 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F083380 |
| Family Type | Metagenome |
| Number of Sequences | 113 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MKTKELEKLFKDRLAKDGINKKWMDEKLIFVGLDDEDIKDD |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 65.49 % |
| % of genes near scaffold ends (potentially truncated) | 22.12 % |
| % of genes from short scaffolds (< 2000 bps) | 80.53 % |
| Associated GOLD sequencing projects | 72 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (47.788 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (37.168 % of family members) |
| Environment Ontology (ENVO) | Unclassified (94.690 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (98.230 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.88% β-sheet: 0.00% Coil/Unstructured: 68.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF11753 | DUF3310 | 14.16 |
| PF12957 | DUF3846 | 2.65 |
| PF13155 | Toprim_2 | 1.77 |
| PF00268 | Ribonuc_red_sm | 0.88 |
| PF03592 | Terminase_2 | 0.88 |
| PF00476 | DNA_pol_A | 0.88 |
| PF03783 | CsgG | 0.88 |
| PF06067 | DUF932 | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG0208 | Ribonucleotide reductase beta subunit, ferritin-like domain | Nucleotide transport and metabolism [F] | 0.88 |
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 0.88 |
| COG1462 | Curli biogenesis system outer membrane secretion channel CsgG | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
| COG3728 | Phage terminase, small subunit | Mobilome: prophages, transposons [X] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 52.21 % |
| Unclassified | root | N/A | 47.79 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 37.17% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 34.51% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 12.39% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 5.31% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 2.65% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.65% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.77% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.89% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.89% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.89% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300001720 | Marine viral communities from the Pacific Ocean - LP-36 | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300008216 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar | Environmental | Open in IMG/M |
| 3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
| 3300009449 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
| 3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017730 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13 | Environmental | Open in IMG/M |
| 3300017732 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11 | Environmental | Open in IMG/M |
