| Basic Information | |
|---|---|
| Family ID | F083688 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 112 |
| Average Sequence Length | 42 residues |
| Representative Sequence | ALQRSSNVDELQEMINRGASLLNRPTTAGTTLARGAAPSKH |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 88.39 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.607 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.107 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.464 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.43% β-sheet: 0.00% Coil/Unstructured: 69.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF00482 | T2SSF | 84.82 |
| PF00989 | PAS | 1.79 |
| PF00158 | Sigma54_activat | 0.89 |
| PF14559 | TPR_19 | 0.89 |
| PF12704 | MacB_PCD | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001098|JGI12633J13313_105993 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 548 | Open in IMG/M |
| 3300004082|Ga0062384_100451815 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300004157|Ga0062590_101139494 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300005435|Ga0070714_100021617 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 5265 | Open in IMG/M |
| 3300005436|Ga0070713_101505332 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300005712|Ga0070764_10479168 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300005712|Ga0070764_10584326 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
| 3300005764|Ga0066903_106875560 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300005888|Ga0075289_1068747 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 575 | Open in IMG/M |
| 3300006028|Ga0070717_10198442 | All Organisms → cellular organisms → Bacteria | 1756 | Open in IMG/M |
| 3300006052|Ga0075029_100666276 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300006162|Ga0075030_100204859 | All Organisms → cellular organisms → Bacteria | 1588 | Open in IMG/M |
| 3300007982|Ga0102924_1241298 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300009521|Ga0116222_1514411 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300009639|Ga0116122_1090998 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300010048|Ga0126373_12760106 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300010360|Ga0126372_10013384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 4524 | Open in IMG/M |
| 3300010366|Ga0126379_13243713 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300010376|Ga0126381_100977649 | All Organisms → cellular organisms → Bacteria | 1221 | Open in IMG/M |
| 3300010376|Ga0126381_101394182 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300010376|Ga0126381_104070141 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300010376|Ga0126381_104470943 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300010379|Ga0136449_103097148 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300012209|Ga0137379_10807149 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300012211|Ga0137377_11409273 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300012350|Ga0137372_10797291 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300012357|Ga0137384_10624977 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300012361|Ga0137360_11353261 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300012362|Ga0137361_10145315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2115 | Open in IMG/M |
| 3300012944|Ga0137410_12049456 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300012960|Ga0164301_11339377 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300014156|Ga0181518_10054451 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2384 | Open in IMG/M |
| 3300014168|Ga0181534_10754352 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300015052|Ga0137411_1035655 | All Organisms → cellular organisms → Bacteria | 1344 | Open in IMG/M |
| 3300015052|Ga0137411_1201364 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
