NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F083560

Metagenome / Metatranscriptome Family F083560

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F083560
Family Type Metagenome / Metatranscriptome
Number of Sequences 112
Average Sequence Length 48 residues
Representative Sequence LHWRDVLTGVRHAGLRPLLSELTRRLPVALLIPEDIYLAEQERLAGESAR
Number of Associated Samples 91
Number of Associated Scaffolds 112

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 89.29 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.32

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (82.143 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(46.429 % of family members)
Environment Ontology (ENVO) Unclassified
(47.321 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(47.321 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 44.87%    β-sheet: 0.00%    Coil/Unstructured: 55.13%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.32
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 112 Family Scaffolds
PF02922CBM_48 50.89
PF00128Alpha-amylase 25.00
PF11941DUF3459 9.82
PF00535Glycos_transf_2 0.89
PF04030ALO 0.89
PF01494FAD_binding_3 0.89
PF06781CrgA 0.89
PF01565FAD_binding_4 0.89

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 112 Family Scaffolds
COG02961,4-alpha-glucan branching enzymeCarbohydrate transport and metabolism [G] 25.00
COG0366Glycosidase/amylase (phosphorylase)Carbohydrate transport and metabolism [G] 25.00
COG1523Pullulanase/glycogen debranching enzymeCarbohydrate transport and metabolism [G] 25.00
COG3280Maltooligosyltrehalose synthaseCarbohydrate transport and metabolism [G] 25.00
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 1.79
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 0.89
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.89
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.89
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 0.89


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms82.14 %
UnclassifiedrootN/A17.86 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001356|JGI12269J14319_10256066All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia649Open in IMG/M
3300005541|Ga0070733_11187296All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia511Open in IMG/M
3300005591|Ga0070761_10929050All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007550Open in IMG/M
3300005602|Ga0070762_10308065All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1000Open in IMG/M
3300005921|Ga0070766_10335459Not Available978Open in IMG/M
3300005921|Ga0070766_10700603All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura685Open in IMG/M
3300005921|Ga0070766_11166785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura532Open in IMG/M
3300009683|Ga0116224_10015536All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3772Open in IMG/M
3300009698|Ga0116216_10185755Not Available1276Open in IMG/M
3300009700|Ga0116217_10077302All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2320Open in IMG/M
3300009824|Ga0116219_10019983All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4138Open in IMG/M
3300010361|Ga0126378_12650363All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007573Open in IMG/M
3300010866|Ga0126344_1203516Not Available1630Open in IMG/M
3300010880|Ga0126350_10784772All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007533Open in IMG/M
3300010880|Ga0126350_11042254All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007506Open in IMG/M
3300010880|Ga0126350_11604496All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007647Open in IMG/M
3300016294|Ga0182041_11113723All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007717Open in IMG/M
