| Basic Information | |
|---|---|
| Family ID | F083403 |
| Family Type | Metagenome |
| Number of Sequences | 113 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MQFCRLYTGNDGKSHFEELDQTEGSEHFLAPLAVKALVFKNDENRDDL |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 87.61 % |
| % of genes near scaffold ends (potentially truncated) | 98.23 % |
| % of genes from short scaffolds (< 2000 bps) | 87.61 % |
| Associated GOLD sequencing projects | 102 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (85.841 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (13.274 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.743 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (38.053 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.42% β-sheet: 15.79% Coil/Unstructured: 65.79% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF13649 | Methyltransf_25 | 15.93 |
| PF08241 | Methyltransf_11 | 11.50 |
| PF05175 | MTS | 7.96 |
| PF00378 | ECH_1 | 6.19 |
| PF12847 | Methyltransf_18 | 4.42 |
| PF16576 | HlyD_D23 | 2.65 |
| PF12704 | MacB_PCD | 2.65 |
| PF13489 | Methyltransf_23 | 1.77 |
| PF13533 | Biotin_lipoyl_2 | 1.77 |
| PF12700 | HlyD_2 | 0.88 |
| PF00202 | Aminotran_3 | 0.88 |
| PF03352 | Adenine_glyco | 0.88 |
| PF00005 | ABC_tran | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG2818 | 3-methyladenine DNA glycosylase Tag | Replication, recombination and repair [L] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 86.73 % |
| Unclassified | root | N/A | 13.27 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000559|F14TC_100604253 | All Organisms → cellular organisms → Bacteria | 1376 | Open in IMG/M |
| 3300000559|F14TC_103493182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1109 | Open in IMG/M |
| 3300000955|JGI1027J12803_101896360 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300000955|JGI1027J12803_108018126 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota | 644 | Open in IMG/M |
| 3300001431|F14TB_101999122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 684 | Open in IMG/M |
| 3300003994|Ga0055435_10235843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 535 | Open in IMG/M |
| 3300003997|Ga0055466_10023726 | Not Available | 1355 | Open in IMG/M |
| 3300003999|Ga0055469_10063023 | Not Available | 1000 | Open in IMG/M |
| 3300005293|Ga0065715_10354828 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300005294|Ga0065705_10181749 | All Organisms → cellular organisms → Bacteria | 1573 | Open in IMG/M |
| 3300005331|Ga0070670_101433397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 633 | Open in IMG/M |
| 3300005332|Ga0066388_106005158 | Not Available | 613 | Open in IMG/M |
| 3300005332|Ga0066388_106720168 | Not Available | 579 | Open in IMG/M |
| 3300005337|Ga0070682_101674330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300005364|Ga0070673_100284435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1451 | Open in IMG/M |
| 3300005450|Ga0066682_10242133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1160 | Open in IMG/M |
| 3300005518|Ga0070699_102217020 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300005546|Ga0070696_101821969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 526 | Open in IMG/M |
| 3300005577|Ga0068857_102110173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 553 | Open in IMG/M |
| 3300005617|Ga0068859_101902729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 657 | Open in IMG/M |