| 3300017735 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21 | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017742 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21 | Environmental | Open in IMG/M |
| 3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020274 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX556029-ERR598943) | Environmental | Open in IMG/M |
| 3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022164 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2) | Environmental | Open in IMG/M |
| 3300025048 | Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes) | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025071 | Marine viral communities from the Pacific Ocean - LP-36 (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025101 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300029318 | Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289 | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100347124 | 3300000101 | Marine | MKTKELEKLFKDRLAKDGINKKWMDEKLIFVGLDDEDDNDE* |
| DelMOSum2010_100575182 | 3300000101 | Marine | MKTKELEKLFKDRLAKDGIDKKWMDEKLIFVGLDDEDKAND* |
| DelMOSum2010_100853544 | 3300000101 | Marine | MKTKELEKLFKDRLAKDGIDKKWMDEKLIFVGLDDEDIKDD* |
| DelMOSum2010_101254473 | 3300000101 | Marine | MKTKELEKLFKDRLAKDGINKKWMDEKLIFVGLDDEESDNE* |
| DelMOSum2011_100666904 | 3300000115 | Marine | KTKELEKLFKDRLAKDGIDKKWMDEKLIFVGLDDEDIKDD* |
| DelMOSum2011_101758651 | 3300000115 | Marine | MKTKELEKLFKDRLAKDGIDKKWMNEKLIFVGLDDEDIKDD* |
| JGI24006J15134_100927871 | 3300001450 | Marine | MKTKELGKLFKDKLAKDGINKKWMDEKLIFVGLDEEDDNEN* |
| JGI24006J15134_101539711 | 3300001450 | Marine | ELEKLFKDRLAKDGINKKWMDEKLIFVGLDEESDNE* |
| JGI24003J15210_100565955 | 3300001460 | Marine | MKTKELKKLFKDKLAKDGINKKWMDEKLIFVGLDEESENE* |
| JGI24003J15210_100773952 | 3300001460 | Marine | MKTKELEKLFKDRLAKDGINKKWMDEKLIFVGLDEEADNES* |
| JGI24004J15324_100292096 | 3300001472 | Marine | MKTKELEKLFKDRLAKDGINKKWMDEKLIFVGLDEEDENE* |
| JGI24004J15324_100578735 | 3300001472 | Marine | ELEKLFKDRLAKDGINKKWMDEKLIFVGLDEEGENER* |
| JGI24004J15324_101368911 | 3300001472 | Marine | MKTKELKKLFKDKLAKDGINKKWMDEKLIFVGLDEES |
| JGI24005J15628_100541704 | 3300001589 | Marine | MKTKELEKLFKDRLAKDGINKKWMDEKLIFVGLDEESDNE* |
| JGI24513J20088_10255162 | 3300001720 | Marine | MKTKELEKLFKDRLAKDGINKKWMDEKLIFVGLDEEADNE* |
| Ga0075466_10000628 | 3300006029 | Aqueous | MKTKELEKLFKDRLVKDGINKDWMDKKLIFVGLDDEETKDD* |
| Ga0075466_10066616 | 3300006029 | Aqueous | MKTKELEKLFKDRLAKDGINKKWMDEKLIFVGLDDEDDNE* |
| Ga0098038_100464413 | 3300006735 | Marine | MKTKELEKLFKDRLAKDGIDKKWMDEKLIFVGLDDEDTKDD* |
| Ga0098038_10195525 | 3300006735 | Marine | MKTKELEKLFKDRLAKDGINKKWMDEKLIFVGLDDEDEDE* |
| Ga0098037_10835052 | 3300006737 | Marine | MKTKDLEKLFKDKLFRDGMNKKWMDERLILDGLDDEDVKDD* |