3300016341|Ga0182035_10627008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007931Open in IMG/M
3300016357|Ga0182032_10443192Not Available1058Open in IMG/M
3300016357|Ga0182032_11616479All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007564Open in IMG/M
3300016422|Ga0182039_11695376All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007578Open in IMG/M
3300017924|Ga0187820_1196397All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007628Open in IMG/M
3300017928|Ga0187806_1328676All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007544Open in IMG/M
3300017933|Ga0187801_10420185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007558Open in IMG/M
3300017955|Ga0187817_11007388All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007534Open in IMG/M
3300017961|Ga0187778_11099231All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007554Open in IMG/M
3300017970|Ga0187783_11286957All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007527Open in IMG/M
3300017972|Ga0187781_10532753All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007844Open in IMG/M
3300017974|Ga0187777_10789380All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007678Open in IMG/M
3300017975|Ga0187782_10340297Not Available1135Open in IMG/M
3300018001|Ga0187815_10188498All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007873Open in IMG/M
3300018001|Ga0187815_10394050All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007589Open in IMG/M
3300018062|Ga0187784_10170485All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Clavibacter → Clavibacter michiganensis → Clavibacter michiganensis subsp. michiganensis1778Open in IMG/M
3300018062|Ga0187784_11148932All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007616Open in IMG/M
3300018090|Ga0187770_10936458All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007696Open in IMG/M
3300020583|Ga0210401_10247643Not Available1641Open in IMG/M
3300020583|Ga0210401_11196244All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007618Open in IMG/M
3300021401|Ga0210393_10489475All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-0071004Open in IMG/M
3300021403|Ga0210397_10180298Not Available1497Open in IMG/M
3300021403|Ga0210397_11548884All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007514Open in IMG/M
3300021407|Ga0210383_11089039All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007675Open in IMG/M
3300021439|Ga0213879_10156392All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007664Open in IMG/M
3300021476|Ga0187846_10203408All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007829Open in IMG/M
3300021479|Ga0210410_11114830All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007679Open in IMG/M
3300021560|Ga0126371_13729539All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007514Open in IMG/M
3300025634|Ga0208589_1106080All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007659Open in IMG/M
3300026515|Ga0257158_1076817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007642Open in IMG/M
3300027029|Ga0208731_1001420Not Available1920Open in IMG/M
3300027497|Ga0208199_1087327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007648Open in IMG/M
3300027701|Ga0209447_10143263All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007656Open in IMG/M
3300028742|Ga0302220_10047802All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Clavibacter → Clavibacter michiganensis → Clavibacter michiganensis subsp. michiganensis1811Open in IMG/M
3300028773|Ga0302234_10055455All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Clavibacter → Clavibacter michiganensis → Clavibacter michiganensis subsp. michiganensis1785Open in IMG/M
3300029999|Ga0311339_10002191All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales33937Open in IMG/M
3300029999|Ga0311339_10067474All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4640Open in IMG/M
3300029999|Ga0311339_10659496Not Available1030Open in IMG/M
3300030524|Ga0311357_11043428All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007716Open in IMG/M
3300030524|Ga0311357_11183932All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007662Open in IMG/M
3300030707|Ga0310038_10014316All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5131Open in IMG/M
3300031234|Ga0302325_13416400All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007500Open in IMG/M
3300031525|Ga0302326_11637262All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007853Open in IMG/M
3300031543|Ga0318516_10296161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007935Open in IMG/M
3300031546|Ga0318538_10282776All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007893Open in IMG/M
3300031546|Ga0318538_10792672All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007514Open in IMG/M
3300031549|Ga0318571_10045548Not Available1287Open in IMG/M
3300031564|Ga0318573_10053557All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1977Open in IMG/M
3300031572|Ga0318515_10322550All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007828Open in IMG/M
3300031681|Ga0318572_10644811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007631Open in IMG/M
3300031682|Ga0318560_10273283All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007909Open in IMG/M
3300031708|Ga0310686_100980241All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007814Open in IMG/M
3300031708|Ga0310686_109775715Not Available1690Open in IMG/M
3300031719|Ga0306917_10264219Not Available1322Open in IMG/M
3300031724|Ga0318500_10057697All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Clavibacter → Clavibacter michiganensis → Clavibacter michiganensis subsp. michiganensis1669Open in IMG/M
3300031736|Ga0318501_10071240All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Clavibacter → Clavibacter michiganensis → Clavibacter michiganensis subsp. michiganensis1678Open in IMG/M
3300031736|Ga0318501_10357594All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007785Open in IMG/M
3300031751|Ga0318494_10021989All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales3184Open in IMG/M
3300031751|Ga0318494_10340375All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007867Open in IMG/M
3300031753|Ga0307477_10885455All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007590Open in IMG/M
3300031764|Ga0318535_10007732All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3682Open in IMG/M
3300031777|Ga0318543_10191886All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007906Open in IMG/M
3300031777|Ga0318543_10267553All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007763Open in IMG/M
3300031779|Ga0318566_10077003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Clavibacter → Clavibacter michiganensis → Clavibacter michiganensis subsp. michiganensis1617Open in IMG/M
3300031779|Ga0318566_10635018All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007519Open in IMG/M
3300031782|Ga0318552_10105868Not Available1391Open in IMG/M
3300031792|Ga0318529_10197003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007934Open in IMG/M
3300031792|Ga0318529_10410822All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007630Open in IMG/M
3300031793|Ga0318548_10094832All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Clavibacter → Clavibacter michiganensis → Clavibacter michiganensis subsp. michiganensis1423Open in IMG/M
3300031794|Ga0318503_10308049All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007514Open in IMG/M
3300031795|Ga0318557_10411508All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007622Open in IMG/M
3300031798|Ga0318523_10047769All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2002Open in IMG/M
3300031799|Ga0318565_10045475All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Clavibacter → Clavibacter michiganensis → Clavibacter michiganensis subsp. michiganensis2025Open in IMG/M
3300031821|Ga0318567_10270218Not Available956Open in IMG/M
3300031831|Ga0318564_10317068All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis687Open in IMG/M
3300031835|Ga0318517_10467616All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007569Open in IMG/M
3300031897|Ga0318520_10660955All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007652Open in IMG/M
3300031910|Ga0306923_10347937Not Available1690Open in IMG/M
3300031959|Ga0318530_10040633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Clavibacter → Clavibacter michiganensis → Clavibacter michiganensis subsp. michiganensis1714Open in IMG/M
3300032009|Ga0318563_10094620All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Clavibacter → Clavibacter michiganensis → Clavibacter michiganensis subsp. michiganensis1575Open in IMG/M
3300032009|Ga0318563_10110442Not Available1459Open in IMG/M
3300032010|Ga0318569_10354976All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007683Open in IMG/M
3300032044|Ga0318558_10059157All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Clavibacter → Clavibacter michiganensis → Clavibacter michiganensis subsp. michiganensis1716Open in IMG/M
3300032052|Ga0318506_10298213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007715Open in IMG/M
3300032059|Ga0318533_10777376All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007703Open in IMG/M
3300032064|Ga0318510_10058562Not Available1383Open in IMG/M
3300032065|Ga0318513_10019331Not Available2824Open in IMG/M
3300032066|Ga0318514_10292481All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007860Open in IMG/M
3300032068|Ga0318553_10260005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007907Open in IMG/M
3300032076|Ga0306924_10249734Not Available2037Open in IMG/M
3300032076|Ga0306924_11957431All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007606Open in IMG/M
3300032089|Ga0318525_10101863All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Clavibacter → Clavibacter michiganensis → Clavibacter michiganensis subsp. michiganensis1463Open in IMG/M
3300032090|Ga0318518_10139385Not Available1228Open in IMG/M
3300033289|Ga0310914_11427785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007595Open in IMG/M
3300034163|Ga0370515_0414914All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. J1-007568Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil46.43%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.04%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa8.04%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland7.14%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil6.25%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment5.36%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil4.46%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil3.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.79%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.79%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.89%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.89%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.89%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.89%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.89%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.89%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.89%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010866Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021439Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03EnvironmentalOpen in IMG/M
3300021476Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)EnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025634Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300026515Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-AEnvironmentalOpen in IMG/M
3300027029Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF045 (SPAdes)EnvironmentalOpen in IMG/M
3300027497Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027701Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300028742Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3EnvironmentalOpen in IMG/M
3300028773Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2EnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030707Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12269J14319_1025606613300001356Peatlands SoilDTVLPLPELHWWDVLTGTRHAGLRPPLSELTWRLPVALLIPERIYLAGHDQLADGSLA*
Ga0070733_1118729623300005541Surface SoilPELHWWDVLTGTRHAGFRPPLSELTWRLPVALLIPERIYLAGQDQLDDGGRV*
Ga0070761_1092905023300005591SoilRHAGLRPPLAELTRRLPVALLIPEEIYLAEQERLAGESAR*
Ga0070762_1030806513300005602SoilLPLPDVHWRDVLTGVRHAGTRPPLAELTRRLPVALLIPDKIYAQEQDRRSGRIAR*
Ga0070766_1033545913300005921SoilLRPPLAELTRRLPVALLIPEEIYLAEQERLAGESAR*
Ga0070766_1070060323300005921SoilWRDVLTGTRHAGLRPPLAELTRRLPVALLIPEEIYLAEQEALAGESTR*
Ga0070766_1116678523300005921SoilWRDVLTGTRHAGLRPPLAELTRRLPVALLIPEEIYLAEQERLADESAR*
Ga0116224_1001553643300009683Peatlands SoilLPLPELHWRDVLTGVRHAGLRPLLSELTRRLPVALLIPEDVFLAEQERLAGQSAR*
Ga0116216_1018575513300009698Peatlands SoilLHWRDVLTGVRHAGLRPLLSELTRRLPVALLIPEDIYLAEQERLAGESAR*
Ga0116217_1007730233300009700Peatlands SoilLPLPELHWRDVLTGVRHAGLRPLLSELTRRLPVALLIPEDIYLAEQERLAGESAR*
Ga0116219_1001998313300009824Peatlands SoilVRHAGLRPLLSELTRRLPVALLIPEDVFLAEQERLAGQSAR*
Ga0126378_1265036313300010361Tropical Forest SoilTGTRHAGLRPLLSELTWRLPVALLIPERVYLAEHDQTAGEGPA*
Ga0126344_120351623300010866Boreal Forest SoilGTRHAGLRPPLAELTWRLPVALLIPEETYLAEQERQAGESTR*
Ga0126350_1078477223300010880Boreal Forest SoilVLPLPELHWQDVLTGVRHAGLRPPLAELTRRLPVALLIPEETYLAEQERRAR*
Ga0126350_1104225413300010880Boreal Forest SoilHAGLRPPLAELTWRLPVALLVPERIYISERDRTAPENPR*
Ga0126350_1160449613300010880Boreal Forest SoilVLPLPQLHWRDVLTGARHAGLRPPLAELTRRLPVALLIPEEIYLAEHERQAR*
Ga0182041_1111372323300016294SoilLPGLHWRDVLTGIRHAGLRPQLAELTRRLPVALLIPEEIYLAEQARPSGEGGR
Ga0182035_1062700813300016341SoilLHWRDVLTGVRHAGLRPLLSELTWRLPAALLIPEEIYLAERARLAGGNAR
Ga0182032_1044319223300016357SoilWRDVLTGIRHAGLRPPLAELTRRLPVALLIPEEIYLAEQARLSGESAR
Ga0182032_1161647923300016357SoilPELHWRDVLTGVRHAGLRPLLSELTWRLPVALLIPEEIYLAERARLAGGNAR
Ga0182039_1169537623300016422SoilRPLLSDLTRQLPVALLIPEEIYRAEQERRARGNAR
Ga0187820_119639723300017924Freshwater SedimentLPLPELHWRDVLTGVRHAGLRPLLSDLTRRLPVALLIPEETYRAEQERLAGGNAR
Ga0187806_132867623300017928Freshwater SedimentVLPLPELHWWDVLTGTRHAGFRPPVSELTWRLPVALLIPERIYLAGQDQLADGSLG
Ga0187801_1042018513300017933Freshwater SedimentDVLTGVRHAGLRPLLSELTRRLPVALLIPEEIYLAEHARLAGQSAR
Ga0187817_1100738823300017955Freshwater SedimentADTVLPLPGLHWRDVLTGVRHAGLRPLLSELTRRLPVALLIPEDIYLAEQERLAGENDR
Ga0187778_1109923123300017961Tropical PeatlandAGLRPLLADLTRRLPVALLIPERIYLAEQDRPGDGSAR
Ga0187783_1128695713300017970Tropical PeatlandRPLLSELTWRLPVALLIPERIYLDEQEQLADGGPA
Ga0187781_1053275313300017972Tropical PeatlandTVLPLPEVHWRDVLTGARHAGLRPLLSELTRRLPVALLIPERVYLSEQEWFTDGSAR
Ga0187777_1078938013300017974Tropical PeatlandLPLPELHWRDVLTGARHAGLRPLLSELTRRLPVALLIPDRIYLEEQERLRDGRAR
Ga0187782_1034029723300017975Tropical PeatlandADTVLPLPELHWWDVLTGTRHAGLRPPLSELTWRLPVALLIPERIYLGGQDQPADGGLA
Ga0187815_1018849813300018001Freshwater SedimentWWDVLTGTRHAGLRPPLSELTWRLPVALLIPERVYLAGQDQLADGSMA
Ga0187815_1039405013300018001Freshwater SedimentVLTGVRHAGLRPLLSELTRRLPVALLVPEDIYLAEQERLAGENDR
Ga0187784_1017048523300018062Tropical PeatlandVLPLPEVHWRDVLTGARHAGLCPLLSELTVRLPVALLIPDRVYLEEQERLMDGRAR
Ga0187784_1114893223300018062Tropical PeatlandDTVLPLPELHWWDVLTGTRHAGLRPPLSELTRRLPVALLIPERIYLAGQDQLADGSLA
Ga0187770_1093645813300018090Tropical PeatlandVHWRDVLTGARHAGLCPLLSELTRRLPVALLIPERVFLSEQEGLTDGGPR
Ga0210401_1024764313300020583SoilLTGTRHAGLRPPLAELTRRLPVALLIPEEIYLAEQERLAGESAR
Ga0210401_1119624423300020583SoilAGLRPPLAELTRRLPVALLVPEEIYLAEQERLAGESVR
Ga0210393_1048947523300021401SoilLPLPGLHWRDMLTGTRHAGLRPPLAELTRRLPVALLIPEEIYLAEQERLAGESTR
Ga0210397_1018029823300021403SoilRDVLTGTRHAGLRPPLAELTWRLPVALLVPEEIYLAEQEQLAGESAR
Ga0210397_1154888423300021403SoilDVLTGIRHAGLRPPLAELTRRLPVALLIPEEIYLAEQERLAGESAR
Ga0210383_1108903913300021407SoilPLPELHWWDVLTGTRHAGFRPPLSELTWRLPVALLIPERIYLTGQDQLADGDLA
Ga0213879_1015639223300021439Bulk SoilPLPRLHWRDVLTGTRHAGFSPLMSELTRRLPVALLIPERVYLEEQERLAGGNGR
Ga0187846_1020340813300021476BiofilmWDVLTGTRHAGLRPPMSELTWRLPVALLIPERIYLAQQDLAGEDPA
Ga0210410_1111483023300021479SoilHAGLRPPLAELTWRLPVALLIPEEIYLAEQERLGGQSAR
Ga0126371_1372953923300021560Tropical Forest SoilGLRPPLSELTRRLPVALLIPEEIYLAEQERLSDESTR
Ga0208589_110608013300025634Arctic Peat SoilRDVLTGVRHAGLRPPLSELTWRLPVALLIPERIYAAGQDRDGAGSAR
Ga0257158_107681713300026515SoilVLPLPGLHWRDVLTGTRHAGLRPPLAELTWRLPVALLIPEEIYLAEQERLAGENAR
Ga0208731_100142023300027029Forest SoilHAGLRPPLAELTRRLPVALLIPEEIYLAEQEQLAGESAR
Ga0208199_108732713300027497Peatlands SoilTGVRHAGLRPLLSELTRRLPVALLIPEDIYLAEQERLAGESAR
Ga0209447_1014326313300027701Bog Forest SoilAGLRPPLAELTWRLPVALLIPEEIYRAEQERLAGENAR
Ga0302220_1004780223300028742PalsaTGVRHAGTRPPLAELTRRLPVALLIPDQIYAQEQDRRSGRTAR
Ga0302234_1005545523300028773PalsaTGVRHAGLRPPLDELTRRLPVALLIPDRVYGEKQGRAASRSGR
Ga0311339_10002191303300029999PalsaVRHAGLRPPLAELTRRLPVALLIPDQIYAQEHDRRPGGSAR
Ga0311339_1006747413300029999PalsaLHWRDVLTGVRHAGLRPPLAELTRRLPVALLIPDQIYAQERDRRPGGSAR
Ga0311339_1065949613300029999PalsaLTGVRHAGTRPPLAELTRRLPVALLIPDQIYAQEQDRRSGRSAW
Ga0311357_1104342813300030524PalsaHWRDVLTGVRHAGTRPPLAELTRRLPVALLIPDQIYAQEQDRRSGRSAR
Ga0311357_1118393223300030524PalsaAGTRPPLAELTRRLPVALLIPDQIYAQEQDRRSGRSAR
Ga0310038_1001431653300030707Peatlands SoilLTGVRHAGLRPLLSELTRRLPVALLIPEDIYLAEQERLAGESAR
Ga0302325_1341640023300031234PalsaLPLPELHWRDVLTGARHAGLRPLLSDLTRYLPVALLIPEEIYLAEQERLAGQSGR
Ga0302326_1163726213300031525PalsaLPLPELHWRDVLTGARHAGLRPLLSDLTRYLPVALLIPEEIYLAEQERLAGQSSR
Ga0318516_1029616113300031543SoilVLPLPELHWRDVLTGVRHAGLRPPLSELTRRLPVALLIPEEIYLAEQDRLSGESTR
Ga0318538_1028277613300031546SoilLHWRDVLTGVRHAGLRPLLSELTWRLPVALLIPEEIYLAERARLAGGNAR
Ga0318538_1079267223300031546SoilVLPLPELHWHDVLTGARHAGLRPLLSELTRRLPVALLIPERVYLAEQERLTDGSSR
Ga0318571_1004554823300031549SoilPLPELHWRDALTGARHAGLRPLLSELTRRLPVALLIPDRVYLSEQERLSDGRAR
Ga0318573_1005355733300031564SoilRHAGLRPLLSDLTRRLPVALLIPEEIYRAEQERLASGNGR
Ga0318515_1032255013300031572SoilADTVLPLPEMHWRDVLTGVRHAGLRPLLSELTRRLPVALLIPEEIYLAEQEQLSGERAR
Ga0318572_1064481123300031681SoilVLPLPDLHWRDVLTGARHAGLRPLLSELTRRLPVALLIPDRVFLSEREQLTDGAAR
Ga0318560_1027328323300031682SoilTGVRHAGLRPLLSELTWRLPVALLIPEEIYLAERARLAGGNAR
Ga0310686_10098024113300031708SoilTRHAGLRPPLAELTWRLPVALLIPEEIYLAEQERLAGENAR
Ga0310686_10977571523300031708SoilRDVLTGTRHAGLRPLMSELTRRLPVALLIPERVYLQEQDRLAGGNAG
Ga0306917_1026421923300031719SoilLHWHDVLTGARHAGLRPLLSELTRRLPVALLIPERVYLAEQERLTDGSSR
Ga0318500_1005769713300031724SoilLTGIRHAGLRPPLAELTRRLPVALLIPEEIYLAEQARLSGESAR
Ga0318501_1007124013300031736SoilPELHWRDVLTGIRHAGLRPPLAELTRRLPVALLIPEEIYLAEQARLSGESAR
Ga0318501_1035759423300031736SoilTVLPLPDLHWRDVLTGARHAGLRPLLSELTRRLPVALLIPDRVFLSEREQLTDGAAR
Ga0318494_1002198913300031751SoilHWRDVLTGVRHAGLRPLLSELTRRLPVALLIPEEIYLAEQEQLSGERAR
Ga0318494_1034037513300031751SoilADTVLPLPELHWRDVLTGVRHAGLRPPLAELTRRLPVALLIPEEIYLAEQDRLSGESTR
Ga0307477_1088545523300031753Hardwood Forest SoilWDVLTGTRHAGLRPPLSELTWRLPVALLIPERVYLDGQDQLADGGLA
Ga0318535_1000773243300031764SoilGIRHAGLRPPLAELTRRLPVALLIPEEIYLAEQARLSGESAR
Ga0318543_1019188623300031777SoilPELHWRDVLTGVRHAGLRPLLSELTWRLPAALLIPEEIYLAERERLAGGNAR
Ga0318543_1026755313300031777SoilRDVLTGIRHAGLRPPLAELTRRLPVALLIPEEIYLAEQARLSGESAR
Ga0318566_1007700313300031779SoilWRDVLTGVRHAGLRPLLSELTWRLPVALLIPEEIYLAERARLAGGNAR
Ga0318566_1063501813300031779SoilLTGARHAGLRPLLSELTRRLPVALLIPERVYLAEQERLTDGSSR
Ga0318552_1010586823300031782SoilLTGVRHAGLRPLLSELTRRLPVALLIPEEIYLAEQEQLSGERAR
Ga0318529_1019700313300031792SoilDVLTGVRHAGLRPLLSELTWRLPVALLIPEEIYLAERARLAGGNAR
Ga0318529_1041082223300031792SoilHWHDVLTGARHAGLRPLLSELTRRLPVALLIPERVYLAEQERLTDGSSR
Ga0318548_1009483223300031793SoilIRHAGLRPPLAELTRRLPAALLIPEEIYLAEQARLSGESAR
Ga0318503_1030804923300031794SoilAGLRPLLSELTRRLPVALLIPEEIYLAEQEQLSGERAR
Ga0318557_1041150813300031795SoilHWRDVLTGIRHAGLRPLLSDLTRRLPVALLIPEEIYRAEQERLASGNGR
Ga0318523_1004776943300031798SoilELHWRDVLTGIRHAGLRPPLAELTRRLPVALLIPEEIYLAEQARLSGESAR
Ga0318565_1004547513300031799SoilADTVLPLPELHWRDVLTGIRHAGLRPPLAELTRRLPVALLIPEEIYLAEQARLSGESAR
Ga0318567_1027021813300031821SoilLRPLLSELTWRLPVALLIPEEIYLAERERLAGGNAR
Ga0318564_1031706823300031831SoilALTGVRHAGLRPLLSELTWRLPVALLIPEQVYLAEQDRMPGEKA
Ga0318517_1046761613300031835SoilVLPLPELHWRDVLTGVRHAGLRPPLSELTRRLPVALLIPEEIYLAEQERLSGQGTR
Ga0318520_1066095523300031897SoilWHDVLTGARHAGLRPLLSELTRRLPVALLIPERVYLAEQERLTDGSSR
Ga0306923_1034793713300031910SoilADTVLPLPELHWHDVLTGARHAGLRPLLSELTRRLPVALLIPERVYLAEQERLTDGSSR
Ga0318530_1004063323300031959SoilVLPLPGLHWRDVLTGIRHAGLRPQLAELTRRLPVALLIPEEIYLAEQARPSGEGGR
Ga0318563_1009462023300032009SoilDTVLPLPELHWRDVLTGVRHAGLRPLLSDLTRRLPVALLIPEEIYRAEQERLADGNAR
Ga0318563_1011044213300032009SoilADTVLPLPELHWRDVLTGVRHAGLRPPLAELTRRLPVALLIPEEIYLAEQERLSGQGTR
Ga0318569_1035497623300032010SoilADTVLPLPDLHWRDVLTGARHAGLRPLLSELTRRLPVALLIPDRVFLSEREQLTDGAAR
Ga0318558_1005915723300032044SoilLRPPLAELTRRLPVALLIPEEIYLAEQARLSGENAR
Ga0318506_1029821323300032052SoilLHWRDVLTGIRHAGLRPPLAELTRRLPVALLIPEEIYLAEQEQLSGERAR
Ga0318533_1077737623300032059SoilLPLPELHWRDVLTGVRHAGLRPLLSELTWRLPVALLIPEEIYLAERARLAGGNAR
Ga0318510_1005856213300032064SoilHWRDVLTGVRHAGLRPLLSELTWRLPVALLIPEEIYLAERARLAGGNAR
Ga0318513_1001933113300032065SoilVLTGARHAGLRPLLSELTRRLPVALLIPERVYLAEQERLTDGSSR
Ga0318514_1029248113300032066SoilVLTGVRHAGLRPLLSELTRRLPVALLIPEEIYLAEQERLAGESAR
Ga0318553_1026000523300032068SoilGARHAGLRPLLSELTRRLPVALLIPDRVYLSEQERLSDGRAR
Ga0306924_1024973423300032076SoilLPLPELHWHDVLTGARHAGLRPLLSELTRRLPVALLIPERVYLAEQERLTDGSSR
Ga0306924_1195743123300032076SoilDTVLPLPELHWRDVLTGVRHAGLRPPLAELTRRLPVALLIPEEIYLAEQERLSGQGTR
Ga0318525_1010186313300032089SoilGRDVLTGVRHAGLRPLLSELTWRLPVALLIPEEIYLAEQERLSAESAR
Ga0318518_1013938523300032090SoilADTVLPLPELHWRDALTGARHAGLRPLLSELTRRLPVALLIPDRVYLSEQERLSDGRAR
Ga0310914_1142778513300033289SoilHWRDALTGARHAGLRPLLSELTRRLPVALLIPDRVYLSEQERLSDGRAR
Ga0370515_0414914_2_1663300034163Untreated Peat SoilPLPDLHWRDVLTGVRHAGTRPPLAELTRRLPVALLIPDQIYAQEQDRRSGRSAW


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.