Metagenome Family F083476

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F083476
Family Type	Metagenome
Number of Sequences	112
Average Sequence Length	39 residues
Representative Sequence	MNSSTFVLFGKYCPIVDQLSSKDSSRDFQLNCAISYFF
Number of Associated Samples	56
Number of Associated Scaffolds	112

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	3.64 %
% of genes near scaffold ends (potentially truncated)	98.21 %
% of genes from short scaffolds (< 2000 bps)	98.21 %
Associated GOLD sequencing projects	56
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (91.071 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (96.429 % of family members)
Environment Ontology (ENVO)	Unclassified (98.214 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (96.429 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 45.45% β-sheet: 0.00% Coil/Unstructured: 54.55%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.34
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 112 Family Scaffolds
PF02826	2-Hacid_dh_C	0.89

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.07 %
All Organisms	root	All Organisms	8.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.07 %
cellular organisms	root	All Organisms → cellular organisms	8.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.07 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	8.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.07 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	8.04 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.07 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	8.04 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.07 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	8.04 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.07 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	8.04 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.07 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	7.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.07 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	7.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.07 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	7.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.07 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	7.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.07 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	7.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.07 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	7.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.07 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	7.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.07 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	7.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.07 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	7.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.07 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	7.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.07 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	3.57 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.07 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	3.57 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.07 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	1.79 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	0.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.07 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	1.79 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	0.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.07 %
Saccharinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae	1.79 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	0.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.07 %
Miscanthus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus	1.79 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	0.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.07 %
Miscanthus lutarioriparius	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	1.79 %
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	0.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.07 %
Miscanthus lutarioriparius	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	1.79 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	0.89 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300003322\|rootL2_10370998	Not Available	1337	Open in IMG/M
3300014745\|Ga0157377_10706318	Not Available	733	Open in IMG/M
3300014969\|Ga0157376_13095325	Not Available	504	Open in IMG/M
3300015267\|Ga0182122_1050204	Not Available	558	Open in IMG/M
3300015268\|Ga0182154_1015769	Not Available	764	Open in IMG/M
3300015268\|Ga0182154_1041058	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	594	Open in IMG/M
3300015274\|Ga0182188_1006696	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	891	Open in IMG/M
3300015275\|Ga0182172_1069695	Not Available	518	Open in IMG/M
3300015281\|Ga0182160_1035893	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	642	Open in IMG/M
3300015283\|Ga0182156_1080853	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	516	Open in IMG/M
3300015285\|Ga0182186_1068328	Not Available	533	Open in IMG/M
3300015286\|Ga0182176_1072489	Not Available	531	Open in IMG/M
3300015286\|Ga0182176_1074227	Not Available	526	Open in IMG/M
3300015289\|Ga0182138_1025748	Not Available	718	Open in IMG/M
3300015289\|Ga0182138_1087601	Not Available	505	Open in IMG/M
3300015291\|Ga0182125_1075032	Not Available	540	Open in IMG/M
3300015292\|Ga0182141_1038282	Not Available	655	Open in IMG/M
3300015292\|Ga0182141_1049245	Not Available	610	Open in IMG/M
3300015294\|Ga0182126_1074995	Not Available	542	Open in IMG/M
3300015300\|Ga0182108_1081344	Not Available	548	Open in IMG/M
3300015302\|Ga0182143_1034985	Not Available	696	Open in IMG/M