| 3300005718|Ga0068866_11457760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300006844|Ga0075428_101901275 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300006846|Ga0075430_100918294 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300006847|Ga0075431_100752814 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300006852|Ga0075433_10600964 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300006853|Ga0075420_101661587 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300006894|Ga0079215_11712609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 503 | Open in IMG/M |
| 3300006903|Ga0075426_10485600 | Not Available | 917 | Open in IMG/M |
| 3300006904|Ga0075424_102177889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 584 | Open in IMG/M |
| 3300006954|Ga0079219_11051441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 683 | Open in IMG/M |
| 3300006969|Ga0075419_10114032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1746 | Open in IMG/M |
| 3300007004|Ga0079218_11445288 | Not Available | 739 | Open in IMG/M |
| 3300009078|Ga0105106_10394543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 998 | Open in IMG/M |
| 3300009147|Ga0114129_13161556 | Not Available | 537 | Open in IMG/M |
| 3300009156|Ga0111538_11530648 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300009162|Ga0075423_10119392 | All Organisms → cellular organisms → Bacteria | 2764 | Open in IMG/M |
| 3300009162|Ga0075423_12481826 | Not Available | 566 | Open in IMG/M |
| 3300009162|Ga0075423_13037383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300009168|Ga0105104_10448579 | Not Available | 722 | Open in IMG/M |
| 3300009609|Ga0105347_1169271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 864 | Open in IMG/M |
| 3300009610|Ga0105340_1114952 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300010043|Ga0126380_10474568 | Not Available | 953 | Open in IMG/M |
| 3300010043|Ga0126380_11702979 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300010047|Ga0126382_11272632 | Not Available | 663 | Open in IMG/M |
| 3300010376|Ga0126381_104624397 | Not Available | 530 | Open in IMG/M |
| 3300010399|Ga0134127_10502098 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
| 3300010401|Ga0134121_11616862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 668 | Open in IMG/M |
| 3300011427|Ga0137448_1216363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300011439|Ga0137432_1124766 | Not Available | 818 | Open in IMG/M |
| 3300012200|Ga0137382_10832260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 665 | Open in IMG/M |
| 3300012226|Ga0137447_1074351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 653 | Open in IMG/M |
| 3300012358|Ga0137368_10095124 | All Organisms → cellular organisms → Bacteria | 2329 | Open in IMG/M |
| 3300012361|Ga0137360_10008926 | All Organisms → cellular organisms → Bacteria | 6305 | Open in IMG/M |
| 3300012485|Ga0157325_1039631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 507 | Open in IMG/M |
| 3300012922|Ga0137394_10014569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 6221 | Open in IMG/M |
| 3300012929|Ga0137404_10117330 | All Organisms → cellular organisms → Bacteria | 2171 | Open in IMG/M |
| 3300012930|Ga0137407_10058699 | All Organisms → cellular organisms → Bacteria | 3156 | Open in IMG/M |