| 3300017928|Ga0187806_1332164 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300017930|Ga0187825_10279308 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300017942|Ga0187808_10583327 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300017959|Ga0187779_10522915 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300017970|Ga0187783_10642617 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300017972|Ga0187781_10403705 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300018007|Ga0187805_10438645 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300018043|Ga0187887_10675046 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300018058|Ga0187766_10701475 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300018060|Ga0187765_11031118 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300018086|Ga0187769_10783933 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300018086|Ga0187769_11054161 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300018433|Ga0066667_12132651 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300018482|Ga0066669_10429826 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
| 3300019789|Ga0137408_1404428 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300020010|Ga0193749_1021253 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
| 3300020579|Ga0210407_10994816 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300020580|Ga0210403_11272032 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300020583|Ga0210401_10089540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2894 | Open in IMG/M |
| 3300021088|Ga0210404_10345243 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300021170|Ga0210400_10333118 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
| 3300021178|Ga0210408_11056611 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300021403|Ga0210397_10233802 | All Organisms → cellular organisms → Bacteria | 1327 | Open in IMG/M |
| 3300021404|Ga0210389_10538618 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300021405|Ga0210387_11075204 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300021479|Ga0210410_10216023 | All Organisms → cellular organisms → Bacteria | 1719 | Open in IMG/M |
| 3300022532|Ga0242655_10106123 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300025434|Ga0208690_1003627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4037 | Open in IMG/M |
| 3300026116|Ga0207674_11079610 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300026335|Ga0209804_1315221 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300026467|Ga0257154_1050907 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300026532|Ga0209160_1110463 | All Organisms → cellular organisms → Bacteria | 1372 | Open in IMG/M |
| 3300027528|Ga0208985_1110286 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300027692|Ga0209530_1118242 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300027773|Ga0209810_1210406 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300027824|Ga0209040_10497004 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300027853|Ga0209274_10113080 | All Organisms → cellular organisms → Bacteria | 1347 | Open in IMG/M |
| 3300027867|Ga0209167_10295719 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300027867|Ga0209167_10332647 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300027869|Ga0209579_10167039 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
| 3300027884|Ga0209275_10007518 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4588 | Open in IMG/M |
| 3300028037|Ga0265349_1020740 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300028572|Ga0302152_10077869 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300028788|Ga0302189_10224185 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300028789|Ga0302232_10531029 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 578 | Open in IMG/M |
| 3300028873|Ga0302197_10114271 | All Organisms → cellular organisms → Bacteria | 1342 | Open in IMG/M |