3300015302\|Ga0182143_1086130	Not Available	534	Open in IMG/M
3300015303\|Ga0182123_1036580	Not Available	669	Open in IMG/M
3300015303\|Ga0182123_1098123	Not Available	503	Open in IMG/M
3300015304\|Ga0182112_1061470	Not Available	594	Open in IMG/M
3300015305\|Ga0182158_1072089	Not Available	564	Open in IMG/M
3300015307\|Ga0182144_1047898	Not Available	645	Open in IMG/M
3300015308\|Ga0182142_1073588	Not Available	578	Open in IMG/M
3300015314\|Ga0182140_1015708	Not Available	903	Open in IMG/M
3300015321\|Ga0182127_1125466	Not Available	501	Open in IMG/M
3300015322\|Ga0182110_1033768	Not Available	748	Open in IMG/M
3300015323\|Ga0182129_1109294	Not Available	512	Open in IMG/M
3300015341\|Ga0182187_1187851	Not Available	514	Open in IMG/M
3300015341\|Ga0182187_1197781	Not Available	504	Open in IMG/M
3300015342\|Ga0182109_1044645	Not Available	905	Open in IMG/M
3300015342\|Ga0182109_1045530	Not Available	898	Open in IMG/M
3300015342\|Ga0182109_1047824	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	884	Open in IMG/M
3300015342\|Ga0182109_1118332	Not Available	639	Open in IMG/M
3300015342\|Ga0182109_1213186	Not Available	511	Open in IMG/M
3300015343\|Ga0182155_1020016	Not Available	1147	Open in IMG/M
3300015343\|Ga0182155_1125230	Not Available	625	Open in IMG/M
3300015344\|Ga0182189_1090009	Not Available	711	Open in IMG/M
3300015344\|Ga0182189_1112168	Not Available	657	Open in IMG/M
3300015344\|Ga0182189_1192528	Not Available	538	Open in IMG/M
3300015344\|Ga0182189_1230616	Not Available	500	Open in IMG/M
3300015345\|Ga0182111_1038851	Not Available	993	Open in IMG/M
3300015345\|Ga0182111_1041962	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	966	Open in IMG/M
3300015345\|Ga0182111_1124111	Not Available	654	Open in IMG/M
3300015345\|Ga0182111_1125639	Not Available	651	Open in IMG/M
3300015346\|Ga0182139_1109774	Not Available	685	Open in IMG/M
3300015346\|Ga0182139_1120885	Not Available	661	Open in IMG/M
3300015346\|Ga0182139_1209602	Not Available	535	Open in IMG/M
3300015347\|Ga0182177_1078529	Not Available	777	Open in IMG/M
3300015347\|Ga0182177_1232806	Not Available	516	Open in IMG/M
3300015351\|Ga0182161_1023606	Not Available	1244	Open in IMG/M
3300015351\|Ga0182161_1045423	Not Available	993	Open in IMG/M
3300015351\|Ga0182161_1048777	Not Available	968	Open in IMG/M
3300015351\|Ga0182161_1137571	Not Available	656	Open in IMG/M
3300015351\|Ga0182161_1207752	Not Available	557	Open in IMG/M
3300015351\|Ga0182161_1261060	Not Available	507	Open in IMG/M
3300015355\|Ga0182159_1043750	Not Available	1181	Open in IMG/M
3300015355\|Ga0182159_1063305	Not Available	1028	Open in IMG/M
3300015355\|Ga0182159_1072034	Not Available	978	Open in IMG/M
3300015355\|Ga0182159_1160055	Not Available	707	Open in IMG/M
3300015355\|Ga0182159_1180855	Not Available	671	Open in IMG/M
3300015355\|Ga0182159_1243236	Not Available	591	Open in IMG/M
3300015355\|Ga0182159_1253602	Not Available	580	Open in IMG/M
