVGWAAIFFKGGIK |
| Ga0307469_108788971 | 3300031720 | Hardwood Forest Soil | MIELFQQPNLDWMGKAKYFFALSGALLIIGWASIF |
| Ga0306918_109991512 | 3300031744 | Soil | MIELFKQPDIDWMGKAKYFFALSGLLLLIGWSAIY |
| Ga0318526_101851332 | 3300031769 | Soil | MIELFKQPNLDWMGKAKYFYALSGILLLAGWTSIFFG |
| Ga0318576_100521211 | 3300031796 | Soil | MIELFKQPNIDWMGKAKYFFALSGLLLVIGWSAIFLK |
| Ga0318568_102478341 | 3300031819 | Soil | MIELFKQPNIDWMGKAKYFFALSGLLLVIGWSAILFRGGIK |
| Ga0307473_104789932 | 3300031820 | Hardwood Forest Soil | MIELFKQPNINWMGKAKYFYALSGILLLAGWTSIIV |
| Ga0307478_103224931 | 3300031823 | Hardwood Forest Soil | MIEFFKEPNIDWMGKAKYFYALSGILLLAGWTSVFLNH |
| Ga0307478_115701041 | 3300031823 | Hardwood Forest Soil | MIELFKQPNIDWMGKAKYFFALSAILLLTGWTAIFLKGGPAK |
| Ga0318517_101167852 | 3300031835 | Soil | MIELFKQPNIDWMGKAKYFFALSGLLLVIGWSAIF |
| Ga0310912_104460632 | 3300031941 | Soil | MIELFKQPNIDWMGKAKYFFALSGLLLVIGWSAIFL |
| Ga0318563_104051231 | 3300032009 | Soil | MIEFFKEPNIDWMGKAKYFYVLSGILLLAGWVSIFA |
| Ga0318575_100209064 | 3300032055 | Soil | MIELFKQPNIDWMGKAKYFFALSGLLLVIGWSAIL |
| Ga0335078_100833625 | 3300032805 | Soil | MIEIFKQPNIDWMGKAKYFFALSGLLLLLGWSAIYFKG |
| Ga0335081_108699451 | 3300032892 | Soil | MIELFRQPNIDWMGKAKYFFALSGLLLAIGWAAIFLKGGIK |
| Ga0335076_104688221 | 3300032955 | Soil | MIELFKQPNIDWMGKAKYFFALSGLLLIIGWSAILFKGGIKY |
| Ga0335073_108560161 | 3300033134 | Soil | MIELFKQPNIDWMGKAKYFFALSLLLLIIGWSAIFLKGGIK |
| Ga0310914_116912151 | 3300033289 | Soil | MIELFKQPNLDWMGKAKYFYALSGILLLAGWTSIFFGH |
| ⦗Top⦘ |