| 3300012984|Ga0164309_10068215 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2133 | Open in IMG/M |
| 3300012985|Ga0164308_11129047 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300012989|Ga0164305_11369202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 622 | Open in IMG/M |
| 3300014150|Ga0134081_10325004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 558 | Open in IMG/M |
| 3300014254|Ga0075312_1152533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 513 | Open in IMG/M |
| 3300014304|Ga0075340_1099046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 584 | Open in IMG/M |
| 3300014315|Ga0075350_1188430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 539 | Open in IMG/M |
| 3300014326|Ga0157380_13489717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 504 | Open in IMG/M |
| 3300014873|Ga0180066_1057504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 775 | Open in IMG/M |
| 3300014969|Ga0157376_12696349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 537 | Open in IMG/M |
| 3300015357|Ga0134072_10364069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 559 | Open in IMG/M |
| 3300015373|Ga0132257_103282832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 589 | Open in IMG/M |
| 3300015374|Ga0132255_105790198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 523 | Open in IMG/M |
| 3300018054|Ga0184621_10215181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 688 | Open in IMG/M |
| 3300018076|Ga0184609_10183172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 973 | Open in IMG/M |
| 3300018077|Ga0184633_10136580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1270 | Open in IMG/M |
| 3300018077|Ga0184633_10321939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 785 | Open in IMG/M |
| 3300018081|Ga0184625_10559168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 567 | Open in IMG/M |
| 3300018422|Ga0190265_10070016 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3161 | Open in IMG/M |
| 3300018429|Ga0190272_13233143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 508 | Open in IMG/M |
| 3300018481|Ga0190271_10947544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 985 | Open in IMG/M |
| 3300019377|Ga0190264_10713684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 743 | Open in IMG/M |
| 3300019377|Ga0190264_11087256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 650 | Open in IMG/M |
| 3300020004|Ga0193755_1117586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 831 | Open in IMG/M |
| 3300020016|Ga0193696_1172122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 522 | Open in IMG/M |
| 3300020060|Ga0193717_1004135 | All Organisms → cellular organisms → Bacteria | 7930 | Open in IMG/M |
| 3300020084|Ga0194110_10924303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 517 | Open in IMG/M |
| 3300020197|Ga0194128_10099198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → Azospirillum lipoferum | 1813 | Open in IMG/M |
| 3300021081|Ga0210379_10193447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 875 | Open in IMG/M |
| 3300021081|Ga0210379_10413966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 596 | Open in IMG/M |
| 3300025318|Ga0209519_10317424 | Not Available | 902 | Open in IMG/M |
| 3300025551|Ga0210131_1084720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 544 | Open in IMG/M |
| 3300025900|Ga0207710_10765232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 507 | Open in IMG/M |
| 3300026044|Ga0208287_1001270 | All Organisms → cellular organisms → Bacteria | 2764 | Open in IMG/M |
| 3300026095|Ga0207676_10520968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1132 | Open in IMG/M |
| 3300026315|Ga0209686_1035397 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1896 | Open in IMG/M |
| 3300026343|Ga0209159_1020115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3778 | Open in IMG/M |
| 3300026538|Ga0209056_10032547 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4896 | Open in IMG/M |
| 3300027209|Ga0209875_1042850 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300027843|Ga0209798_10445220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 600 | Open in IMG/M |
| 3300027880|Ga0209481_10226177 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300027907|Ga0207428_11103011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300028587|Ga0247828_10544949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 698 | Open in IMG/M |
| 3300028884|Ga0307308_10569710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 543 | Open in IMG/M |
| 3300030006|Ga0299907_10025394 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4529 | Open in IMG/M |
| 3300031562|Ga0310886_10949847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 549 | Open in IMG/M |
| 3300031720|Ga0307469_10816371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 857 | Open in IMG/M |
| 3300031740|Ga0307468_100805567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 802 | Open in IMG/M |
| 3300031901|Ga0307406_11067041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 696 | Open in IMG/M |
| 3300031947|Ga0310909_10588812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 930 | Open in IMG/M |
| 3300031965|Ga0326597_11279926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 718 | Open in IMG/M |
| 3300032000|Ga0310903_10440292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 671 | Open in IMG/M |
| 3300032002|Ga0307416_100063616 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3022 | Open in IMG/M |
| 3300032003|Ga0310897_10082380 | Not Available | 1241 | Open in IMG/M |
| 3300033513|Ga0316628_100639346 | All Organisms → cellular organisms → Bacteria | 1390 | Open in IMG/M |
| 3300034147|Ga0364925_0274977 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 13.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.39% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 5.31% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.31% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.42% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.54% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.54% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 3.54% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.54% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.65% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.77% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.77% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.77% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.77% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.77% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.77% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.77% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.77% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.77% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.77% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.89% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.89% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.89% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300003994 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300003997 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 | Environmental | Open in IMG/M |