3300015355\|Ga0182159_1266970	Not Available	567	Open in IMG/M
3300015355\|Ga0182159_1298808	Not Available	539	Open in IMG/M
3300015361\|Ga0182145_1141016	Not Available	560	Open in IMG/M
3300015361\|Ga0182145_1179322	Not Available	516	Open in IMG/M
3300017404\|Ga0182203_1032296	Not Available	839	Open in IMG/M
3300017404\|Ga0182203_1119386	Not Available	559	Open in IMG/M
3300017404\|Ga0182203_1141164	Not Available	528	Open in IMG/M
3300017410\|Ga0182207_1166591	Not Available	512	Open in IMG/M
3300017411\|Ga0182208_1086694	Not Available	571	Open in IMG/M
3300017411\|Ga0182208_1100465	Not Available	545	Open in IMG/M
3300017413\|Ga0182222_1060099	Not Available	587	Open in IMG/M
3300017413\|Ga0182222_1105469	Not Available	505	Open in IMG/M
3300017420\|Ga0182228_1037351	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	801	Open in IMG/M
3300017420\|Ga0182228_1118999	Not Available	518	Open in IMG/M
3300017424\|Ga0182219_1059698	Not Available	655	Open in IMG/M
3300017425\|Ga0182224_1143596	Not Available	527	Open in IMG/M
3300017430\|Ga0182192_1038813	Not Available	837	Open in IMG/M
3300017430\|Ga0182192_1129994	Not Available	556	Open in IMG/M
3300017430\|Ga0182192_1140810	Not Available	541	Open in IMG/M
3300017433\|Ga0182206_1068423	Not Available	658	Open in IMG/M
3300017433\|Ga0182206_1126947	Not Available	541	Open in IMG/M
3300017436\|Ga0182209_1001376	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1994	Open in IMG/M
3300017436\|Ga0182209_1145414	Not Available	533	Open in IMG/M
3300017436\|Ga0182209_1153118	Not Available	524	Open in IMG/M
3300017438\|Ga0182191_1057991	Not Available	737	Open in IMG/M
3300017438\|Ga0182191_1127164	Not Available	569	Open in IMG/M
3300017438\|Ga0182191_1159079	Not Available	527	Open in IMG/M
3300017442\|Ga0182221_1079045	Not Available	639	Open in IMG/M
3300017443\|Ga0182193_1090328	Not Available	658	Open in IMG/M
3300017443\|Ga0182193_1096534	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	644	Open in IMG/M
3300017443\|Ga0182193_1163210	Not Available	537	Open in IMG/M
3300017682\|Ga0182229_1046784	Not Available	733	Open in IMG/M
3300017683\|Ga0182218_1046526	All Organisms → cellular organisms → Eukaryota	724	Open in IMG/M
3300017683\|Ga0182218_1073581	Not Available	632	Open in IMG/M
3300017683\|Ga0182218_1096116	Not Available	582	Open in IMG/M
3300017684\|Ga0182225_1040370	Not Available	746	Open in IMG/M
3300017684\|Ga0182225_1105322	Not Available	555	Open in IMG/M
3300017685\|Ga0182227_1030369	Not Available	933	Open in IMG/M
3300017686\|Ga0182205_1031773	Not Available	874	Open in IMG/M
3300017686\|Ga0182205_1039096	Not Available	818	Open in IMG/M
3300017686\|Ga0182205_1067975	Not Available	685	Open in IMG/M
3300017690\|Ga0182223_1039825	Not Available	688	Open in IMG/M
3300017690\|Ga0182223_1106111	Not Available	526	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	96.43%
Rhizome	Host-Associated → Plants → Rhizome	1.79%