| 3300028906|Ga0308309_11546598 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300029944|Ga0311352_10432360 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
| 3300029953|Ga0311343_11103750 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300030399|Ga0311353_10348431 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
| 3300030503|Ga0311370_10237514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2414 | Open in IMG/M |
| 3300030659|Ga0316363_10429354 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300030759|Ga0265745_1016754 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300030906|Ga0302314_11872854 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300031028|Ga0302180_10349240 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300031231|Ga0170824_126056653 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300031234|Ga0302325_10047365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8604 | Open in IMG/M |
| 3300031474|Ga0170818_112527148 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300031708|Ga0310686_105663285 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300031718|Ga0307474_10329731 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
| 3300031718|Ga0307474_10487481 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300031823|Ga0307478_10007000 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7799 | Open in IMG/M |
| 3300031823|Ga0307478_10189992 | All Organisms → cellular organisms → Bacteria | 1648 | Open in IMG/M |
| 3300031890|Ga0306925_11707024 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300031912|Ga0306921_10472109 | All Organisms → cellular organisms → Bacteria | 1460 | Open in IMG/M |
| 3300031912|Ga0306921_11733116 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300032180|Ga0307471_101563564 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300032828|Ga0335080_10111498 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3036 | Open in IMG/M |
| 3300032828|Ga0335080_12304128 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300032898|Ga0335072_10192858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2428 | Open in IMG/M |
| 3300032898|Ga0335072_11248802 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300032954|Ga0335083_10560387 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300033134|Ga0335073_10247514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2174 | Open in IMG/M |
| 3300033158|Ga0335077_10530403 | All Organisms → cellular organisms → Bacteria | 1240 | Open in IMG/M |
| 3300033158|Ga0335077_11661661 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300033289|Ga0310914_10270414 | All Organisms → cellular organisms → Bacteria | 1530 | Open in IMG/M |
| 3300034125|Ga0370484_0038211 | All Organisms → cellular organisms → Bacteria | 1163 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.61% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.93% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 7.14% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.25% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.25% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.46% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.46% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.46% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.57% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.57% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 3.57% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.68% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.68% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.79% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.79% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.79% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.79% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.79% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.79% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.79% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.89% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.89% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.89% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001098 