Basic Information | |
---|---|
Family ID | F083608 |
Family Type | Metagenome |
Number of Sequences | 112 |
Average Sequence Length | 39 residues |
Representative Sequence | VAKLMEAAEGPGTALATLFEEEVVPPLPSADAEGPEP |
Number of Associated Samples | 65 |
Number of Associated Scaffolds | 112 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 17.43 % |
% of genes near scaffold ends (potentially truncated) | 79.46 % |
% of genes from short scaffolds (< 2000 bps) | 97.32 % |
Associated GOLD sequencing projects | 65 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.25 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (95.536 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (91.964 % of family members) |
Environment Ontology (ENVO) | Unclassified (92.857 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (92.857 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 27.69% β-sheet: 0.00% Coil/Unstructured: 72.31% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.25 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 112 Family Scaffolds |
---|---|---|
PF00385 | Chromo | 0.89 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 95.54 % |
All Organisms | root | All Organisms | 4.46 % |
Visualization |
---|
Powered by ApexCharts |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 91.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.68% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.79% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.79% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.89% |
Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 0.89% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300015267 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015274 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015275 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015276 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015277 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015279 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015281 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015285 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015286 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015288 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015289 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015291 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015294 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015295 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015296 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015299 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015300 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015302 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015303 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015304 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015305 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015308 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015314 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015322 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015323 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015342 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015343 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015344 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015345 