Rhizosphere	Host-Associated → Plants → Rhizosphere	1.79%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	96.43%
Unclassified	Host-Associated → Plants → Rhizome → Unclassified	1.79%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	1.79%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	96.43%
Unclassified	Host-Associated → Plants → Rhizome → Unclassified → Unclassified	1.79%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	1.79%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	96.43%
Sugarcane Root And Bulk Soil	Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil	1.79%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.79%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300003322	Sugarcane root Sample L2	Host-Associated	Open in IMG/M
3300003323	Sugarcane root Sample H1	Host-Associated	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated	Open in IMG/M
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017682	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
rootL2_103709982	3300003322	Sugarcane Root And Bulk Soil	MNSTTFVLFGKYCPIVDQLVSKDSSHDFQLNCVISYFFTYI*
rootH1_103276862	3300003323	Sugarcane Root And Bulk Soil	QTWQDFFNLMNSTTFVLFDKYCSIVYQLGSKDSSRDFELNCVIRYFFTYI*
Ga0157377_107063181	3300014745	Miscanthus Rhizosphere	MNSSTFVLFGKYCPIVDQLSSKDSSRDFQLNCAISYFF
Ga0157376_130953251	3300014969	Miscanthus Rhizosphere	MNSTTFVLFGKYYPIVDQLGSKDSSRDFQLNCVISYFFYL
Ga0182122_10502041	3300015267	Miscanthus Phyllosphere	MNSTIFVLFDKYCPIVDQLGLKDSSRDFQLNYVISYFFYL
Ga0182154_10157691	3300015268	Miscanthus Phyllosphere	MNSIIFVLFGKYCPIVDQLGLKDSSRDFQLNCVISY
Ga0182154_10410581	3300015268	Miscanthus Phyllosphere	MNSTTFVLFDKYCSIVDQLGSKDLSRDFQLNCVISYFFYLH
Ga0182188_10066961	3300015274	Miscanthus Phyllosphere	MNSRTFVLFGKYCPIVDQLSSKDSSRDFQLNCVIS
Ga0182172_10696951	3300015275	Miscanthus Phyllosphere	VLFGKYCPIVDQLSLKDSSRDFQLNCAISYFFTYI*
Ga0182160_10358933	3300015281	Miscanthus Phyllosphere	MNSTIFVLFDKYCPIVDQLGLKDSSRDFQLNYVISYFFYLHLI
Ga0182156_10808531	3300015283	Miscanthus Phyllosphere	MNSSTFVLFGKYYLIVDQLSSKDSSRDFQLNYAISYFF
Ga0182186_10683282	3300015285	Miscanthus Phyllosphere	MNSSTFVLFDKYCPIVDQLSSKDSSRDFQLNCAISYFFYL
Ga0182176_10724891	3300015286	Miscanthus Phyllosphere	MNSTTFILFGKYCPIVDQLGSKDSSRDFQLNCVISYF
Ga0182176_10742271	3300015286	Miscanthus Phyllosphere	MNSSTFVLFGKYCPIVDQLSSKDSSRDFQLNCAISYFFYL
Ga0182138_10257481	3300015289	Miscanthus Phyllosphere	MNNSIFVLFGKYCLIVDQLSSKGSSRDFQLNCAISYFFLPTFNAP
Ga0182138_10876011	3300015289	Miscanthus Phyllosphere	ITFVLFDKYYPIVNQLGSKNSSRNFQLNYVISYFFIYI*
Ga0182125_10750321	3300015291	Miscanthus Phyllosphere	TFVLFGLYCPIVNQLSSKDLSRDFQLNCAISYFFTYI*
Ga0182141_10382822	3300015292	Miscanthus Phyllosphere	MNSSTFVLFGKYCPIVDQLSSKDSSRDFQLNCTISYFFTYI*
Ga0182141_10492451	3300015292	Miscanthus Phyllosphere	MNSSTFVLFDKYCPIVDQLSSKDSSRDFQLNCAISYF
Ga0182126_10749951	3300015294	Miscanthus Phyllosphere	MNSSVFVLFGKYYLIVDQLSSKDSSRDFQLNCAISFF