| 3300003999 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011427 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT418_2 | Environmental | Open in IMG/M |
| 3300011439 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012226 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT400_2 | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Host-Associated | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014254 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D2 | Environmental | Open in IMG/M |
| 3300014304 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300014315 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014873 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10D | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
| 3300020060 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2 | Environmental | Open in IMG/M |
| 3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
| 3300020197 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65m | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
| 3300025551 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026044 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027209 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F14TC_1006042533 | 3300000559 | Soil | MQLCRLYTGPDGKSHFEDLDQNQGSQHFLNTLPAKALVFKNDMNRDDLHGWHPAP |
| F14TC_1034931821 | 3300000559 | Soil | MQFCRIYTGADGKSHFEDFDQTQGARHFLTALDVKTLVFKNDMNREDLHGWHNAPRRQ |
| JGI1027J12803_1018963602 | 3300000955 | Soil | MQFCRLYTGNDGKSHFEELDQTEGSEHFLAPLAVKALVFKND |
| JGI1027J12803_1080181261 | 3300000955 | Soil | MQMYRLYMGNDGKSHFEELDQAEGSNHFLAPLAVKALVFKND |
| F14TB_1019991221 | 3300001431 | Soil | MQFCRIYTGEDGKSHFEDLDQSQGSKHFLENLPVKTLVFKNDMNRD |
| Ga0055435_102358432 | 3300003994 | Natural And Restored Wetlands | MQFCRLYTGADGKSHFEELDQKEGSKFFLTAITPKSLVFKN |
| Ga0055466_100237261 | 3300003997 | Natural And Restored Wetlands | MKFCRIYTGADGQSHFEDLPQTAGSKHFLTDLSVKTLVFKNDTHRDDLRGWH |
| Ga0055469_100630231 | 3300003999 | Natural And Restored Wetlands | MQFCRLYTGADGKSHFEELNQNEGAREFMKEHPAGALVFKNDKLRDD |
| Ga0065715_103548281 | 3300005293 | Miscanthus Rhizosphere | MQFCRMYTGADGKSHFEELDQQEGSKFFLTAITSKALVFKNDLNRDDLHG |
| Ga0065705_101817491 | 3300005294 | Switchgrass Rhizosphere | MQFCRLYTGNDGKSHFEELDQADGSKHFLAPLVVKALVFKNDKNRDDLLGWHTAP |
| Ga0070670_1014333972 | 3300005331 | Switchgrass Rhizosphere | MQFCRMYTGDDGKSHFQELDQTQGSEFFLSTIAAKALVFKNDDNR |
| Ga0066388_1060051581 | 3300005332 | Tropical Forest Soil | MQFCRLYTGKDGKSHFEELDQAEGSPHFLKPFTVKNLVFKNDKNREDLLGWH |
| Ga0066388_1067201681 | 3300005332 | Tropical Forest Soil | MHFCRLYTGNDGKSHFEELDQADGSSHFLAPLTVKTLVFKND |
| Ga0070682_1016743301 | 3300005337 | Corn Rhizosphere | MQFCRLYTGDDRRSHFEDLDQTEGSKHFLATLPAKALVFKNDSNRDDLHGWHTAPRRQWC |
| Ga0070673_1002844351 | 3300005364 | Switchgrass Rhizosphere | LQFCRLYTGDDGRSHFEDLDQTAGSKHFLATLPVKALVFKNDT |
| Ga0066682_102421331 | 3300005450 | Soil | MQFCRIYTGGDGKSHFEELDQREGSKFFLTSLAVKALVFKNDMN |
| Ga0070699_1022170201 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LQIVYGNDGKSHFEELDQTEGSEHFLAPLAVKALVFKNDENRDDL |
| Ga0070696_1018219692 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MQFCRIYTGADGKSHFEDLDQTQGAKHFLTGLDVKTLVFKNDMNR |
| Ga0068857_1021101732 | 3300005577 | Corn Rhizosphere | LQFCRLYTGDDGRSHFEDLDQSAGSKHFLATLPVKTLVFKN |
| Ga0068859_1019027291 | 3300005617 | Switchgrass Rhizosphere | MQFCRMYTGEDGKSHFEELEQQQGAKSFDSRIDAKTLV |
| Ga0068866_114577602 | 3300005718 | Miscanthus Rhizosphere | MQFCRMYTGDDGESHFEELDQNEGSKFFLTIITPKALVFKNDMNRDDLHGWHNAPR |
| Ga0075428_1019012751 | 3300006844 | Populus Rhizosphere | MQFCRLYTGDDDKSHFEELDQQESSKHFAAAVTAKALAFKNDQNRDDLLGWHTAPRRQW |
| Ga0075430_1009182941 | 3300006846 | Populus Rhizosphere | MQFCRLYTGNDGQSHFEELDQAEGSKHFLAPLVVKTLVFKNDKNREDLLGWHTA |
| Ga0075431_1007528141 | 3300006847 | Populus Rhizosphere | MQFCRMYTGEDGKSHFEELDQQQGSKFFLTTITPKALVFKNDMNRDDLHGWHNAPRRQWC |
| Ga0075433_106009642 | 3300006852 | Populus Rhizosphere | MQFCRMYTGADGKSHFEELDQQEGSKYFLTTITPKALVFKNDMNRDDLHGWHNAPRRQWC |
| Ga0075420_1016615872 | 3300006853 | Populus Rhizosphere | MQFCRLYTGDDGKSHFEELDQAESSKYFSTPLMVKALVFKNDK |
| Ga0079215_117126091 | 3300006894 | Agricultural Soil | MQFCRMYSGADGKSHFEELDQDAGSKLFSNSLPVKALVFKNDDNRDILG |
| Ga0075426_104856001 | 3300006903 | Populus Rhizosphere | MQFCRIYSGADGKSHFEDFDQDQGSKYFLSALDVKTLVFKNDMNR |
| Ga0075424_1021778891 | 3300006904 | Populus Rhizosphere | MQFCRLYTGDDGQSYFEDFDQGEGSKHFLTNLSVKALVFKND |
| Ga0079219_110514411 | 3300006954 | Agricultural Soil | LQFCRLYTGHDGRSHFEDLDQSAGSKHFLATLPVKALVFKNDTNRD |
| Ga0075419_101140322 | 3300006969 | Populus Rhizosphere | MQFCRLYTGDDGKSHFEELDQAESSKYFSTPLMVKALVFKNDKTVTIS* |
| Ga0079218_114452881 | 3300007004 | Agricultural Soil | MQFCRLYTGNDGKSHFEDLEQQEGSLHFLADQQATALVFKNDVLRSDLHAYHNAPRRQ |
| Ga0105106_103945431 | 3300009078 | Freshwater Sediment | MYTGDDGRSHFEELDQTEGSRFFLGAIAAKALVFK |
| Ga0114129_131615561 | 3300009147 | Populus Rhizosphere | MQFCRLYTGNDGRSHFEQLDQAEGSKHFLAPLVVKALVFKNDKNREDLLG |
| Ga0111538_115306481 | 3300009156 | Populus Rhizosphere | MEFCRLYTGNDGQSHFEELDQAEGSKHFLAPLVVKALVFKNDKNREDLLGWHTAPRRQ |
| Ga0075423_101193921 | 3300009162 | Populus Rhizosphere | MQFCRIYTGEDGKSHFEDLDQSEGSKHFLENLPVKTLVFKNDMN |
| Ga0075423_124818261 | 3300009162 | Populus Rhizosphere | MQFCRLYTGDDRRSHFEDLDQTEGSKHLLATLPAKALVLKDDSKRHDLNGWKSAP |
| Ga0075423_130373831 | 3300009162 | Populus Rhizosphere | MQFCRLYTGDDGKSHFEELDQAESSAHFSTPLMVKALIFKNDKNRDDLL |
| Ga0105104_104485792 | 3300009168 | Freshwater Sediment | MQFCRLYTGNDGKSHFEELDQADGSKHFLAPLTVKTLVFK |
| Ga0105347_11692711 | 3300009609 | Soil | MYTGDDGKSHFEELDQTQGSKFFLSTIASKALVFKNDDNRDILGW |
| Ga0105340_11149521 | 3300009610 | Soil | MYTGADGKSHFEELDQQGGSKFFLTTITPKALVFK |
| Ga0126380_104745681 | 3300010043 | Tropical Forest Soil | MHFCRLYTGNDGQSHFEELDQAEGSPHFLKPFTVKNLVFKNDKNREDLLGWHT |
| Ga0126380_117029791 | 3300010043 | Tropical Forest Soil | MQFCRLYTGKDGKSHFEELDQAEGSPHFLKPFTVKNLVFKNDKNREDLLGWHT |
| Ga0126382_112726321 | 3300010047 | Tropical Forest Soil | LYTGNDGQSHFEELDQAEGSPHFLKPFTVKNLVFKNDKNREDLLGWHTA |
| Ga0126381_1046243972 | 3300010376 | Tropical Forest Soil | MQFCRLYTGKDGKSHFEELDQAEGSPHFLKPFTVKNLVFKNDKNREDLLGWHTA |
| Ga0134127_105020981 | 3300010399 | Terrestrial Soil | MYTGADGKSHFEELDQQEGSKFFLTAITSKALVFK |
| Ga0134121_116168621 | 3300010401 | Terrestrial Soil | MQFCRIYTGADGKSHFEDFDQNQGAKHFLTGLDVKTLVFKNDMNREDLHGWHNAPRRQ |
| Ga0137448_12163631 | 3300011427 | Soil | MYTGDDGKSHFEELDQSEGAKLFQSALAVKALMFKNDQN |
| Ga0137432_11247661 | 3300011439 | Soil | MQFCRLYTGDDDRSHFEELDQQEGSKHFAAPFAVKALAFKNDKNRGDLLGWHTAPR |
| Ga0137382_108322601 | 3300012200 | Vadose Zone Soil | MKLCRLYTGEDGKSHFEDLDQSEGSKYFLATLACKALVFKNDTN |
| Ga0137447_10743511 | 3300012226 | Soil | MQFCRLYTGADGKSHFEELDQKQGSKFFLTTITPKALVFKNDFNRDDLHGWHNA |
| Ga0137368_100951243 | 3300012358 | Vadose Zone Soil | MQFCRIYTGEDGKSHFEDLDQSEGSKHFLRSLPVKALVF |
| Ga0137360_100089261 | 3300012361 | Vadose Zone Soil | MQFCRLYTGNDGKSHFEELDQTEGSEHFLAPLAVKALVFKNDENRDDL |
| Ga0157325_10396312 | 3300012485 | Arabidopsis Rhizosphere | MQFCRIYTGADGKSHFEDFDQNQGAKHFLTGLDVKTLVFKNDMNREDLH |
| Ga0137394_100145698 | 3300012922 | Vadose Zone Soil | MQFCRLYTGNDGKSHFAELDQAESSEHFLAPLAVRTLVFKNDKNRDD |
| Ga0137404_101173301 | 3300012929 | Vadose Zone Soil | MQFCRIYTGADGKSHFEDFDQNQGAKHFLTGLDVKTLVFKNDMNREDLHGWHNAPRRQWCIT |
| Ga0137407_100586991 | 3300012930 | Vadose Zone Soil | MQFCRIYTGKDDKSHFEDFDQSEGSKHFLTNLSVKTLVFKNDTNRD |
| Ga0164309_100682151 | 3300012984 | Soil | MQFCRLYTGDDRRSHFEDLDQTEGSKHFLATLPAKALVFKNDSNRDDLHGW |
| Ga0164308_111290471 | 3300012985 | Soil | MQFCRLYTGDDRRSHFEDLDQTEGSKHFLATLPAKALVFKN |
| Ga0164305_113692021 | 3300012989 | Soil | MQFCRIYSGADGKSHFEDFDQNQGAKHFLTGLDVKT |
| Ga0134081_103250042 | 3300014150 | Grasslands Soil | MQFCRIYTGGDGKSHFEELDQREGSKFFLTSLAVKALVFK |
| Ga0075312_11525331 | 3300014254 | Natural And Restored Wetlands | MAELNLGDHMKFCRIYTGADGQSHFEDLPQTAGSKHFLTDLSVKTLVFKNDTHRDDLRGWHNAPRRQWCIT |
| Ga0075340_10990462 | 3300014304 | Natural And Restored Wetlands | MYTGDDGKSHFEQLDQTQGSQFFLSTIAAKALVFKNDDNRDI |
| Ga0075350_11884302 | 3300014315 | Natural And Restored Wetlands | MYTGDDGKSHFEQLDQTQGSQFFLSTIAAKALVFKNDDNRDILGWHNAP |
| Ga0157380_134897171 | 3300014326 | Switchgrass Rhizosphere | MYTGDDGKSHFEELDQAQGSQFFLSTIGAKALVFKN |
| Ga0180066_10575042 | 3300014873 | Soil | MYTGDDGKSHFEELDQSEGAKLFQSALAVKALMFKNDQNRDDLHGW |
| Ga0157376_126963492 | 3300014969 | Miscanthus Rhizosphere | MQFCRLYTGPDGKSHFEDLDQSQGSKYFLNAIQSKAAMFKNDTNRDDLHGWHN |
| Ga0134072_103640692 | 3300015357 | Grasslands Soil | MQFCRIYTGGDGKSHFEELDQREGSKFFLTSLAVKAL |
| Ga0132257_1032828322 | 3300015373 | Arabidopsis Rhizosphere | MQFCRLYTGPDGKSHFEDLDQSQGSKYFLNAIQSKAAMFKNDTNRDDLHGW |
| Ga0132255_1057901981 | 3300015374 | Arabidopsis Rhizosphere | MYTGDDGKSHFEELDQNEGSKFFLTIITPKALVFKNDMHRDDLHGWHNAPRRQWCI |
| Ga0184621_102151811 | 3300018054 | Groundwater Sediment | MQFCRLYTGDDGKSHFEDLAQTDGSKYFLKNLSAKTLVFKNDMNRDDLHGW |
| Ga0184609_101831721 | 3300018076 | Groundwater Sediment | MQFCRLFTGADGKSHFEDLDQSQGSKHFLTALAVKALVFKNDTNRDDL |
| Ga0184633_101365802 | 3300018077 | Groundwater Sediment | MQFCRLYTGADGKSHFEDLDQSQGSKYFLTALAVKALVFKNDTNRDDLHGWHTAPRRQWC |
| Ga0184633_103219392 | 3300018077 | Groundwater Sediment | MQFCRLYTGADGKSHFEELDQTEGSKFFLTAITPKA |
| Ga0184625_105591681 | 3300018081 | Groundwater Sediment | MQFCRIYTGADLKSHFEELDQKEGGQFFLTNITAKTLVFKNDLNRDDLHGWHNAPRRQWCITLS |
| Ga0190265_100700161 | 3300018422 | Soil | MQFCRMYTGDDGKSHFEELEQDAGSKLFSNSLPVKALVFKNDENPDIL |
| Ga0190272_132331432 | 3300018429 | Soil | MQFCRMYTGVDRKSHFEELDQTQGGKFFLSTLAAKALVFKN |
| Ga0190271_109475444 | 3300018481 | Soil | MQFCRMYTGSDGKSHFEELDQTPGGKSFLSTLAAKALVFKNDQ |
| Ga0190264_107136841 | 3300019377 | Soil | MQFCRMYTGDDGKSRFEELEQNVGSQFFLNSLPVKALV |
| Ga0190264_110872561 | 3300019377 | Soil | MQFCRMYTGNDGKSHFEELDQQLGSSFFLSRINTKALVF |
| Ga0193755_11175861 | 3300020004 | Soil | MQFCRIYTGADGKSYFEDFDQNQGAKHFLTGLDVKTLVFKNDMNREDLHGWHNAPR |
| Ga0193696_11721222 | 3300020016 | Soil | MQFCRIYTGADGKSHFEDFDQNQGAKHFLTGLDVKTLVFKNDMNREDL |
| Ga0193717_10041351 | 3300020060 | Soil | MQFCRMYTGEDGKSHFEELEQQQGAKSFDSRIAAKTLVFKND |
| Ga0194110_109243032 | 3300020084 | Freshwater Lake | MQFCRMYTGADGKSHFEDLDQSLASEFFLKAINAKA |
| Ga0194128_100991981 | 3300020197 | Freshwater Lake | MHFCRLYTGNDGQSHFEELDQQEGAEFFLSTIPAKALKFKNDKNRDDLHGWHNAPRR |
| Ga0210379_101934471 | 3300021081 | Groundwater Sediment | MQFCRLYTGDDGKSHFEELDQKEGSKFFLTTITPKALVFKNDFNRDD |
| Ga0210379_104139661 | 3300021081 | Groundwater Sediment | MQFCRLYTGDDGKSHFEDLDQSQGSKHFLTALSVKALVFKNDVNRDDLHGWYNAPRPQWCITLS |
| Ga0209519_103174242 | 3300025318 | Soil | MQFCRIYTGDDGQSHFEDLPQTEESKHFLTHLSVKTLVFKNDTHRDDLHGWHNAPRRQWC |
| Ga0210131_10847201 | 3300025551 | Natural And Restored Wetlands | MQFCRLYTGADGKSHFEELDQKEGSKFFLTAITPKSLVFKNDMN |
| Ga0207710_107652322 | 3300025900 | Switchgrass Rhizosphere | MQFCRLYTGPDGKSHFEDLDQSQGSKYFLNAIQSKAAMFKNDTNRDDLHGWHTAPR |
| Ga0208287_10012704 | 3300026044 | Natural And Restored Wetlands | MAELNLGDHMKFCRIYTGADGQSHFEDLPQTAGSKHFLTDLSVKTLVFKND |
| Ga0207676_105209683 | 3300026095 | Switchgrass Rhizosphere | MQFCRMYTGEDGKSHFEELEQQQGAKSFDSRIDVKTLVFKNDDNRDILGWH |
| Ga0209686_10353973 | 3300026315 | Soil | MQFCRIYTGGDGKSHFEELDQREGSKFFLTSLAVK |
| Ga0209159_10201155 | 3300026343 | Soil | MQFCRIYTGGDGKSHFEELDQREGSKFFLTSLAVKALVFKNDMNREDLHGWHTAPRRQ |
| Ga0209056_100325471 | 3300026538 | Soil | MQFCRIYTGGDGKSYFEELDQREGSKFFLTSLAVK |
| Ga0209875_10428501 | 3300027209 | Groundwater Sand | MQFCRLYTGNDGKSHFEALDQAEGSKHFLAPLTVKTLVFKNDQNREDLLGWHTAPRRQWCIT |
| Ga0209798_104452201 | 3300027843 | Wetland Sediment | MQFCRMYTGDDGKSHFEELDQNQGAKFFLTTINAKGLVFKNDDNKD |
| Ga0209481_102261772 | 3300027880 | Populus Rhizosphere | MQFCRLYTGDDGKSHFEELDQAESSKYFSTPLMVKALVFKNDKTVTIS |
| Ga0207428_111030111 | 3300027907 | Populus Rhizosphere | MEFCRLYTGNDGQSHFEELDQAEGSKHFLAPLVVKALVFKNDKNREDLLGWHTAPRRQW |
| Ga0247828_105449491 | 3300028587 | Soil | MQFCRMYSGADGKSHFEELDQDAASKLFSNSLPVKALVFKN |
| Ga0307308_105697102 | 3300028884 | Soil | MQFCRLYTGDDGQSYFEDFDQGEGSKHFLTNLSVKALVFKNDMNRDDLHGWHPAPRR |
| Ga0299907_100253941 | 3300030006 | Soil | MQFCRIYTGDDGQSHFEDLPQSEGSKHFLTNLPVKALVFKNDTARDDLS |
| Ga0310886_109498471 | 3300031562 | Soil | MQFCRMYSGADGKSHFEELDQDAGSKLFSNSLPVKA |
| Ga0307469_108163712 | 3300031720 | Hardwood Forest Soil | MQFCRLYTGDDGQSYFEDFDQGEGSKHFLTNLSVKALVFKN |
| Ga0307468_1008055672 | 3300031740 | Hardwood Forest Soil | MQFCRIYTGADGKSHFEDFDQTQGAKHFLTGLDVK |
| Ga0307406_110670412 | 3300031901 | Rhizosphere | MQFCRMYTGDDGKSHFEELEQTAASKFFFTSLPAKALVFKNDENRDILGWHN |
| Ga0310909_105888121 | 3300031947 | Soil | MQFCRLYTGADGRSHFEDLDQTEGSRHFLATLPAK |
| Ga0326597_112799261 | 3300031965 | Soil | MHFCRLYTGDDGQSHFEELDQKEGSKFFLTTITPKALV |
| Ga0310903_104402922 | 3300032000 | Soil | MQFCRMYTGDDGKSHFEELDQTQGSQFFLSTIAAKALVFKNDDNRDILGW |
| Ga0307416_1000636165 | 3300032002 | Rhizosphere | MQFCRMYTGDDGKSHFEELEQTAASKFFFTSLPAKALV |
| Ga0310897_100823801 | 3300032003 | Soil | MQFCRLYTGDDRRSHFEDLDQTEGSKHFLATLPAKALVFKNDSNRDDLHGWHT |
| Ga0316628_1006393463 | 3300033513 | Soil | MLFCRLFTGDDDKSHFEDLDQSPSSTYFLSALPSKALVFKNDMNRDDLHGFHNA |
| Ga0364925_0274977_3_134 | 3300034147 | Sediment | MQFCRMYTGADGKSHFEELDQQEGSKFFLTTITPKALVFKNDLN |
| ⦗Top⦘ |