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015346 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015347 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015351 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015355 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017404 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017407 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017409 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017410 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017411 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017413 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017415 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017420 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017424 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017425 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017427 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017430 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017433 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017436 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017438 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017442 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017443 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017680 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017682 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017683 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017685 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017686 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017689 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017690 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300021060 | Phyllosphere microbial comminities from miscanthus, Michigan, USA - G6R3_NF_07NOV2016_LD2 MG | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0068869_1009246431 | 3300005334 | Miscanthus Rhizosphere | LTADKVVTKLLEAAEGPGTALATLFEEEVVPPPLSTDARDAEP* |
Ga0068870_113120351 | 3300005840 | Miscanthus Rhizosphere | KLMEAAEGPGTALATLFEEEVVPPLPSTGAEGPEP* |
Ga0105242_112447941 | 3300009176 | Miscanthus Rhizosphere | AEVVRLLEAAEAPGTALAKLFEEEVVPPAPAADL* |
Ga0157378_102609803 | 3300013297 | Miscanthus Rhizosphere | VAKLMEAAEGPGTALATLFEEEVVPPLPSADAEGPEP* |
Ga0157378_126939251 | 3300013297 | Miscanthus Rhizosphere | TKLMEAAEGLGAALAGLFEEEVVPPPPSADARDPAP* |
Ga0182122_10289881 | 3300015267 | Miscanthus Phyllosphere | VDAVVTKLMEAMEGPGSALAMLFEEEVVPPLPPAGVEGFEP* |
Ga0182188_10165751 | 3300015274 | Miscanthus Phyllosphere | MKLVEAAEAPGKALASLFEEEVVPPTPSADAGDPEF* |
Ga0182172_10421361 | 3300015275 | Miscanthus Phyllosphere | TKLMEAAEGPGTALATLFEEEVVPPLPSADAGGPKP* |
Ga0182172_10437091 | 3300015275 | Miscanthus Phyllosphere | DDEEADAAVAKLMEAAEGPGTALATLFEEEVVPLLPSADAEGPEP* |
Ga0182172_10585881 | 3300015275 | Miscanthus Phyllosphere | EEVTKLVEAAEGPGTTLAKLFKEEVVPPTSSADASDPEP* |
Ga0182172_10636141 | 3300015275 | Miscanthus Phyllosphere | EVMKLVEATEGPSMALAKLFEEEVVPPMPSADAGDPEP* |
Ga0182170_10402631 | 3300015276 | Miscanthus Phyllosphere | VVAKLMEAAEGPGTALAKLFEEEVVAPPPSADAGGLEP* |
Ga0182128_10433131 | 3300015277 | Miscanthus Phyllosphere | AVTKLMEATEGPGTTLATLFEEEVVPPLPSADAGGSEP* |
Ga0182174_10808781 | 3300015279 | Miscanthus Phyllosphere | DEEADEAVAKLIEAVEGPGTALAKLFEEEVVPPPPSADAGGPEP* |
Ga0182160_10141442 | 3300015281 | Miscanthus Phyllosphere | ANEAVAKLIEAAEGPSTALAKLFEEEVVPPPPSIDAGGPEP* |
Ga0182160_10157701 | 3300015281 | Miscanthus Phyllosphere | DEEEADAAVTRLMEAAEGPGTALATLFEEEVVPPLPSAGAEGPKP* |
Ga0182160_10209241 | 3300015281 | Miscanthus Phyllosphere | VLPDDDEEADAAVMKLMEATEGPGTALATLFEEEVVPPLPSAGAEGPEP* |
Ga0182186_10405421 | 3300015285 | Miscanthus Phyllosphere | VNKEVAKLMEAAEGLGMALAKLFEEEVVPPTSSADAGDPKA* |
Ga0182176_10523311 | 3300015286 | Miscanthus Phyllosphere | DDEEEADEAVTKLMEAAEGPGAALARLFEEEVVPPPPSADAGDPAP* |
Ga0182173_10828041 | 3300015288 | Miscanthus Phyllosphere | VMKLEEAAEAPGTALASLFEEEVVPPTPSADAGDLEF* |
Ga0182138_10335262 | 3300015289 | Miscanthus Phyllosphere | MVEAAEAPGTALARLFEEEVAPPTPSVDAGDPVF* |
Ga0182138_10353691 | 3300015289 | Miscanthus Phyllosphere | AAVTKLMEVAEGPGTALAMLFEEEVVPPLPSADAGGPEA* |
Ga0182125_10255651 | 3300015291 | Miscanthus Phyllosphere | EADEEVTKLMEAAEVPGAALASLFEEEVVPPAPVADAGDPEP* |
Ga0182125_10588601 | 3300015291 | Miscanthus Phyllosphere | MVEAAEAPGTALARLFEEEVAPPMPSVDAGDPVF* |
Ga0182125_10601921 | 3300015291 | Miscanthus Phyllosphere | LKLVEAAEAPGMELAWLFEEEVVPSTPTADAGDPEF* |
Ga0182125_10882661 | 3300015291 | Miscanthus Phyllosphere | MTKLMEAAEGPGAELAGLFEEEVVPPPPSADAGDPTP* |
Ga0182126_10914532 | 3300015294 | Miscanthus Phyllosphere | DEAVTKLMEAAEGPSTALAGLFEEEVVPPPPSADAGDPTP* |
Ga0182175_10247541 | 3300015295 | Miscanthus Phyllosphere | VVAKLIEAAEGPSTALAKLFEEEVVPPPPSADAGGPEP* |
Ga0182175_10735071 | 3300015295 | Miscanthus Phyllosphere | AEVAKLMEAAEAPGTALAKLYEEEVVPPAPAADP* |
Ga0182157_10293521 | 3300015296 | Miscanthus Phyllosphere | AKLMEAAEGPGTALATLFEEEVVPPLPSAGAEGAEP* |
Ga0182107_10143741 | 3300015299 | Miscanthus Phyllosphere | KLMEAAEGPGTALATLFEEEVVPPLPSADAEGPEP* |
Ga0182108_10146871 | 3300015300 | Miscanthus Phyllosphere | EVTKLMEVAEAPSTALASLFEEEVVPPAPTADAGDPEP* |
Ga0182108_10261921 | 3300015300 | Miscanthus Phyllosphere | KLMEAAEGPGMALAKLFEEVVVPPTPSADAGDPEP* |
Ga0182108_10821671 | 3300015300 | Miscanthus Phyllosphere | EEEADEAVTKLMEAAEGPGTALAGLFEEEVVPPPPSAEAGDPTP* |
Ga0182143_10547371 | 3300015302 | Miscanthus Phyllosphere | LMEATEGPGTALAKLFEEEVVPPTLSADAGDPEP* |
Ga0182143_10667581 | 3300015302 | Miscanthus Phyllosphere | VVKLMEAAKGPGTALAMLFEEEVVPPPPSADAGGPEP* |
Ga0182143_10710241 | 3300015302 | Miscanthus Phyllosphere | EVMKLAEAVEAPGAALAWLFEEEVVPPAPPIDAGHPVF* |
Ga0182143_10877491 | 3300015302 | Miscanthus Phyllosphere | LMEAAEGPDAALAGLFEEEVVPPSPSTDAGDPAP* |
Ga0182143_10896141 | 3300015302 | Miscanthus Phyllosphere | TKLMEAAEVPGAALASLFEEEVVPPAPAVDAGDPEP* |
Ga0182123_10562191 | 3300015303 | Miscanthus Phyllosphere | ADEEVTKLMEAAKVPGTMLASLFEEEVVPPAPAVDAGDLEP* |
Ga0182123_10647881 | 3300015303 | Miscanthus Phyllosphere | DEEANVAVAKLMEAAEGPGAALATLFEEEVVPPLPSAGAEGPEP* |
Ga0182123_10986481 | 3300015303 | Miscanthus Phyllosphere | DAAVTKLMEAAEGPGTALATLFEEEVVLPLPSTAAEGPKP* |
Ga0182112_10188952 | 3300015304 | Miscanthus Phyllosphere | LMEAVEGPGMALATLFEEEVVPPPPSADAGGPEP* |
Ga0182112_10241291 | 3300015304 | Miscanthus Phyllosphere | AEVVKLLEAAEAPGTALAGLFEEEVVPPTPAADP* |
Ga0182158_10493201 | 3300015305 | Miscanthus Phyllosphere | AVTKLMEAAEGPGTALATLFEEEVVPPLPSVGAEGPKP* |
Ga0182142_10183182 | 3300015308 | Miscanthus Phyllosphere | LPEANEEVAKLMESAEGPGTALAKLFEEEVVPPPPSADAGDPEP* |
Ga0182142_10992041 | 3300015308 | Miscanthus Phyllosphere | TKLMEAAEVPGAALASLFEEEVVPPAPAADAGDPKP* |
Ga0182142_11004211 | 3300015308 | Miscanthus Phyllosphere | VTKLMEVAEAPGTTLASLFEEEVVPPVPTANAGDPKP* |
Ga0182140_10908321 | 3300015314 | Miscanthus Phyllosphere | TKLMEAVEGLGTALAMLFEEEVVPPLPSADAGGPEP* |
Ga0182110_11077442 | 3300015322 | Miscanthus Phyllosphere | LMEAAEGPGTALATLFEEEVVPPLPSADAGGPKP* |
Ga0182129_10485491 | 3300015323 | Miscanthus Phyllosphere | LEEAAEALGMALASLFEEEVVPPTPSADAGDPEF* |
Ga0182129_11138921 | 3300015323 | Miscanthus Phyllosphere | EADKEVAKLMEAAKGLGTALAKLFEEEVVPPMPSTDARGPEP* |
Ga0182109_11806101 | 3300015342 | Miscanthus Phyllosphere | EVKKLEEVAEAPGTALASLFEEEVVPPPPSADAGDPEF* |
Ga0182109_12217371 | 3300015342 | Miscanthus Phyllosphere | VTKLMEAAEGPGAALATLFEEEVVPPLPSAGAESPKP* |
Ga0182155_11913181 | 3300015343 | Miscanthus Phyllosphere | DDEADEVVTKLLEAAKGPGTALATLFEEEVVPPPPSIDAGGPEP* |
Ga0182189_11816952 | 3300015344 | Miscanthus Phyllosphere | AVTKLMEAAEGPGTALATLFEEEVVPPLPSAGAEDPEP* |
Ga0182189_12046121 | 3300015344 | Miscanthus Phyllosphere | DDEEADAAVAKLMEAAEGPGTALATLFEEEVVPPLPSADAEGPEP* |
Ga0182189_12260121 | 3300015344 | Miscanthus Phyllosphere | KLMEAAEVPGAALASLFEEEVVPPAPAADAGDPEP* |
Ga0182111_10933391 | 3300015345 | Miscanthus Phyllosphere | KLIEAAKGPGVALAKLFEEEVVPPPPSADAGGPEP* |
Ga0182111_11263821 | 3300015345 | Miscanthus Phyllosphere | LLEAAEGPGTALAMLFEGEVVPPPPSADAGGAEP* |
Ga0182139_11626361 | 3300015346 | Miscanthus Phyllosphere | VAKLMEAAKGPSTALAKLFEEEVIPPTSSADAGDPEP* |
Ga0182177_10992971 | 3300015347 | Miscanthus Phyllosphere | EADEAVVKLMEAAEGPGTVLAKLFEEEVVPPPPSADAGGPEP* |
Ga0182161_12249101 | 3300015351 | Miscanthus Phyllosphere | LVGSVTVAEAPGMALAKLFEEEVVPPTPTIDAGDLEL* |
Ga0182161_12365961 | 3300015351 | Miscanthus Phyllosphere | KLMEAAEGPGTALAMLFEEEVVPLLPSAGAECPEP* |
Ga0182159_12692812 | 3300015355 | Miscanthus Phyllosphere | DAEVAKLMEAAEAPGTALARLFEEEVVPPAPGADP* |
Ga0182159_13162682 | 3300015355 | Miscanthus Phyllosphere | MKLMEAAKGPGAALAGLFEEEVVPRPPSADVGDPTP* |
Ga0182203_10737711 | 3300017404 | Miscanthus Phyllosphere | EADATVMKLVDAAEGPGTALATLFKVEVVPPLPSADVGGPEP |
Ga0182220_10289881 | 3300017407 | Miscanthus Phyllosphere | MRLEEAAKGLGTALAKLFEEEVVPPSPSADAGDPES |
Ga0182204_10442511 | 3300017409 | Miscanthus Phyllosphere | TKLMEAAEVPGAALASLFEEEVVASAPAADAGDPEP |
Ga0182204_11148691 | 3300017409 | Miscanthus Phyllosphere | RLLEAAEAPGTALAKLFEEEVVPPALAADAGDLEP |
Ga0182207_10913751 | 3300017410 | Miscanthus Phyllosphere | MKLMEAAKGPGAALAGLFEEEVVPPPPSADAGDPTP |
Ga0182208_10321941 | 3300017411 | Miscanthus Phyllosphere | EAVNKLMEAVEGPSTALASLFEEEVVPPTPAADAGDPEP |
Ga0182208_10794801 | 3300017411 | Miscanthus Phyllosphere | EADAAVTKLMEAAEGPGTALAMLFEEEVVPPLPSAGAEDPEP |
Ga0182208_10834521 | 3300017411 | Miscanthus Phyllosphere | EVTKLMEAAGHSTALAKLFEEEVVPPTSSTDAGDPEP |
Ga0182222_10333321 | 3300017413 | Miscanthus Phyllosphere | EEADAAVTKLMEAAEGPGTALATLFEEEVVPPLPSAGAEGPEP |
Ga0182222_10459621 | 3300017413 | Miscanthus Phyllosphere | EANEVVTKLMEAAEGPGSALAGLFEEEVVPPPPSADAGDPAP |
Ga0182222_10618291 | 3300017413 | Miscanthus Phyllosphere | DEEVAKLMEVVEGPGTVLAKLFEEEVVPPPPSADAGDPEP |
Ga0182222_10862291 | 3300017413 | Miscanthus Phyllosphere | EEANAAITKLMEAAEGPGTALATLFEEEVVPPLPSADAGGPEP |
Ga0182202_11072982 | 3300017415 | Miscanthus Phyllosphere | MKLVEAAEAPGTMLASLFEEEVVPPTPSTDAGDPEF |
Ga0182228_10584731 | 3300017420 | Miscanthus Phyllosphere | VKLMEAAEGPSTALAKLFEEEVVPPMPSADAGDPEP |
Ga0182228_11090031 | 3300017420 | Miscanthus Phyllosphere | KLMEVAKGPGTALAKLFKEEGVAPLPSANARGPKP |
Ga0182219_10621711 | 3300017424 | Miscanthus Phyllosphere | KLLEAAEGPSTALATLFEEEVVPPLPSADAEGAEP |
Ga0182224_11618131 | 3300017425 | Miscanthus Phyllosphere | DAEVAKLMEAAEAPGTALAKLFEEEVVPPAPAADP |
Ga0182190_10380782 | 3300017427 | Miscanthus Phyllosphere | VTKLMEAAEGPGAALDGLFEEEVVPPPPSADAGDPAP |
Ga0182190_11087371 | 3300017427 | Miscanthus Phyllosphere | AAVAKLMEAAEGPGTALAMLFEEEVVPPLPPAGVEGSEP |
Ga0182192_10379222 | 3300017430 | Miscanthus Phyllosphere | EVTKLMEAAEGPGTVLAKLFEEEVVPPTPSADAGDLEP |
Ga0182192_11257371 | 3300017430 | Miscanthus Phyllosphere | ADEEVTKLMEATEIPGAALASLFEEEVVPPMPAVDAGDPEP |
Ga0182192_11406732 | 3300017430 | Miscanthus Phyllosphere | EEANEAVTKLLEAAEGPGTALAMLFEEEVVPPLPSANAGDPEP |
Ga0182206_10725161 | 3300017433 | Miscanthus Phyllosphere | DKEEADEEVAKLMEAAEGPGTALAKLFDEEVVPPTPSADAGDPEP |
Ga0182206_10792691 | 3300017433 | Miscanthus Phyllosphere | DDEEAHAAVAKLLEAAEGPGTALATLFEDEVVPPLPSAGAGSPEP |
Ga0182206_11504441 | 3300017433 | Miscanthus Phyllosphere | PDDNEEANAAVTKLMEAAEGPGTALATLFEEEVVPPLPPAGVEGPKP |
Ga0182209_11277671 | 3300017436 | Miscanthus Phyllosphere | EVTKLMEVAEGLGTVLAKLFEEEVVRPTPSADAGDPKP |
Ga0182191_11590391 | 3300017438 | Miscanthus Phyllosphere | KLSEVAEGPGTALATLYEEEVVPPPPSIDAGGPEP |
Ga0182221_11006091 | 3300017442 | Miscanthus Phyllosphere | EEANEEVAKLMEAAEGLGTVLAKLFKEEVVPPMPSADARDPEP |
Ga0182193_10481563 | 3300017443 | Miscanthus Phyllosphere | MKLMEAAEGPGAALAGLFEEEVVPPPPSADAGDPTP |
Ga0182193_10558663 | 3300017443 | Miscanthus Phyllosphere | VAKLLEAAEGPGTALATLFEDEVVPPLPSIGAGGPEP |
Ga0182233_10876301 | 3300017680 | Miscanthus Phyllosphere | VVAKLMEVAEGPGTALAKLFEEEVVPSTLSIGAGDPEP |
Ga0182229_10713351 | 3300017682 | Miscanthus Phyllosphere | VNKLMQAVEGPSTALASLFEEEVVPPAPAADAGDPEP |
Ga0182229_11042791 | 3300017682 | Miscanthus Phyllosphere | AAFTKLMEAAEGPGTALAMLFEEEVVPPLPSASAKGLEP |
Ga0182218_10967912 | 3300017683 | Miscanthus Phyllosphere | MKLVEAAKAPGTALAKLFEEEVVPRAPTADAGDPEF |
Ga0182227_10747681 | 3300017685 | Miscanthus Phyllosphere | MKLVEAAEAPGTALARLFEEEVVPPTPTVDAGDPEF |
Ga0182227_10967881 | 3300017685 | Miscanthus Phyllosphere | AVTKLMEAAEGPGAALAGLFEEEVVPPPPSADAGDPTP |
Ga0182227_11259141 | 3300017685 | Miscanthus Phyllosphere | DDEEANEELAKLMAATEGLGTALAKLFEEDVVPPPPSADAGDPEP |
Ga0182205_11153511 | 3300017686 | Miscanthus Phyllosphere | DDEEADAAVTKLMEAAEGLGTVLAMLFEEEVVPPLPSADAGGPKP |
Ga0182231_10783902 | 3300017689 | Miscanthus Phyllosphere | MKLMEAAEGLGVALAGLFEEEVVPPPPSADAGDPTP |
Ga0182231_10949871 | 3300017689 | Miscanthus Phyllosphere | VVTKLMEVAEGPGSALATLFEEEVVPPLPPAGVEGSEP |
Ga0182223_10115962 | 3300017690 | Miscanthus Phyllosphere | MVTSCLMMTKLMEAAEVPSAALASLFKEEVVPPTPAADAGDPEP |
Ga0182223_10831601 | 3300017690 | Miscanthus Phyllosphere | EEADEAVAKLMEVAEGPGTVLAKLFEEEVVPSMPSVGAGDPEP |
Ga0182232_10614001 | 3300021060 | Phyllosphere | SKLVEVAEAPGTALAWLFEEEVVPFMPTADAGDPEF |
Ga0207709_103476891 | 3300025935 | Miscanthus Rhizosphere | ADAAVAKLMEAAEGPGTALATLFEEEVVPPLPSAGAEGPEP |
Ga0207677_106038461 | 3300026023 | Miscanthus Rhizosphere | VVTKLMEAAEGPGAALAGLFEEEVVSPPPSTDARDPAP |
Ga0207675_1017608851 | 3300026118 | Switchgrass Rhizosphere | AAVTKLMEAAKGPGTALATLFEEEVVPPLPSAGAEGPEP |
⦗Top⦘ |