| Ga0098037_12160243 | 3300006737 | Marine | MKTKELEKLFKDKLIKDGINKDWMDKKLIFVGLNDEEIKDD* |
| Ga0098042_10314032 | 3300006749 | Marine | MKTKELEKLFKDKLAKDGINKDWMDEKLIFVSFEDDEEEE* |
| Ga0098055_10989032 | 3300006793 | Marine | MKTKKLEKLFKDKLFRDDMNKKWLDERLILDGLDDEDIKDD* |
| Ga0075467_102091893 | 3300006803 | Aqueous | MKTKELEKLFKDRLAKDGIDKKWMDEKLIFVGLDDEDDNE* |
| Ga0070754_100970762 | 3300006810 | Aqueous | MKTKELEKLFKDRLVKDGINKKWMDEKLIFVGLDDEESDNDD* |
| Ga0070746_103496753 | 3300006919 | Aqueous | MKTKELEKLFKDRLVKDGIDKKWMNEKLIFVGLDDEDIKDD* |
| Ga0070748_10351272 | 3300006920 | Aqueous | MKIKELEKLFKDRLAKDGIDKKWMDEKLIFVGLDDEDKAND* |
| Ga0098060_100337312 | 3300006921 | Marine | MKTKELEKLFKDKLVKDGINKDWMDKKLIFVGLNDEEIKDD* |
| Ga0098060_10411711 | 3300006921 | Marine | QAIQGARKMKTKELEKLFKDRLAKDGINKKWMDEKLIFVGLDDEDEDE* |
| Ga0098051_12100853 | 3300006924 | Marine | MKTKKLEKLFKDKLFRDGMNKKWLDERLILDGLDDEDIKDD* |
| Ga0098036_11124803 | 3300006929 | Marine | MKVKELEKLFKDKLAKDGISKDWMNEKLVFVGLDDDEEEE* |
| Ga0070747_10819682 | 3300007276 | Aqueous | MKIKELEKLFKDRLAKDGIDKKWMDEKLIFVGLDDEDIKDD* |
| Ga0070752_13123111 | 3300007345 | Aqueous | MKTKELEKLFKDRLVKDGINKKWLDEKFIVIGLDDEESDNDD* |
| Ga0114898_11001743 | 3300008216 | Deep Ocean | MKTKELEKLFKDRLAKDGINKKWMDEKLIFVGLDEEESDNE* |
| Ga0115551_11290946 | 3300009193 | Pelagic Marine | MKTKELEKLFKDRLAKDGIDKKWMDEKLIFVGLDDEDKANDG |
| Ga0115558_11079455 | 3300009449 | Pelagic Marine | MKTKELEKLFKDRLAKDGINKKWMDEKLIFVGLDDEDD |
| Ga0098056_10667885 | 3300010150 | Marine | MKPKKLEKLFKDKLFRDGMNKKWLDERLILDGLDDEDIKDD* |
| Ga0098059_11289883 | 3300010153 | Marine | MKTKDLEKLFKDKLFRDGMKKKWMDERLILDGLDDEDVKDD* |
| Ga0180120_103252023 | 3300017697 | Freshwater To Marine Saline Gradient | MKIKELEKLFKDRLAKDGIDKKWMDEKLIFVGLDDEDIKDDXHITSNTRCY |
| Ga0181369_11288022 | 3300017708 | Marine | MKTKELEKLFKDRLAKDGIDKKWMDKKLIFVGLDDEDTKDD |
| Ga0181403_10176135 | 3300017710 | Seawater | MKTKELEKLFKDKLFRDGMNKKWLDERLILDGLDDEDIKDD |
| Ga0181391_10438472 | 3300017713 | Seawater | MKIKELEKLFKDKAFRDGINKKWMDEKLIFVGLDDEDDNE |
| Ga0181412_11165702 | 3300017714 | Seawater | MKTKELEKLFKDRLAKDGIDKKWMDEKLIFVGLDDKETKDD |
| Ga0181373_10512803 | 3300017721 | Marine | MKTKELKKLFKDRLAKDGIDKKWMDEKLIFVGLDDEDTKDD |
| Ga0181398_100299314 | 3300017725 | Seawater | MKIKELEKLFKDKLFRNGINKKWMDERLIFDGLDEEDDNE |
| Ga0181419_10056598 | 3300017728 | Seawater | MKTKELEKLFKDKLAKDGINKDWMNEKLIFVGLDDEEEE |
| Ga0181419_10187963 | 3300017728 | Seawater | MKTKELEKLFKDKAFRDGINKKWMDEKLIFVGLDDEESDNDE |
| Ga0181419_10214337 | 3300017728 | Seawater | MKIKELEKLFKDKLFRDGINKKWMDEKLIFVGLDDEDDNE |
| Ga0181417_10103444 | 3300017730 | Seawater | MKIKELEKLFKDKLFRDGINKKWMDERLIFVGLDDEESDNDE |
| Ga0181415_10568041 | 3300017732 | Seawater | MKIKELEKLFKDKLFRNGINKKWMDERLIFDGLDDEESDNDE |
| Ga0181431_11246042 | 3300017735 | Seawater | MKIKELEKLFKDKAFRDGINKKWMNEKLIFDGLDEEDDNE |