Ga0182108_10813441	3300015300	Miscanthus Phyllosphere	MNSSTFVLFGKYCPIVDQLSSKDSSRDFQLNCTIS
Ga0182143_10349851	3300015302	Miscanthus Phyllosphere	MNSTTFVLFGKYCLIMDQLGSKDSSRDFQLNCVIS
Ga0182143_10861301	3300015302	Miscanthus Phyllosphere	MAKNCNPMNSSTFVLFGKYCPIVDQLSSKDSSRDFQLNC
Ga0182123_10365801	3300015303	Miscanthus Phyllosphere	MNSTTFVLFDKYYPIVNQLGSKDLSRDFQLNCVISYFF
Ga0182123_10981231	3300015303	Miscanthus Phyllosphere	MNSATFILFGKYYPIVDQLGSKDSSRDFQLNCVISFFLPTFNTP
Ga0182112_10614701	3300015304	Miscanthus Phyllosphere	TFVLFNKYCPIVDQLGSKDSSRDFQLNYVISYFFTYI*
Ga0182158_10720891	3300015305	Miscanthus Phyllosphere	MNSTIFVLFGKYSPIVDQLGSKDSSRDFQLNYVISYFFY
Ga0182144_10478981	3300015307	Miscanthus Phyllosphere	MNSSTLVLFDKYCPIVDQLGSKDSSRDFELNCAISYFFY
Ga0182142_10735881	3300015308	Miscanthus Phyllosphere	MNSTTFVLFGKYCPIVDQLGSKDSSRDFQLNYVIS
Ga0182140_10157081	3300015314	Miscanthus Phyllosphere	NPMNSSTFVLFGKYCPIMDQLSSKDSSRDFELNCTISYFFTYI*
Ga0182127_11254661	3300015321	Miscanthus Phyllosphere	MNSTTFVLFGKYYSTVDQLGSKDSSRDFQLNCVISYFFYLHLIL
Ga0182110_10337681	3300015322	Miscanthus Phyllosphere	NFNPMNSSTFVLFGKYCLIVDQLSSKDLSRDFQLNYAISYFFYLHLMLHASG*
Ga0182129_11092942	3300015323	Miscanthus Phyllosphere	MNSIIFVLFGKYCPIVDQLGSKDSSRDFQLNYVISYFFY
Ga0182187_11878511	3300015341	Miscanthus Phyllosphere	MNSTTFVLFNKYCPIVDQLGSKDSSRDFQLNYIISYF
Ga0182187_11977811	3300015341	Miscanthus Phyllosphere	MNSSTFVLFGKYCPIVDQLSSKDSSRDFQLNCAISYFFTYI
Ga0182109_10446451	3300015342	Miscanthus Phyllosphere	STTFVLFDKYCPIMYQLGLKDSSRDFQLNYVINYFFTYI*
Ga0182109_10455302	3300015342	Miscanthus Phyllosphere	MNSITFVLFGKYCPIVDQLGSKDSSRDFQLNYIISYFFTYI*
Ga0182109_10478241	3300015342	Miscanthus Phyllosphere	MNSSAFVLFGKYYPIVDQLSSKDSSRDFQLNCVISYFF
Ga0182109_11183321	3300015342	Miscanthus Phyllosphere	MNSIIFVLFGKYCPIVDQLGSKDSSRDFQLNCVIS
Ga0182109_12131861	3300015342	Miscanthus Phyllosphere	MNSSIFVLFGKYCPIVDQLSSKDSSRDFQLNYAISYF
Ga0182155_10200161	3300015343	Miscanthus Phyllosphere	MNSTIFVLFDKYYPIVDQLGLKDSSRDFQLNCVISYFFYL
Ga0182155_11252301	3300015343	Miscanthus Phyllosphere	ALSFVFGKNCPIMDYLALKDSSRQLRTNYAISYFFTYI*
Ga0182189_10900091	3300015344	Miscanthus Phyllosphere	MNSSTFVLFGKYYPIVDQLSSKDSSRDFQLNCAISFFLP
Ga0182189_11121681	3300015344	Miscanthus Phyllosphere	MNSTTFVLFGKYCPIVDQLGSKDSSRDFQLNCVISYF
Ga0182189_11925282	3300015344	Miscanthus Phyllosphere	MNSSIFVLFDKYCSIVDQLSSKDSSYDFQLNYTISYFF
Ga0182189_12306161	3300015344	Miscanthus Phyllosphere	MNSSTFVLFGKYYPIVDQLSSKDSSRDFQLNCAISYFFYLHLML
Ga0182111_10388513	3300015345	Miscanthus Phyllosphere	MNSSTFVLFGKYCPIVDQLSSKDSSRDFQLNCAIS
Ga0182111_10419622	3300015345	Miscanthus Phyllosphere	MNNTTFVLFGKYCPIVDQLGSKDSSRDFQLNYVISYFFT
Ga0182111_11241111	3300015345	Miscanthus Phyllosphere	MNSITFVLFDKYYPIVDQLSSKDSSRDFKLNCAISYFFYL
Ga0182111_11256391	3300015345	Miscanthus Phyllosphere	MNNIIFVLFGKYYLIVDQLGSKDSYRDFQLNCVISYF
Ga0182139_11097741	3300015346	Miscanthus Phyllosphere	MMNNSTFVLFGKYYPIVNQLSSKDSSRDSQLNCAISYFFY
Ga0182139_11208851	3300015346	Miscanthus Phyllosphere	MNSRIFVLFGKYCPIVDQLSSKDLSRDFQLNCAISYF
Ga0182139_12096022	3300015346	Miscanthus Phyllosphere	MNSTTFVLFGKYYPIVDQLGSKDSSRDFQLNYVISYFF
Ga0182177_10451431	3300015347	Miscanthus Phyllosphere	KNFKPMNSTTFVLFDKYCPIVDQLGSKDSSRDFQLNYVISYFFTYI*
Ga0182177_10785291	3300015347	Miscanthus Phyllosphere	MNSSVFVLFGKYCPIVDQLSSKDSSRDFQLNCVISYF
Ga0182177_12328061	3300015347	Miscanthus Phyllosphere	MNSTTFVLFCKYCPIVDQLGSKDSSRDFQLNCVISYFFLPTFNTP
Ga0182161_10236062	3300015351	Miscanthus Phyllosphere	MNSIIFVLFGKYCLIVDQLGSKDLSRDFQLNCVISYFFLPIFN
Ga0182161_10454231	3300015351	Miscanthus Phyllosphere	MNSSTFVLFDKYCPIVDQLGSKDSSRDFELNCAISYF
Ga0182161_10487771	3300015351	Miscanthus Phyllosphere	MNSTTFVLFGKYYPIVDQLGSKDSSRDFQLNCVISFF
Ga0182161_11375711	3300015351	Miscanthus Phyllosphere	MNPMNSTTFVLFGKYCPIVDQLGSKDSSRDFQLNC
Ga0182161_12077521	3300015351	Miscanthus Phyllosphere	MNSITFVLFDKYCPIVDQLGSKDSSRDFQLNCVISYF
Ga0182161_12610601	3300015351	Miscanthus Phyllosphere	MNSSTFVLFGKYYPIVDQLSSKDSSRDFQLKCAISYFFYLHLMLHTN
Ga0182159_10437502	3300015355	Miscanthus Phyllosphere	MNSTTFVLFDKYYPIVDQLGSKDSSRDFQLNCVISYFF
Ga0182159_10633051	3300015355	Miscanthus Phyllosphere	VLFGKYYPIVDQLGSKDSSRDFQLNCVISYFFTYI*
Ga0182159_10720342	3300015355	Miscanthus Phyllosphere	MNNTIFVLFDKYCPIVDQLGSKDSSRDFQLNCVIS
Ga0182159_11600551	3300015355	Miscanthus Phyllosphere	MNLINSIIFVLFDKYCPIVNQLGSKDLSRDFQLNCVIIYFFYLH
Ga0182159_11808551	3300015355	Miscanthus Phyllosphere	MNSTTFVLFDKYCPIVDQLSSKDSSRDFQLNCVIS
Ga0182159_12432361	3300015355	Miscanthus Phyllosphere	MNSSIFVLLGKYCPIEDQLSSKDSSRDFELNYAISYFFYLHLML
Ga0182159_12536021	3300015355	Miscanthus Phyllosphere	MNSTTFVLFGKYCPIMDQLDSKDSSRDFQLNCVISYFF
Ga0182159_12669702	3300015355	Miscanthus Phyllosphere	MNSSDFVLFGKYYPIVDQLSSKDSSRDFQLNCAISYFFT
Ga0182159_12988082	3300015355	Miscanthus Phyllosphere	MNSSTFVLFGKYCPIVDQLGSKDSSRDFELNCAISYFFT
Ga0182145_11410161	3300015361	Miscanthus Phyllosphere	SNFVLFDKYCPIVDQLSSKDSSRDFQLNYVISYFFTYI*
Ga0182145_11793222	3300015361	Miscanthus Phyllosphere	TFVLFDKYCPIVDQLGSKDSSRDFELNYAISYFFTYI*
Ga0182203_10322961	3300017404	Miscanthus Phyllosphere	MNSTTFVLFGKYCPIVDQLGSKDSSRDFQLNCVISY
Ga0182203_11193861	3300017404	Miscanthus Phyllosphere	MNSSTFVLFGKYYSIVDQLSSKDSSRDFQLNCAISYFFYL
Ga0182203_11411641	3300017404	Miscanthus Phyllosphere	MNSTIFVLFGKYGPIVDQLGSKDSSRDFQLNCVISFFYLHLI
Ga0182207_11665911	3300017410	Miscanthus Phyllosphere	TFVLFDKYCPIVDQLGSKDSSRDFQLNCVISYFFTYI
Ga0182208_10866941	3300017411	Miscanthus Phyllosphere	MNSTTFVLFDKYCPIVDQLGSKDLSRDFQLNCVISYFF
Ga0182208_11004651	3300017411	Miscanthus Phyllosphere	MNSSTFVLFGKYYPIVDQLSSKDSSRDFQLNCAISYFF
Ga0182222_10600991	3300017413	Miscanthus Phyllosphere	MNSATFVLFGKYCLIVDQLGSKDSSRDFQLNCVIS
Ga0182222_11054691	3300017413	Miscanthus Phyllosphere	MNSSNFVLFDKYCPIVDQLSSKDSSRDFELNCAISYFFYLH
Ga0182228_10373512	3300017420	Miscanthus Phyllosphere	MNSSTFVLFDKYCPIVDQLGLKDSSRDFELNCAISYFFTY
Ga0182228_11189991	3300017420	Miscanthus Phyllosphere	MNSSIFVLFDKYCSIVDQLSSKDSSRDFQLNCAISYF
Ga0182219_10596982	3300017424	Miscanthus Phyllosphere	MNNSIFVLFGKYCPIVDQLSSKDSSHDFQLNYAISYFFYLHLMLH
Ga0182224_11435961	3300017425	Miscanthus Phyllosphere	MNSTAFVLFDKYCPIVDQLGSKDSSRDFQLNCVIS
Ga0182192_10388131	3300017430	Miscanthus Phyllosphere	MNSTIFVLFDKYCPIMDQLGSKVSSRDFQLNCVISYFFYLHLI
Ga0182192_11299941	3300017430	Miscanthus Phyllosphere	MNSTIFVLFDKYCPIVDQLGLKDSSRDFQLNCVISYF
Ga0182192_11408101	3300017430	Miscanthus Phyllosphere	MNNSIFVLFGKYCPIVDQLSSKDSSHDFQLNYAISYFFYLHLMLHA
Ga0182206_10684231	3300017433	Miscanthus Phyllosphere	MNSNIFVLSGKYCLIVDQLSSKDLSRDFQLNCVISFFF
Ga0182206_11269471	3300017433	Miscanthus Phyllosphere	MNSTTFVLFGKYCSIVDQLGSKDSSRDFQLNCVISYF
Ga0182209_10013761	3300017436	Miscanthus Phyllosphere	MNSSIFVLFGKYCPIVDQLSSKDLSRDLELNYTISYFFYLH
Ga0182209_11454141	3300017436	Miscanthus Phyllosphere	MNSTTFVLFCKYCPIVDQLGSKDSSRDFQLNCVISYFF
Ga0182209_11531181	3300017436	Miscanthus Phyllosphere	MNSIIFVLFGKYCLIVDQLGSKDSSRDFQLNYVISY
Ga0182191_10579911	3300017438	Miscanthus Phyllosphere	MNSNTFVLFDKYYLIVDQLSSKDSSRDFQLNYAISYFFY
Ga0182191_11271641	3300017438	Miscanthus Phyllosphere	MNSSTFVLFGKYYPIVDQLSSKDSSRDFELNCAINYFF
Ga0182191_11590791	3300017438	Miscanthus Phyllosphere	MNSSTFVLFGKYCPIVDQLSSKDSSRYFQLNCAISY
Ga0182221_10790451	3300017442	Miscanthus Phyllosphere	PMNNSIFVLFGKYYLIVDQLSSKDSYRDFQLNYAISYFFYLHLMLYANG
Ga0182193_10903281	3300017443	Miscanthus Phyllosphere	MAKNFNMMNSSIFVLFNKYCLIVDQLSSKDLSRDFQLNC
Ga0182193_10965342	3300017443	Miscanthus Phyllosphere	MNSITFVLFGKYCLIVDQLGSKDSSRDFQLNCVIS
Ga0182193_11632101	3300017443	Miscanthus Phyllosphere	MNSSTFVLFGKYCPIMDQLSSKNSSRDFELNCAISY
Ga0182229_10467841	3300017682	Miscanthus Phyllosphere	VLFDKYYSIVDQLGSKDSSRDFQLNCVISYFFTYI
Ga0182218_10465261	3300017683	Miscanthus Phyllosphere	MNSTIFVLFGKYCPIVDQLGSKDSSRDFQLNCVIS
Ga0182218_10735811	3300017683	Miscanthus Phyllosphere	MNNNIFVLFSKYCLIVDQLSSKDSSHDFQLNCTISYFFY
Ga0182218_10961161	3300017683	Miscanthus Phyllosphere	MNSTTFILFGKYCPIVDQLGSKDSSHDFQLNCVISYFF
Ga0182225_10403702	3300017684	Miscanthus Phyllosphere	MNSSTFVLFGKYCPIMNQLSSKDSSRDFQLNCAINYFFYL
Ga0182225_11053221	3300017684	Miscanthus Phyllosphere	MNSNTFVLFGKYCPIMDQLSLKDSSRDFQLNCEISYFFYL
Ga0182227_10303691	3300017685	Miscanthus Phyllosphere	MNSSTFVLFGKYCPIVDQLSLKDSSRDFQLNCAISYF
Ga0182205_10317731	3300017686	Miscanthus Phyllosphere	MNSSTFVLFGKYCPIMDQLSSKDSYRDFQLNYAISYFFYLHLMLHAN
Ga0182205_10390961	3300017686	Miscanthus Phyllosphere	MNSTIFVLFDKYCLIVNQLGLKDLSRNFQLNCVISYFLAIF
Ga0182205_10679751	3300017686	Miscanthus Phyllosphere	LKKKVNPINSTIFVLFDKYYPIVDQLGSKDSSRDFQLNCVINYFF
Ga0182223_10398253	3300017690	Miscanthus Phyllosphere	VLFGKYYPIVDQLSSKDSSRDFQLNCAISYFFTYI
Ga0182223_11061112	3300017690	Miscanthus Phyllosphere	MNSTTFVLFDKYCLIVDQLGSKDSSRDFQLNCVIS

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F083476

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences