Metagenome Family F083480

Overview

Basic Information

• Family ID: F083480
• Family Type: Metagenome
• Number of Sequences: 112
• Average Sequence Length: 38 residues
• Representative Sequence: QAVEVDRIDAAVLAEELAEIYSTPTPKGWPEPKK
• Number of Associated Samples: 57
• Number of Associated Scaffolds: 112

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 0.93 %
• % of genes near scaffold ends (potentially truncated): 87.50 %
• % of genes from short scaffolds (< 2000 bps): 93.75 %
• Associated GOLD sequencing projects: 57
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (93.750 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (93.750 % of family members)
• Environment Ontology (ENVO): Unclassified (94.643 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant surface (94.643 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 20.97%
  β-sheet: 0.00%
  Coil/Unstructured: 79.03%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.75 %
All Organisms	root	All Organisms	6.25 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.75 %
cellular organisms	root	All Organisms → cellular organisms	6.25 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.75 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	6.25 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.75 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	6.25 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.75 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	6.25 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.75 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	6.25 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.75 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	6.25 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.75 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	6.25 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.75 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	6.25 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.75 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	6.25 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.75 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	6.25 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.75 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	5.36 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.75 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	4.46 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	0.89 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.75 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	4.46 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	0.89 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.75 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	4.46 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	0.89 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.75 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	4.46 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	0.89 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.75 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	4.46 %
malvids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids	0.89 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.75 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	1.79 %
BOP clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade	0.89 %
Malvales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales	0.89 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.75 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	1.79 %
Pooideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae	0.89 %
Malvaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae	0.89 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.75 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	1.79 %
Triticodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae	0.89 %
Malvoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae	0.89 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.75 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	1.79 %
Gossypium	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium	0.89 %
Triticeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae	0.89 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.75 %
Saccharinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae	1.79 %
Triticinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae	0.89 %
Gossypium australe	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	0.89 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.75 %
Miscanthus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus	1.79 %
Triticinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae	0.89 %
Gossypium australe	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	0.89 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.75 %
Miscanthus lutarioriparius	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	1.79 %
Triticinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae	0.89 %
Gossypium australe	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	0.89 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300005364|Ga0070673_101367627	Not Available	666
3300005543|Ga0070672_101511651	Not Available	602
3300013297|Ga0157378_11575708	Not Available	702
3300013297|Ga0157378_12320150	Not Available	588
3300014745|Ga0157377_11564349	Not Available	527
3300015267|Ga0182122_1040362	Not Available	593
3300015269|Ga0182113_1042426	Not Available	646
3300015274|Ga0182188_1034763	Not Available	587
3300015275|Ga0182172_1034397	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	634
3300015275|Ga0182172_1036408	Not Available	625
3300015275|Ga0182172_1064564	Not Available	530
3300015276|Ga0182170_1037452	Not Available	621
3300015276|Ga0182170_1055488	Not Available	556
3300015277|Ga0182128_1006172	Not Available	1014
3300015279|Ga0182174_1035210	Not Available	653
3300015281|Ga0182160_1045857	Not Available	600
3300015282|Ga0182124_1046772	Not Available	594
3300015282|Ga0182124_1057173	Not Available	560
3300015285|Ga0182186_1000478	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	2206
3300015286|Ga0182176_1031892	Not Available	685
3300015287|Ga0182171_1032183	Not Available	674
3300015288|Ga0182173_1006723	Not Available	1015
3300015288|Ga0182173_1056671	Not Available	570
3300015288|Ga0182173_1080065	Not Available	514
3300015295|Ga0182175_1049473	Not Available	619
3300015295|Ga0182175_1065630	Not Available	570
3300015295|Ga0182175_1088590	Not Available	520
3300015296|Ga0182157_1022659	Not Available	783
3300015296|Ga0182157_1066584	Not Available	576
3300015300|Ga0182108_1027187	Not Available	755
3300015300|Ga0182108_1068266	Not Available	578
3300015300|Ga0182108_1097279	Not Available	517
3300015302|Ga0182143_1032113	Not Available	713
3300015302|Ga0182143_1056371	Not Available	608
3300015302|Ga0182143_1092496	Not Available	522
3300015303|Ga0182123_1026885	Not Available	728
3300015305|Ga0182158_1010223	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	975
3300015307|Ga0182144_1076126	Not Available	562
3300015307|Ga0182144_1077614	Not Available	559
3300015308|Ga0182142_1023327	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	808
3300015308|Ga0182142_1034036	Not Available	725
3300015313|Ga0182164_1030116	Not Available	867
3300015314|Ga0182140_1007077	Not Available	1124
3300015321|Ga0182127_1039184	Not Available	719
3300015322|Ga0182110_1103570	Not Available	533
3300015322|Ga0182110_1126083	Not Available	500
3300015323|Ga0182129_1082042	Not Available	560
3300015341|Ga0182187_1036953	Not Available	903
3300015341|Ga0182187_1119634	Not Available	607
3300015342|Ga0182109_1146105	Not Available	592
3300015342|Ga0182109_1152241	Not Available	583
3300015342|Ga0182109_1183624	Not Available	542
3300015342|Ga0182109_1203266	Not Available	521
3300015342|Ga0182109_1211467	Not Available	513
3300015344|Ga0182189_1001860	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae	2266
3300015344|Ga0182189_1128659	Not Available	626
3300015344|Ga0182189_1180404	Not Available	551
3300015344|Ga0182189_1185425	Not Available	545
3300015344|Ga0182189_1220500	Not Available	510
3300015345|Ga0182111_1061100	Not Available	846
3300015345|Ga0182111_1188821	Not Available	556
3300015346|Ga0182139_1228664	Not Available	516
3300015351|Ga0182161_1082387	Not Available	798
3300015351|Ga0182161_1240626	Not Available	524
3300015361|Ga0182145_1088100	Not Available	656
3300015361|Ga0182145_1097683	Not Available	634
3300015361|Ga0182145_1127350	Not Available	580
3300017404|Ga0182203_1046577	Not Available	753
3300017404|Ga0182203_1053579	Not Available	721
3300017404|Ga0182203_1124393	Not Available	551
3300017407|Ga0182220_1061808	Not Available	590
3300017407|Ga0182220_1064828	Not Available	582
3300017407|Ga0182220_1090400	Not Available	530
3300017409|Ga0182204_1053447	Not Available	642
3300017410|Ga0182207_1032779	Not Available	870
3300017411|Ga0182208_1063183	Not Available	629
3300017413|Ga0182222_1087494	Not Available	532
3300017417|Ga0182230_1048987	Not Available	742
3300017424|Ga0182219_1061123	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	651
3300017424|Ga0182219_1114007	Not Available	537
3300017425|Ga0182224_1048648	Not Available	740
3300017425|Ga0182224_1052912	Not Available	721
3300017425|Ga0182224_1073750	Not Available	651
3300017430|Ga0182192_1054263	Not Available	750
3300017433|Ga0182206_1040039	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	777
3300017433|Ga0182206_1099677	Not Available	585
3300017433|Ga0182206_1106032	Not Available	573
3300017436|Ga0182209_1041383	Not Available	792
3300017436|Ga0182209_1073358	Not Available	664
3300017436|Ga0182209_1115703	Not Available	575
3300017438|Ga0182191_1126972	Not Available	570
3300017438|Ga0182191_1142602	Not Available	548
3300017438|Ga0182191_1169535	Not Available	516
3300017442|Ga0182221_1127617	Not Available	551
3300017442|Ga0182221_1134776	Not Available	541
3300017442|Ga0182221_1136896	Not Available	539
3300017442|Ga0182221_1143647	Not Available	531
3300017443|Ga0182193_1142506	Not Available	564
3300017443|Ga0182193_1161169	Not Available	540
3300017443|Ga0182193_1188938	Not Available	510
3300017683|Ga0182218_1075436	Not Available	627
3300017683|Ga0182218_1087595	Not Available	599
3300017684|Ga0182225_1051939	Not Available	690
3300017684|Ga0182225_1105816	Not Available	554
3300017690|Ga0182223_1082495	Not Available	564
3300017690|Ga0182223_1086613	Not Available	557
3300026023|Ga0207677_11448577	Not Available	633

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Category

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	94.64%
Rhizosphere	Host-Associated → Plants → Rhizosphere	4.46%
Rhizoplane	Host-Associated → Plants → Rhizoplane	0.89%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	94.64%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	2.68%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.79%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	0.89%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	94.64%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	2.68%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.79%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	0.89%

Habitat

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	93.75%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.68%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.89%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.89%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.89%
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	0.89%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Host-Associated
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated
3300015313	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated
3300017417	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG	Host-Associated
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0070673_1013676271	3300005364	Switchgrass Rhizosphere	VEVDRIDAAILAEELTEIYSTPTPKGWPEPKKVIDFVFD*
Ga0070672_1015116511	3300005543	Miscanthus Rhizosphere	VEVDRIDAAILAEELTEIYSTPTPKGWLEPKKVN*PVFD
Ga0157378_115757082	3300013297	Miscanthus Rhizosphere	VVQQAVEVDRIDVAILAEELAKIYSTPTPKGWSELKK*
Ga0157378_123201501	3300013297	Miscanthus Rhizosphere	YLQQAVEVDQIDAGVLAKELAEIYSTITPKGWPEPKK*
Ga0157377_115643491	3300014745	Miscanthus Rhizosphere	AVEVDRIDAVILAEELAEIYSTPTPKGWPEPKNN*
Ga0182122_10403621	3300015267	Miscanthus Phyllosphere	GTYRQAVEVDRIDAAVLAEELVEIYSTPTPKGWSEPKK*
Ga0182113_10424261	3300015269	Miscanthus Phyllosphere	HDGTYRQAVEVDRIDAAVLAEELAEIYSTPTPKGWPKPKKVIEFVFN*
Ga0182188_10347631	3300015274	Miscanthus Phyllosphere	QQAVEVDRIDAAVLAEELTEIYSTPTPKRWPESKK*
Ga0182188_10474621	3300015274	Miscanthus Phyllosphere	P*LYLQQAVEVDWIDAAVLAEELAEIYSTPTPKGWPEPKK*
Ga0182172_10343971	3300015275	Miscanthus Phyllosphere	YLQQAVEVDRIDAAVLAEELAEIYSTPTPKGWPEPKK*
Ga0182172_10364082	3300015275	Miscanthus Phyllosphere	YLQQAVKVDRIDAAVPAKELAEIYSTPTPKGWPEPKK*
Ga0182172_10645641	3300015275	Miscanthus Phyllosphere	IQVVEVYRIDATVLAEELTEIYSTPTPKGWPEPKK*
Ga0182170_10374522	3300015276	Miscanthus Phyllosphere	VEVDRIDAAILAEELVEIYSTPTPKGWPEPKKVIDFVFD*
Ga0182170_10554881	3300015276	Miscanthus Phyllosphere	RYLQQAVEVDRIDATVLAEELAEIYSTPTPKGWLEPKK*
Ga0182128_10061721	3300015277	Miscanthus Phyllosphere	TYRQAVEVDRIDAAILAEELAKIYSTPTPKGWPEQKKSN*
Ga0182174_10352101	3300015279	Miscanthus Phyllosphere	DRIDAAVLAEELVEIYSTPTPKGWPEPKKVIDLYLID*
Ga0182160_10458571	3300015281	Miscanthus Phyllosphere	GTYRQAVEVDRIDAAILAEELAEIYSTPTPKGWLKPKK*
Ga0182124_10467721	3300015282	Miscanthus Phyllosphere	LQQAVEVDQINADVLAEELTEIYSTPTPKGWLEPKKK*
Ga0182124_10571732	3300015282	Miscanthus Phyllosphere	YRQAVEVNRIDAAVLAEELAEIYSTPTPKGCPEPKKVN*
Ga0182186_10004784	3300015285	Miscanthus Phyllosphere	YRQAMEVNRIDAAVLAEELVEIYSTPTPKGWSEPKKSK*
Ga0182176_10318921	3300015286	Miscanthus Phyllosphere	RQAVEVDRIDAAILAEELAEIYSTPTPKGWLEPKKVIDLY*
Ga0182171_10321832	3300015287	Miscanthus Phyllosphere	TYRQAVEVDRIDVAILAEELVEIYSTPTPKGWPEPKK*
Ga0182173_10067231	3300015288	Miscanthus Phyllosphere	QQAVEVNRIDAVVLAEKLAEIYSTPTPKGWPKEKK*
Ga0182173_10566712	3300015288	Miscanthus Phyllosphere	IDAAVLAEELAEIYSTPTPKRWPEPKKVIAFVFD*
Ga0182173_10800651	3300015288	Miscanthus Phyllosphere	QQAVEVDQIDAAILAVELTEIYSTPTPKGWPEPKK*
Ga0182175_10494731	3300015295	Miscanthus Phyllosphere	TYRQVVEVVRIDAAVLAEELARIYSTPTPKGWPEPKKVNN*
Ga0182175_10638111	3300015295	Miscanthus Phyllosphere	LQQAVEVDWIDVAILAEELTEIYSTPTPKGLSEPKK*
Ga0182175_10656302	3300015295	Miscanthus Phyllosphere	QAVDVDRIDAAVLAEELAEIYSTPTPKGWPEPKK*
Ga0182175_10885901	3300015295	Miscanthus Phyllosphere	VEVDWIDAAVLAEELAEIYSTPTPKGWLEPKKVFDFVFD*
Ga0182157_10226591	3300015296	Miscanthus Phyllosphere	TCRQAVEVDRIDVAILAEELTEIYSTPTSKGWPEPKKIN*
Ga0182157_10665842	3300015296	Miscanthus Phyllosphere	EVNWIDVAILAEELAEIYSAPTPKGWPKPKKVIDFVFV*
Ga0182108_10271871	3300015300	Miscanthus Phyllosphere	VEVDRIDAAVLAEELTEIYSTPTPKGWLEPKKSN*
Ga0182108_10682661	3300015300	Miscanthus Phyllosphere	LTYTRVAVEVDRIDAAVLAEELAEIYSTPTPKGWPEPKK*
Ga0182108_10972791	3300015300	Miscanthus Phyllosphere	SQQAVEVDRIDTAVLAKELAKINSTPTPKGWPEPKK*
Ga0182143_10321131	3300015302	Miscanthus Phyllosphere	MEVYQIDTTILAEELTEIYSTPTPKGWPEPKKKVIDFVFDWFMSLQ*
Ga0182143_10563711	3300015302	Miscanthus Phyllosphere	RQAVEVDRIDTAVLAEELTEIYSTPTPKGWPEPKKSN*
Ga0182143_10924962	3300015302	Miscanthus Phyllosphere	VEVDRIDAAVLAEELTEIYSTSTPKGWPEPKKIN*
Ga0182123_10268851	3300015303	Miscanthus Phyllosphere	LQQAVEVNRIDAAILAEELAEIYSTPTPKGWPKPKK*
Ga0182158_10102232	3300015305	Miscanthus Phyllosphere	VEVDRIDAAVLAEELAEIYSTPTPKGWLEPKKVIDLYLD*
Ga0182144_10761262	3300015307	Miscanthus Phyllosphere	VEVDRIDATVVAEELAEIYSTPTPKGWPEPKKVIDFVFD*
Ga0182144_10776141	3300015307	Miscanthus Phyllosphere	LQQAVEVDQIDAAVLAEELAEIYSTPTPKGWPEPKK*
Ga0182142_10233272	3300015308	Miscanthus Phyllosphere	QAVEVDRIDVVVLAEELAEIYSTPTPKGWPEPKK*
Ga0182142_10340361	3300015308	Miscanthus Phyllosphere	QAVEVDRIDAAIVAKEFSEIYSTPTLKGWSEPKK*
Ga0182164_10301161	3300015313	Switchgrass Phyllosphere	VEVDRIDAAILAEELAEIYSTPTPKGWPKPKKVIDFVFD*
Ga0182140_10070771	3300015314	Miscanthus Phyllosphere	DGTCRQAVEVDRIDVAILAEKLTEIYSTPTSKGWPEPKKIN*
Ga0182127_10391841	3300015321	Miscanthus Phyllosphere	QAVEVDRINVVVLAKELAKIYSTPTPKGWPEPKK*
Ga0182110_10869661	3300015322	Miscanthus Phyllosphere	QAVEVDRIDAAVLAEELIEIYSTPTPKGWPEPKK*
Ga0182110_11035701	3300015322	Miscanthus Phyllosphere	GTYKQAVEVDRIDVVVLAEELTEIYSTPTPKGWPEPK*
Ga0182110_11260831	3300015322	Miscanthus Phyllosphere	VDQIDAAVLAEELAEIYSTPTPKGWPEPKKVIDLY*
Ga0182129_10820422	3300015323	Miscanthus Phyllosphere	VEVDQIDAAVLAEELAEIYSTPTPKGWLELKKVIDLY*
Ga0182187_10369531	3300015341	Miscanthus Phyllosphere	VEVDRIDAAILAEELTEIYSTPTLKGCPEPKKIN*
Ga0182187_11196341	3300015341	Miscanthus Phyllosphere	VEVDRIDVAVLIEELAEIYSTPTPKGWPELKKVSNLYLID
Ga0182109_11461051	3300015342	Miscanthus Phyllosphere	AVEVDRIDAAILAEELAEIYSTPTPKGWPEPKKK*
Ga0182109_11522411	3300015342	Miscanthus Phyllosphere	VEVDRIDAAILAEELAKIYSTPTPKGWLEPKKVIDLY*
Ga0182109_11836242	3300015342	Miscanthus Phyllosphere	TYRQAVEVDRIDAAVLAEELAEIYSTPTPKGRPKPKK*
Ga0182109_12032662	3300015342	Miscanthus Phyllosphere	GTYRQAVEVDRIDAAVLAEELIEIYSTPTPKGWPKPKKVNN*
Ga0182109_12114671	3300015342	Miscanthus Phyllosphere	AVKVDRIDAAVVAEELVEIYSTPTPKGWPEPKKVN*
Ga0182189_10018604	3300015344	Miscanthus Phyllosphere	TYRQAVEVNRIDAAVLAEELAEIYYTPTPKGWPEPKK*
Ga0182189_11286591	3300015344	Miscanthus Phyllosphere	QAVEVDRIDAVVLAEELAKIYSTPTPKGWTEPKK*
Ga0182189_11804041	3300015344	Miscanthus Phyllosphere	QVVEVDRIDAAILAEELAEIYSTPTPKGWLEPKK*
Ga0182189_11854251	3300015344	Miscanthus Phyllosphere	YLQQAVEVDRIDAAILPEELAKIYSTPTPNGWPKPKK*
Ga0182189_12205001	3300015344	Miscanthus Phyllosphere	YLQQEVEVDRIDATVLAEELTEIYSTPTPKGWQEPKK*
Ga0182111_10611001	3300015345	Miscanthus Phyllosphere	QAVEVDRIDAAVLAEELAEIYSTPTPKGWPEPKK*
Ga0182111_11888211	3300015345	Miscanthus Phyllosphere	VEVDRIDAAILAEELAEIYSTPTPKGWLETKKVIDLY*
Ga0182139_12286641	3300015346	Miscanthus Phyllosphere	YRQAVEVDWIDAAILAEELTEIYSTPTPKGWPEPKR*
Ga0182161_10823871	3300015351	Miscanthus Phyllosphere	YLQQAVEVDRIDAAILAEELTEIYSTPTPKGWPEPKK*
Ga0182161_12406262	3300015351	Miscanthus Phyllosphere	VEVDRIDAAVLAEELAEIYSTPTPKGWPEPKKVIDLYCID*
Ga0182159_13315152	3300015355	Miscanthus Phyllosphere	MMVLRQAVEVDRIDAVVLAEELAEIYCTPTPKGCPEQKKNK*
Ga0182145_10881002	3300015361	Miscanthus Phyllosphere	QQTVEVDRIDAAVLAEELAEIYSTPTPKGWPEPKKVIDLY*
Ga0182145_10976831	3300015361	Miscanthus Phyllosphere	VEVDRIDAAVLAEELAEIYSTPTPKGWPEPKKVIDLY
Ga0182145_11273501	3300015361	Miscanthus Phyllosphere	GTYRQAVEVDRIDAAILAEELAEIYSTSTPKRWPEPKKVIDFVFD*
Ga0182203_10465771	3300017404	Miscanthus Phyllosphere	TYRQAVEVDRIDAAILAEELAKIYSTPTPKGWPEPKK
Ga0182203_10535791	3300017404	Miscanthus Phyllosphere	VEVDRIDAAILAEELAEIYSTPTPKGWPKPKKVIDFVFD
Ga0182203_11243931	3300017404	Miscanthus Phyllosphere	YKQAVQVDWIDAAVLAKELIEIYSTPTPKGWLKPKK
Ga0182220_10618081	3300017407	Miscanthus Phyllosphere	YLQQAVEVDRIDAVVLAEEHTEIYSTPTPMGWPKPKK
Ga0182220_10648281	3300017407	Miscanthus Phyllosphere	GINHDRTYRQAAEVDRIDVAILAEELTEIYSTPTPKGWPEPKK
Ga0182220_10904001	3300017407	Miscanthus Phyllosphere	YRQAVEVDRIDAAVLAEELADIYSTPTPKGWPEPKK
Ga0182204_10534471	3300017409	Miscanthus Phyllosphere	PXWYLQQAVEVDRIDAAVLAEELAEINSTPTPKGXPEPKK
Ga0182207_10327791	3300017410	Miscanthus Phyllosphere	QQAVEVDRIDAAVLAEELTEIYSTPTPKGWPEPKR
Ga0182208_10631831	3300017411	Miscanthus Phyllosphere	GTYRQAVEVDRIDAAVLAEELAEIYSTPTPKGWPKPKK
Ga0182222_10874941	3300017413	Miscanthus Phyllosphere	LQQAVEVDRINATVLAEELTEIYSTPTPKGWPEPKKCN
Ga0182230_10489871	3300017417	Miscanthus Phyllosphere	VEVNRIDAAVLAEELAEIYSTPTPKGWPEPKKVIDFVFD
Ga0182219_10611231	3300017424	Miscanthus Phyllosphere	KQAVEVDRIDAAVLAEELAEIYSTPTPKGWPEPKKVIDFVFD
Ga0182219_10857941	3300017424	Miscanthus Phyllosphere	YLQQAVEVDWIDAVVLAEELAEIYSTPTPKGWPEPKK
Ga0182219_11140072	3300017424	Miscanthus Phyllosphere	TYRQAVEVDLIYTTILAEERAEIYSTPTPKGWPKPKK
Ga0182224_10486482	3300017425	Miscanthus Phyllosphere	RQAVEVDRIDTVVLAEELTEIYSTPTPKGWPEPKK
Ga0182224_10529123	3300017425	Miscanthus Phyllosphere	RIDAAILAEELAEIYSTPTPKGWLEPKKVIDLYLD
Ga0182224_10737501	3300017425	Miscanthus Phyllosphere	LQQAVEVDRIDAAVLAKELAEIYSTPIPKGWSDPKK
Ga0182192_10542631	3300017430	Miscanthus Phyllosphere	IQVVEVDGIDAAVLAEELAEIYSTTPKGWPELKKVNNFVFD
Ga0182206_10400392	3300017433	Miscanthus Phyllosphere	YRQAVEVDRIDATILAEELAEIYYTPTLKGWLEPKKVI
Ga0182206_10996771	3300017433	Miscanthus Phyllosphere	AVEVDRIDAAVLAEEQAEIYSTPTPKGWPEPKKVIDLYLID
Ga0182206_11060321	3300017433	Miscanthus Phyllosphere	VEVDQSDAAILAEELTEIYCTPTPKGWPDPKKVIDFVFDWLM
Ga0182209_10413832	3300017436	Miscanthus Phyllosphere	YLQQAVEVDRIDAAVFAEELAEIYSTPTPKGWLEPKK
Ga0182209_10733582	3300017436	Miscanthus Phyllosphere	YLQQAVEVDRIDAAILAKELTEIYSTPTPKGWPELKK
Ga0182209_11157032	3300017436	Miscanthus Phyllosphere	QAVEVDRIDTAVLAEELTEIYSTHTPKGWPEPKKSN
Ga0182191_11269721	3300017438	Miscanthus Phyllosphere	QQAVEVDWINAVILAKELAEIYSTPTPKGWLEPKK
Ga0182191_11426021	3300017438	Miscanthus Phyllosphere	SHDGTYRQAVKVDRIDVAVLAEELVEIYSTPTPKGWSEPKK
Ga0182191_11695351	3300017438	Miscanthus Phyllosphere	VEVDQIDAVVHAEELAEIYPTPTPKGWPEPKKVNN
Ga0182221_11276172	3300017442	Miscanthus Phyllosphere	LQQAVEVDRIDTTVLDEELAEIYSTPTPKGWPEPKK
Ga0182221_11347761	3300017442	Miscanthus Phyllosphere	QQAVEVDQIDVAILAEELTDIYSTPTPKGWPEPKK
Ga0182221_11368961	3300017442	Miscanthus Phyllosphere	RQAVEVDRIDVAVLAEELVEIYSTPTPKGWPEPKKVIDLYLD
Ga0182221_11436472	3300017442	Miscanthus Phyllosphere	LQQAVEVDRIDAAILGEELTEIYSTPTPKGWPEPKK
Ga0182193_11425061	3300017443	Miscanthus Phyllosphere	RQAVEVDRIDAAVLAEELAKIYSTPTPKGWPEPKK
Ga0182193_11611691	3300017443	Miscanthus Phyllosphere	QQAVEVDRIDAAVLAEELVEIYSTPTPKVWPEPKK
Ga0182193_11889381	3300017443	Miscanthus Phyllosphere	RQAVEVNRIDAAVLAEELVGIYSTPTPKGWPERKKVIDFVFD
Ga0182218_10754361	3300017683	Miscanthus Phyllosphere	QQAVVVDQIDAAVLAEELAEIYSTPTPKGWPEPKK
Ga0182218_10875951	3300017683	Miscanthus Phyllosphere	KVAVEVDRIDAAVLAIELAEIYSTPTPKGWPEPKK
Ga0182225_10519391	3300017684	Miscanthus Phyllosphere	DGTYRQAVDVDRLDVAVLAEELVEIYSTPTPKGWSEPKK
Ga0182225_11058161	3300017684	Miscanthus Phyllosphere	RYLQQAVEVDRIDVAVLAEELTEIYSTPTPKGWPEPKK
Ga0182223_10824952	3300017690	Miscanthus Phyllosphere	LQQAVEVDQIDAALLSKELAEIYSTPTPKGWLEPKK
Ga0182223_10866131	3300017690	Miscanthus Phyllosphere	RYLQQAVKVDRIDAAVLAEELTEIYSTPTSKGWPEPKK
Ga0207677_114485772	3300026023	Miscanthus Rhizosphere	VEVDRIDAAVLAEELAEIYSTPTPKGWPEPKKVIDFVFD