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005888 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009639 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020010 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025434 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300027528 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028037 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 | Environmental | Open in IMG/M |
| 3300028572 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300028788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028873 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029953 | II_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030759 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12633J13313_1059931 | 3300001098 | Forest Soil | QISLEVALQRSSNVDELQEMINRGASLTNRGAAGGGAAKGAASSKH* |
| Ga0062384_1004518151 | 3300004082 | Bog Forest Soil | KEITLETAMARSSNTDELQEMINRGATLTSRSNSATALAKGAAPSKR* |
| Ga0062590_1011394942 | 3300004157 | Soil | KQISMETAMARSSNVDELTEMINRGASLLNRPTAAGTTLARGAAPSKH* |
| Ga0070714_1000216175 | 3300005435 | Agricultural Soil | AMARSSNVDELQEMINRGASLINRPTAAGTTLARGAAPSKH* |
| Ga0070713_1015053321 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | SMETAIARSSNVDELQEMISRGASLLSRPTSTGSSLARGAAPSKH* |
| Ga0070764_104791681 | 3300005712 | Soil | SSNVDELQEMINRGASLLNRGTAAGSTMARGAAPSKH* |
| Ga0070764_105843261 | 3300005712 | Soil | SLEVALQRSSNVDELQEMINRGASLTNRGAAGGGAAKGAASSKH* |
| Ga0066903_1068755601 | 3300005764 | Tropical Forest Soil | RSSNVDELQEMINRGASLLNRPTSAGGALARGAASKH* |
| Ga0075289_10687471 | 3300005888 | Rice Paddy Soil | ITIETALQRSSMPDELQEMINRGASLLGRGQPGHAAGSMVRGAAAPGKR* |
| Ga0070717_101984421 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | ISMETAMARSSNVDELTEMINRGASLLNRPTAAGTTLARGAAPSKH* |
| Ga0075029_1006662762 | 3300006052 | Watersheds | SSNVDELQEMINRGASLLTRPTTAGTTMARGAAPSKH* |
| Ga0075030_1002048592 | 3300006162 | Watersheds | LETAMARSSNTDELQEMINRGATLVNRPTAAGTTLARGAAPSKH* |
| Ga0102924_12412982 | 3300007982 | Iron-Sulfur Acid Spring | SLEVAMARSSNTDELQEMINRGATLLNRPTAAGTTMARGAAPSKR* |
| Ga0116222_15144112 | 3300009521 | Peatlands Soil | SSNVDELHEMINRGASLLNRPSTAGTTLARGAAPSKR* |
| Ga0116122_10909981 | 3300009639 | Peatland | VDELQEMINRGATLTNRATTAGTTLARGAAPSKH* |
| Ga0126373_127601061 | 3300010048 | Tropical Forest Soil | MARSSNPDELTEMINRGASLLNRPTTAGGTLARGAAPSKH* |
| Ga0126372_100133844 | 3300010360 | Tropical Forest Soil | IARSSNVDELTEMINRGASLLSRPTAAASSGLARGAGKH* |
| Ga0126379_132437132 | 3300010366 | Tropical Forest Soil | VARSSNADELQEMIARGASLLQRPTAAGSMAAKAGAPGKR* |
| Ga0126381_1009776491 | 3300010376 | Tropical Forest Soil | VARSSNADELQEMIARGASLLQRPTAAGSMAAKAGSSAKR* |
| Ga0126381_1013941821 | 3300010376 | Tropical Forest Soil | NVDELQEMINRGASLLNRPTSAGGALARGAASKH* |
| Ga0126381_1040701412 | 3300010376 | Tropical Forest Soil | ARSSNVDELQEMINRGASLLSRPTTAGTTLARGAAPSKH* |
| Ga0126381_1044709431 | 3300010376 | Tropical Forest Soil | RSSNADELQEMIARGASLLQRPTAAGSMAAKAGAPGKR* |
| Ga0136449_1030971482 | 3300010379 | Peatlands Soil | SLEVALQRSSNVDELQEMINRGASLLNRPTTAGTTLARGAASSKH* |
| Ga0137379_108071491 | 3300012209 | Vadose Zone Soil | SMEVAMARSSNQDELQEMINRGASLVGRQGAGATAARGTATGKH* |
| Ga0137377_114092732 | 3300012211 | Vadose Zone Soil | SSNVDELQEMINRGASLLHRPTAAGTTLARGAAPSKH* |
| Ga0137372_107972911 | 3300012350 | Vadose Zone Soil | NVDELQEMINRGASLLHRPTAAGTTLARGAAPSKH* |
| Ga0137384_106249772 | 3300012357 | Vadose Zone Soil | ETAMARSSNTDELQEMINRGASLTNRPTTAGTTLARGAAPSKH* |
| Ga0137360_113532611 | 3300012361 | Vadose Zone Soil | SNVDELQEMINRGASLLSRGTTTGATLARGTASSKH* |
| Ga0137361_101453151 | 3300012362 | Vadose Zone Soil | ITLEVAMARSSNQDELQEMINRGASLAGRQAGAGTARGTATGKH* |
| Ga0137410_120494562 | 3300012944 | Vadose Zone Soil | MEVAMARSSNQDELTEMIARGANLLNRPTAAGTLAKAAAPTKR* |
| Ga0164301_113393772 | 3300012960 | Soil | ISMETAMARSSNVDELTEMINRGASLLNRSTAAGTTLARGAAPSKH* |
| Ga0181518_100544513 | 3300014156 | Bog | ELALQRSSNVDELQEMINRGASLLNRPTTAGTTLARGAAPSKH* |
| Ga0181534_107543521 | 3300014168 | Bog | RSSNPEELQEMINRGAGLMNRGAAAGTPLAKGAAPAKH* |
| Ga0137411_10356551 | 3300015052 | Vadose Zone Soil | AYYQKQITMEVAMARSSNQDELTEMISRGANLLNRPTTAASTMARAAAPTKR* |
| Ga0137411_12013641 | 3300015052 | Vadose Zone Soil | LATAAYYQKQITMEVAMARSSNQDELTEMISRGANLLNRPTTAASTMARAAAPTKR* |
| Ga0187806_13321641 | 3300017928 | Freshwater Sediment | QISLEVAMARSSNVDELQEMINRGASLLTRPTTAGSALARGAAPSKH |
| Ga0187825_102793081 | 3300017930 | Freshwater Sediment | AYFQKLISMETAMARSSNVDELTEMINRGASLLNRPTAAGTTMARGAAPSKH |
| Ga0187808_105833271 | 3300017942 | Freshwater Sediment | QKQISLEVALQRSSNVDELQEMINRGASLLNRPAAGSSAMARGAAGKH |
| Ga0187779_105229152 | 3300017959 | Tropical Peatland | ETALQRSSNVDELQEMINRGASLLNRPTTANASMAKGAAGKH |
| Ga0187783_106426172 | 3300017970 | Tropical Peatland | SLETALQRSSNQDELQEMINRGASLLSRPTTAGSVMAKAATPAKR |
| Ga0187781_104037052 | 3300017972 | Tropical Peatland | ALQRSSNVDELQEMINRGASLLNRPTTAGTTLARGAAPSKH |
| Ga0187805_104386451 | 3300018007 | Freshwater Sediment | TAMARSSNTDELQEMINRGASLVNRPTNAGSVLARGAAPSKR |
| Ga0187887_106750461 | 3300018043 | Peatland | QISLEVAMARSSNVDELQEMINRGASLTNRPTSAGGTMARGAAPSKH |
| Ga0187766_107014752 | 3300018058 | Tropical Peatland | SSNQDELQEMISRGASLLNRPTAASTSMARAATPTKR |
| Ga0187765_110311182 | 3300018060 | Tropical Peatland | FQKQISLETAMARSSNVDELQEMINRGASLLSRPTTAGTALARGAAPSKH |
| Ga0187769_107839331 | 3300018086 | Tropical Peatland | FQKQISLEMALQRSSNVDELQEMINRGASLLNRPTTAGTTLARGAAPSKH |
| Ga0187769_110541611 | 3300018086 | Tropical Peatland | TAYAQRKITLETALACSSNQDELQEMINRGTSLLTRNQAMSKGAAHSRH |
| Ga0066667_121326511 | 3300018433 | Grasslands Soil | ITLEVATARSSNQDELQEMIARGASLLNRPTAAGTVMARAASPGKK |
| Ga0066669_104298261 | 3300018482 | Grasslands Soil | KQISMETAIARSSNVDELQEMISRGASLLSRQTTAGSSLARGAAPSKH |
| Ga0137408_14044281 | 3300019789 | Vadose Zone Soil | SGHGAIQMARSSNQDELTEMISRGANLLNRPTTAGTTMARAAAPTKR |
| Ga0193749_10212531 | 3300020010 | Soil | SSNQDELQEMINRGASLAGRQGAGAAAARGTATGKH |
| Ga0210407_109948162 | 3300020579 | Soil | ETAMARSSNQEELQEMINRGASLLNRGGTPGSAMAKGAASKH |
| Ga0210403_112720322 | 3300020580 | Soil | LEVALARSSNQEELQEMINRGASLLNRGGTAGAAKGAASK |
| Ga0210401_100895401 | 3300020583 | Soil | EITLETAMARSSNTDELQEMINRGATLVNRPTAAGTTLARGAAPSKH |
| Ga0210404_103452431 | 3300021088 | Soil | SMETAIARSSNVDELQEMISRGASLLSRPTAAGSSLARGAAPSKH |
| Ga0210400_103331182 | 3300021170 | Soil | AMARSSNTDELQEMINRGASLTNRPTTAGTTLARGAAPSKR |
| Ga0210408_110566111 | 3300021178 | Soil | QKQISLETAMARSSNTDELQEMINRGASLLTRPTTAGTTLARGAAPSKH |
| Ga0210397_102338022 | 3300021403 | Soil | KQISIETAMSRSSNVDELQEMINRGASLLNRGATTPLAKGAAPAKR |
| Ga0210389_105386182 | 3300021404 | Soil | AMARSSNVDELQEMINRGASLLNRPTSGGATLAKGAASKH |
| Ga0210387_110752041 | 3300021405 | Soil | ISLEVAMARSSNTDELQEMINRGATLLNRPTAAGTTMARGAAPSKH |
| Ga0210410_102160231 | 3300021479 | Soil | ITLETAMARSSNTDELQEMINRGATLTSRPTAGTTLAKGAAPSKH |
| Ga0242655_101061232 | 3300022532 | Soil | ARSSNPDELQEMINRGASLVNRPTTAGTTLARGAAGAKH |
| Ga0208690_10036271 | 3300025434 | Peatland | MARSSNTDELQEMINRGATLTSRSNTGATLAKGAAPSKR |
| Ga0207674_110796101 | 3300026116 | Corn Rhizosphere | QKQISMETAMARSSNVDELTEMINRGASLLNRPTAAGTTLARGAAPSKH |
| Ga0209804_13152212 | 3300026335 | Soil | LARSSNQDELQEMINRGASLAGRQGAGAAAARGTATGKH |
| Ga0257154_10509071 | 3300026467 | Soil | TCLQRSSNVDELQEMINRGAGIANRGGTAAKGAASSKH |
| Ga0209160_11104632 | 3300026532 | Soil | SNVDELQEMINRGASLLSRTPAGGTAMAKGAATAKR |
| Ga0208985_11102861 | 3300027528 | Forest Soil | SSNTDELQEMINRGASLTNRGGTAGAAQARGAATSKH |
| Ga0209530_11182421 | 3300027692 | Forest Soil | SNVDELQEMINRGASLTNRGAAGGAAAKGAASSKH |
| Ga0209810_12104061 | 3300027773 | Surface Soil | QISLETAMARSSVPDELRDMIDRGAGLINRPATAAPLAKGAATMKR |
| Ga0209040_104970042 | 3300027824 | Bog Forest Soil | SSNPDELQEMINRGASLTNRGGGTAPAMARGAAPTKR |
| Ga0209274_101130801 | 3300027853 | Soil | TALQRSSNQDELQEMINRGAGLTNRGGASGSNMARGAVPKG |
| Ga0209167_102957192 | 3300027867 | Surface Soil | QRSSNPEELQEMINRGATLTNRGGSTSSPAARAAAKS |
| Ga0209167_103326472 | 3300027867 | Surface Soil | TLETAMARSSNTDELQEMINRGASLSNRPTAGGTTLAKGAAPSKH |
| Ga0209579_101670392 | 3300027869 | Surface Soil | ALARSSNVDELQEMINRGASLVNRPTAAGTTMARGAAPSKH |
| Ga0209275_100075184 | 3300027884 | Soil | TAMARSSNQEELQEMINRGASLLNRGGAAGAAARGAGSKG |
| Ga0265349_10207402 | 3300028037 | Soil | VSLETCLARSSNQEELQEMINRGASLMSRGTTPGSSMAKGAHSKG |
| Ga0302152_100778692 | 3300028572 | Bog | LQRSSNPEELQEMINRGATLSNRGGTTGSALARGATQSKG |
| Ga0302189_102241852 | 3300028788 | Bog | QVTIEVALQRSSNPDELQEMINRGATLTNRGGSTGSATAKGAATAKG |
| Ga0302232_105310291 | 3300028789 | Palsa | FQKQVTLEVALQRSSNPEELQEMINRGATLTNRGGNTGSAIARGAAKS |
| Ga0302197_101142711 | 3300028873 | Bog | SNPEELQEMINRGASLLSRGAQPGSPMAKGATPAKH |
| Ga0308309_115465981 | 3300028906 | Soil | LQRSSNQDELQEMINRGAGLTNRGGASGSNMARGAVPKG |
| Ga0311352_104323602 | 3300029944 | Palsa | QRSSNQDELQEMINRGAGLTNRGGTPGSTMARGATPTKG |
| Ga0311343_111037501 | 3300029953 | Bog | EVALHRSSMPDELQEMINRGAGLTTRNAAGTSMARGATPTKG |
| Ga0311353_103484312 | 3300030399 | Palsa | LETALQRSSNQDELQEMINRGAGLTNRGGTSGSNMARGAVPKG |
| Ga0311370_102375141 | 3300030503 | Palsa | RSSNTDELQEMINRGASLLNRNNPGANLAKGAAPSKH |
| Ga0316363_104293542 | 3300030659 | Peatlands Soil | RSSNPDELQEMINRGAGLVNKPTVAGAGLAKGAAPAKR |
| Ga0265745_10167542 | 3300030759 | Soil | ARSSNQEELQEMINRGASLLNRGGAAGAAARGAGSKG |
| Ga0302314_118728541 | 3300030906 | Palsa | FQKEITLETAMARSSNTDELQEMINRGATLTSRSNSGATLAKGAAPSKR |
| Ga0302180_103492401 | 3300031028 | Palsa | EVALQRSSNVDELQEMINRGASLTNRGAAGAAAAKGAASSKH |
| Ga0170824_1260566531 | 3300031231 | Forest Soil | ETAMARSSNTDELQEMINRGASLTNRPTTAGTTLARGAAPSKH |
| Ga0302325_100473651 | 3300031234 | Palsa | EITLETAMARSSNTDELQEMINRGATLTSRSNSGATLAKGAAPSKR |
| Ga0170818_1125271481 | 3300031474 | Forest Soil | SNTDELQEMINRGASLTNRPTTAGTTLARGAAPSKH |
| Ga0310686_1056632851 | 3300031708 | Soil | SSNPEELQEMINRGAGLVNRGAAGSTMARGATPAKG |
| Ga0307474_103297311 | 3300031718 | Hardwood Forest Soil | FQKQISLEVAMARSSNTDELQEMINRGATLLNRPTAAGTTMARGAASSKH |
| Ga0307474_104874811 | 3300031718 | Hardwood Forest Soil | KQVALEVALQRSSNPEELQEMINRGAGLTNRSTATTGSGLAKGAAPAKR |
| Ga0307478_100070001 | 3300031823 | Hardwood Forest Soil | KQVTIETALQRSSNPEELQEMINRGASLTNRGGSTGSAIARGAAKS |
| Ga0307478_101899921 | 3300031823 | Hardwood Forest Soil | IALEVALQRSSNPDELQEMINRGAGLTNRATATGATMAKGAAPAKR |
| Ga0306925_117070242 | 3300031890 | Soil | SLEVAMARSSNVDELQEMINRGASLMSRPTTAGTTLARGAAGKH |
| Ga0306921_104721092 | 3300031912 | Soil | QKQISMETAIARSSNVDELTEMINRGASLLSRPTSAASSGLARGAGKH |
| Ga0306921_117331161 | 3300031912 | Soil | IEVAVARSSNADELQEMIARGASLLQRPTAAGSMAAKAGSSAKR |
| Ga0307471_1015635641 | 3300032180 | Hardwood Forest Soil | YQKQISLEVAMARSSNQDELTEMISRGANLLNRPTTAGTTMARAAAPTKR |
| Ga0335080_101114983 | 3300032828 | Soil | QKQISLETALARSSNVDELQEMINRGASLMSRPTSASSSLARGAATSKH |
| Ga0335080_123041281 | 3300032828 | Soil | MQRSSNVDELQEMINRGASLLSRPTAAGTTLARGAAPSKH |
| Ga0335072_101928583 | 3300032898 | Soil | LARSSNVDELQEMINRGASLLSRPTSAGSSLARGAATSKH |
| Ga0335072_112488021 | 3300032898 | Soil | QVSLEVALQRSSNQDELQEMINRGASLLTRPTAGAAMAKGAATAKR |
| Ga0335083_105603871 | 3300032954 | Soil | ARSSNVDELQEMINRGASLLSRPTTAGTQLARGAAGKH |
| Ga0335073_102475141 | 3300033134 | Soil | ETALQRSSNPDELQEMINRGATLANRAGTPGSSMARGAATSKH |
| Ga0335077_105304032 | 3300033158 | Soil | LSRSSNVDELQEMINRGASLLNRNQPMAKGAAPKH |
| Ga0335077_116616611 | 3300033158 | Soil | QRSSNQDELQEMINRGASLLNRPTAAGTMARGAAPAKR |
| Ga0310914_102704141 | 3300033289 | Soil | TAIARSSNVDELTEMINRGASLLSRPTSAASSGLARGAGKH |
| Ga0370484_0038211_1026_1163 | 3300034125 | Untreated Peat Soil | SLETAMARSSNVDELQEMINRGASLLNRPTTAGTTLARGAAPSKH |
| ⦗Top⦘ |