| Ga0181428_11590813 | 3300017738 | Seawater | MKTKELEKLFKDKLFRDGMNKKWLDERLILDGLDDEDI |
| Ga0181433_10065021 | 3300017739 | Seawater | MKTKDLEKLFKDKLFRDGMNKKWMDERLILDGLDDEDVKD |
| Ga0181418_10491852 | 3300017740 | Seawater | MKIKELEKLFKDKAFRDGINKKWMDEKLIFVGLDDEESDNDE |
| Ga0181418_11313412 | 3300017740 | Seawater | MKTKELEKLFKDKLFRDGMNKKWMDEKLIFVGLDDKETKDD |
| Ga0181421_10137607 | 3300017741 | Seawater | MKIKELEKLFKDKLFRNGINKKWMDEKLIFVGLDDEESDNDE |
| Ga0181399_10576873 | 3300017742 | Seawater | MKTKELEKLFKDKLAKDGINKKWMDERLIFDGLDEEDDNE |
| Ga0181427_10204881 | 3300017745 | Seawater | MKTKKLEKLFKDKLFRDGINKKWMDEKLIFVGLDDKETKDD |
| Ga0187219_10644454 | 3300017751 | Seawater | MKTKKLEKLFKDKLFRDGMNKKWLDERLILDGLDDEDIKDDXRIT |
| Ga0187219_10798081 | 3300017751 | Seawater | LEKLFKDKLFRDGMNKKWLDERLILDGLDDEDIKDD |
| Ga0181400_12014883 | 3300017752 | Seawater | MKTKELEKLFKDKLFRDGMNKKWLDERLILDGLDDEDIKDDXHIT |
| Ga0181407_10634395 | 3300017753 | Seawater | MKIKELEKLFKDKLFRDGINKKWMDERLIFDGLDDEESDNDE |
| Ga0181382_10608544 | 3300017756 | Seawater | MKTKELEKLFKDKLAKDGIDKKWMDEKLIFVGLDDEDDNE |
| Ga0181420_10022472 | 3300017757 | Seawater | MKTKELEKLFKDKLAKDGINKDWMNEKLIFVGFGDDEEEE |
| Ga0181409_11897654 | 3300017758 | Seawater | KIKELEKLFKDKLFRDGINKKWMDERLIFDGLDEEDDNER |
| Ga0181414_11370752 | 3300017759 | Seawater | MKIKELEKLFKDKLFRDGINKKWMDEKLIFVGLDDEESDNDE |
| Ga0181385_12331342 | 3300017764 | Seawater | MKTKELEKLFKDRLAKDGINKKWMDEKLIFVGLDDEESDND |
| Ga0181385_12398112 | 3300017764 | Seawater | MKTKELEKLFKDRLAKDGIDKKWMDEKLIFVGLDEEENDNEN |
| Ga0181413_10227101 | 3300017765 | Seawater | KTKELEKLFKDKLFRDGINKKWMDERLIFDGLDEEDDNE |
| Ga0181425_11254431 | 3300017771 | Seawater | MKTKELEKLFKDKLFRDGMNKKWLDERLILDGLDDE |
| Ga0181386_10244884 | 3300017773 | Seawater | MKIKELEKLFKDKAFRDGINKKWMDEKLIFVGLDEEDDNE |
| Ga0181386_10912611 | 3300017773 | Seawater | MKTKDLEKLFKDKLFRDGMNKKWMDERLILDGLDDEDVKDDXCIKC |
| Ga0181394_10404562 | 3300017776 | Seawater | MKTKELEKLFKDKLFRDGINKKWIDERLIFDGLDEEDDNE |
| Ga0181395_10916345 | 3300017779 | Seawater | MKTKDLEKLFKDKLFRDGMNKKWMDERLILDGLDDEDVKDDXCI |
| Ga0181423_10475392 | 3300017781 | Seawater | MKTKELEKLFKDKLFRDGINKKWMDERLIFDGLDDEESDNDE |
| Ga0181379_10797182 | 3300017783 | Seawater | MKTKDLEKLFKDKLFRDGMNKKWMDERLILDGLDDEDVTDD |
| Ga0181424_100280038 | 3300017786 | Seawater | MKIKELEKLFKDKLFRDGINKKWMDERLIFDGLDEEDDNDE |
| Ga0181563_100870182 | 3300018420 | Salt Marsh | MKTKELEKLFKDRLAKDGIDKKWMDEKLIFIGLDDEDIKDD |
| Ga0211658_10140361 | 3300020274 | Marine | MKTKDLEKLFKDRLAQDGINKAWMDEKLVFVGFEDDEEEE |
| Ga0213862_100564023 | 3300021347 | Seawater | MKVKELEKLFKDKLVKDGISKDWLDKKFIVLGSDIEEEEE |
| Ga0213869_100688543 | 3300021375 | Seawater | MKTKELEKLFKDRLVKDGINKDWMDKKLIFVGLDDEETKDD |
| Ga0213869_104158062 | 3300021375 | Seawater | MKTKELEKLFKDRLAKDGINKKWMDEKLIFVGLDDEESDNE |
| Ga0212030_10083962 | 3300022053 | Aqueous | MKTKELEKLFKDRLAKDGINKKWMDEKLIFVGLDDEDDNE |
| Ga0224906_10272585 | 3300022074 | Seawater | MKTKDLEKLFKDKLFRDGMNKKWMDERLILDGLDDEDVKDD |
| Ga0224906_10564573 | 3300022074 | Seawater | MKTKKLEKLFKDKLFRDGMNKKWLDERLILDGLDDEDIKDD |
| Ga0224906_10579701 | 3300022074 | Seawater | MKIKELEKLFKDKLFRDGINKKWMDERLIFDGLDDEDDNDE |
| Ga0212022_10747392 | 3300022164 | Aqueous | MKIKELEKLFKDRLAKDGIDKKWMDEKLIFVGLDDEDIKDD |
| Ga0207905_10260414 | 3300025048 | Marine | MKTKELEKLFKDRLAKDGINKKWMDEKLIFVGLDEEADNES |
| Ga0208667_10272723 | 3300025070 | Marine | MKTKELEKLFKDRLAKDGIDKKWMDEKLIFVGLDDEDTKDD |
| Ga0207896_10277412 | 3300025071 | Marine | MKTKELEKLFKDRLAKDGINKKWMDEKLIFVGLDEEADNE |
| Ga0208298_10379853 | 3300025084 | Marine | MKTKELEKLFKDRLAKDGIDKKWMDEKLIFVGLDDEDIKDD |
| Ga0208298_10486641 | 3300025084 | Marine | MKTKELEKLFKDRLAKDGIDKKWMDEKLIFVGLDDED |
| Ga0208157_10103017 | 3300025086 | Marine | RTRQMKTKELEKLFKDRLAKDGIDKKWMDEKLIFVGLDDEDIKDD |
| Ga0208157_10252533 | 3300025086 | Marine | MKTKELEKLFKDRLAKDGINKKWMDEKLIFVGLDDEDEDE |
| Ga0208434_10878942 | 3300025098 | Marine | MKTKELEKLFKDRLAKDGINKKWMDEKLIFVGLDDEDIKDD |
| Ga0208669_10068966 | 3300025099 | Marine | MKTKKLEKLFKDKLFRDDMNKKWLDERLILDGLDDEDIKDD |
| Ga0208669_10187656 | 3300025099 | Marine | MKTKDLEKLFKDKLSKDGINKQWMDEKLIFIGLDDEDIKDD |
| Ga0208159_10117314 | 3300025101 | Marine | MKTKELEKLFKDKLAKDGINKDWMDEKLIFVSFEDDEEEE |
| Ga0209535_10261719 | 3300025120 | Marine | MKTKELKKLFKDKLAKDGINKKWMDEKLIFVGLDEESENE |
| Ga0209535_10586257 | 3300025120 | Marine | MKTKELEKLFKDRLAKDGINKKWMDEKLIFVGLDEE |
| Ga0209535_10888587 | 3300025120 | Marine | MKTKELEKLFKDRLAKDGINKKWMDEKLIFVGLDEEENDNEN |
| Ga0209535_11240172 | 3300025120 | Marine | MKTKELEKLFKDRLAKDGIDKKWMDEKLIFVGLDDEENENG |
| Ga0209535_11983011 | 3300025120 | Marine | LEKLFKDRLAKDGINKKWMDEKLIFVGLDEEADNE |
| Ga0209232_10460723 | 3300025132 | Marine | MKTKDLEKLFKDKLAKDGIDKKWMDEKLIFIGLDDEDTKDD |
| Ga0209232_10584774 | 3300025132 | Marine | MKTKELEKLFKDKLAKDGINKKWMDKKLIFVGLYEEEDNE |
| Ga0209634_11897964 | 3300025138 | Marine | MKTKELGKLFKDKLAKDGINKKWMDEKLIFVGLDEEADNENL |
| Ga0208643_10545712 | 3300025645 | Aqueous | MKTKELEKLFKDRLAKDGIDKKWMDEKLIFVGLDDEDDNE |
| Ga0208134_10535525 | 3300025652 | Aqueous | MKTKELEKLFKDRLVKDGINKKWMDEKLIFVGLDDEESDNDD |
| Ga0208134_10908342 | 3300025652 | Aqueous | MKTKELEKLFKDRLAKDGINKKWMDEKLIFVGLDDEDDNDE |
| Ga0185543_100032312 | 3300029318 | Marine | MKTKDLEKLFKDRLAKDGIDKKWMDEKLIIVGLDDEEEK |
| Ga0183755_10106078 | 3300029448 | Marine | MKTKELEKLFKDRLVKDGINKDWMDKKLIFIGLDDEETKDD |
| Ga0314858_178790_3_119 | 3300033742 | Sea-Ice Brine | MKTKELEKLFKDRLAKDGINKKWMDEKLIFVGLDDEEND |
| Ga0348335_044517_252_374 | 3300034374 | Aqueous | MKTKELEKLFKDRLVKDGINKKWMDEKLIFVGLDDEDDNE |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |