 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F083363 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MNYDAAVRYLLSLGRELAAPTQAAAAKFDLENITVLAE |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 43.36 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 92.04 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (77.876 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (25.664 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.894 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.133 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.82% β-sheet: 0.00% Coil/Unstructured: 68.18% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF01039 | Carboxyl_trans | 77.88 |
| PF02572 | CobA_CobO_BtuR | 8.85 |
| PF02590 | SPOUT_MTase | 1.77 |
| PF01817 | CM_2 | 0.88 |
| PF01594 | AI-2E_transport | 0.88 |
| PF02954 | HTH_8 | 0.88 |
| PF00892 | EamA | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 77.88 |
| COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 77.88 |
| COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 77.88 |
| COG2109 | ATP:corrinoid adenosyltransferase | Coenzyme transport and metabolism [H] | 8.85 |
| COG1576 | 23S rRNA pseudoU1915 N3-methylase RlmH | Translation, ribosomal structure and biogenesis [J] | 1.77 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.88 |
| COG1605 | Chorismate mutase | Amino acid transport and metabolism [E] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 77.88 % |
| All Organisms | root | All Organisms | 22.12 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.66% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.16% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.08% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.42% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.42% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.54% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.54% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.65% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.65% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.65% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.77% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.77% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.77% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.77% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.77% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.89% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009636 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 | Environmental | Open in IMG/M |
| 3300009641 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025439 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026214 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300026928 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 44 (SPAdes) | Environmental | Open in IMG/M |
| 3300027460 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-ROWE17-C (SPAdes) | Environmental | Open in IMG/M |
| 3300027516 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028863 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12712J15308_101789311 | 3300001471 | Forest Soil | MNYQAAVRYLLSLGRELAAPTQAAAAKFDLENITILAERL |
| JGI12635J15846_106647941 | 3300001593 | Forest Soil | MNYEAAVRYLLSLGRELAAPTQAAAAKFDLENITTLSER |
| JGI12635J15846_107968142 | 3300001593 | Forest Soil | MNYDAAVRYLLSLGRELAAPTQAAAAKFDLENITVLSERL |
| JGI12053J15887_104689931 | 3300001661 | Forest Soil | MNYDSAVRYLLSLGRELAAPTQAAAAKFNLENIAILLDR |
| JGI12627J18819_103705991 | 3300001867 | Forest Soil | MNYESAVRYLLSLGRELAAPTQAATAKFNLENITVLM |
| JGI25617J43924_102872662 | 3300002914 | Grasslands Soil | MNYEASVRYLLSLGRELAAPTQVAAAKFDLENITVLTERL |
| Ga0066388_1020400601 | 3300005332 | Tropical Forest Soil | MHFPEAVSYLLSLGRELAAPTQAAAAKFNLENISVLAQHLG |
| Ga0066699_112607732 | 3300005561 | Soil | MNYDAAVRYLLTLGRELAAPTQAAAAKFDLENIAIL |
| Ga0066903_1072168021 | 3300005764 | Tropical Forest Soil | MDFQQSERYLLSLGRELAAPTQAAAAKFDLENILALASA |
| Ga0068860_1019581201 | 3300005843 | Switchgrass Rhizosphere | MNFQEAVNYLLSLGRELAAPTQAATAKFNLENISVLAQHLG |
| Ga0066788_101395182 | 3300005944 | Soil | MNYDAAVRYLLSLGRELAAPIQAAAAKFDLENISVLA |
| Ga0075029_1000428251 | 3300006052 | Watersheds | MNYDGAVRYLLSLGRELAAPTQAAAAKFNLENITTLL |
| Ga0075015_1000340531 | 3300006102 | Watersheds | MDYAEAVRYLLTLGRELAAPSHARAAKFDLANISALAA |
| Ga0075015_1002428892 | 3300006102 | Watersheds | MNYEAAVRYLLSLGRELAAPTQAAAAKFDLENILTLATH |
| Ga0099794_105784591 | 3300007265 | Vadose Zone Soil | MKYEASVRYLLSLGRELAAPTQAAATKFDLENITVL |
| Ga0099828_118218521 | 3300009089 | Vadose Zone Soil | MKYEAAVRYLLSLGRELAAPTQAAAAKFDLENITIL |
| Ga0099827_116334721 | 3300009090 | Vadose Zone Soil | MNYEASVRYLLSLGRELAAPTQVAAAKFDLENITVL |
| Ga0105248_104650743 | 3300009177 | Switchgrass Rhizosphere | MNPEQAVSYLLSLGGELAAPTQAATAKFNLESVSVLAEHLGHPQTRYPSVHIAG |
| Ga0116112_11784291 | 3300009636 | Peatland | MDYAAAVRQLLSLGRELASPTQASAGKFDLENIHALAG |
| Ga0116120_12494971 | 3300009641 | Peatland | MDYAAAVRQLLSLGRELASPTQASAGKFDLENIHALAGR |
| Ga0126374_106244741 | 3300009792 | Tropical Forest Soil | MDFEQAVGYLLSLGRELAAPTQAAAAKFNLENIQLLA |
| Ga0116219_102910032 | 3300009824 | Peatlands Soil | MDYAEAVRYLLTLGRELAAPSHARAAKFDLANIRALASRMGD |
| Ga0134063_106738822 | 3300010335 | Grasslands Soil | MNFEESVRYLLSLGRELTAPTQAAAAKFNLENITTLAESLGHPER |
| Ga0126372_105723502 | 3300010360 | Tropical Forest Soil | MNYEAAVNYLLSLGRELASPTEPRAAKFDLENIAVLAERLG |
| Ga0126378_133608912 | 3300010361 | Tropical Forest Soil | MDYDAAVRYLLSLGRELAGPTQAAAAKFDLENIGLLAERLVRPDRADPSAHIT |
| Ga0137393_103538763 | 3300011271 | Vadose Zone Soil | MDYEAAVRYLLSLGRELAAPTQAASAKFDLENISVL |
| Ga0137363_117361971 | 3300012202 | Vadose Zone Soil | MNYDAAVRYLLTLGRELAAPTQAAAAKFDLENITILADR |
| Ga0137362_100829676 | 3300012205 | Vadose Zone Soil | MNYDAAVRYLLSLGRELAAPTQAGAAKFDLENITVLAER |
| Ga0137379_116078031 | 3300012209 | Vadose Zone Soil | MNYEASVRYLLSLGRELAAPTQVAAAKFDLENITV |
| Ga0137378_103208761 | 3300012210 | Vadose Zone Soil | MNYEASVRYLLSLGRELAAPTQVAAAKFDLENITVLAERL |
| Ga0137360_114858541 | 3300012361 | Vadose Zone Soil | MNYDAAVRFLLSLGRELAAPTQAAAAKFDLENISVL |
| Ga0137390_109689201 | 3300012363 | Vadose Zone Soil | MNYEASVRYLLSLGRELAAPTQVAAAKFDLENITVLTER |
| Ga0137419_100259231 | 3300012925 | Vadose Zone Soil | MNYDAAVRFLLSLGRELAAPTQAAAAKFDLENITVLSERL |
| Ga0137407_124308421 | 3300012930 | Vadose Zone Soil | MNYDASVRYLLSLGRELAAPTQAAAAKFDLENITVLAERL |
| Ga0182033_106542541 | 3300016319 | Soil | MNYASAVRYLLSLGRELAAPTQAAAAKFNLENIAVL |
| Ga0182035_107653621 | 3300016341 | Soil | MNYASAVRYLLSLGRELAAPTQAAAAKFNLENIAVLTER |
| Ga0182037_101468324 | 3300016404 | Soil | MNYDPAVRYLLTLGRELAAPTQTAAAKFDLENITVLAERL |
| Ga0181511_10156222 | 3300016702 | Peatland | MDYQSAVRYLLSLGRELAAPTQAAALKFDLENTAVLLERLGRPDRA |
| Ga0187819_102276511 | 3300017943 | Freshwater Sediment | MEYNDAVRYLLTLGRELAAPSHARAAKFDLANIRALA |
| Ga0187817_103842372 | 3300017955 | Freshwater Sediment | MNYEGAVRYLLSLGRELAVPTQAAAAKFELQNISVLLERLGRPDRAYPTVHIAG |
| Ga0187779_109613941 | 3300017959 | Tropical Peatland | MNYESAVGYLLSLGRELAAPTHAAAAKFDLENTRALAERLGGPFAGRA |
| Ga0187823_103483041 | 3300017993 | Freshwater Sediment | MNYEAAVRYLLTLGRELAAPTQAAAAKFDLENITVLAERL |
| Ga0187772_105069131 | 3300018085 | Tropical Peatland | MDYAGAVQYLLSLGRELAAPTQTAAAKFNLDNITVLLE |
| Ga0187772_105424162 | 3300018085 | Tropical Peatland | MDYQEAVRYLLSLGRELAAPTQAAAAKFNLENISI |
| Ga0187769_101851173 | 3300018086 | Tropical Peatland | MNYVSAVRYLLSLGRELAAPTQAAAAKFDLENTRVLV |
| Ga0187770_102255711 | 3300018090 | Tropical Peatland | VTYDDAVRYLLSLGRELASPQQARVAKFDLANISI |
| Ga0137408_10397321 | 3300019789 | Vadose Zone Soil | MNYNTAVRYLLTLGRELAAPTQAAAAKFDLENITILADR |
| Ga0137408_11839692 | 3300019789 | Vadose Zone Soil | MNYDTAVRYLLTLGRELAAPTQAAAAKFDLENITILADRL |
| Ga0210407_105561152 | 3300020579 | Soil | MNYDAAVRYLLSLGRELAAPTQAAAAKFDLENIAV |
| Ga0210399_111425742 | 3300020581 | Soil | MNYEAAVRYLLSLGRELAAPTQAAAAKFDLENITILAER |
| Ga0210401_111251331 | 3300020583 | Soil | MNYDSAVRYLLSLGRELAAPTQAAAAKFDLENISVL |
| Ga0210404_105378481 | 3300021088 | Soil | MNYDSAVRYLLSLGRELAAPTQAAAAKFNLENITILLE |
| Ga0210385_108145162 | 3300021402 | Soil | MDYAAAVTYLLSLGRELAAPTQAAAAKFNLENITV |
| Ga0210397_103042201 | 3300021403 | Soil | MNYDAAVRYLLSLGRELAAPTQAAAAKFDLENISVLAER |
| Ga0210383_109816641 | 3300021407 | Soil | MNYEAAVRYLLSLGRELAAPTQAAAANFDPENITI |
| Ga0210402_113177131 | 3300021478 | Soil | MNYESAVRYLLSLGRELAAPTQAAAAKFNLENITILLER |
| Ga0210410_112177802 | 3300021479 | Soil | MNYDAAVRYLLSLGRELAAPTQAAAAKFDLENITVLS |
| Ga0126371_111275302 | 3300021560 | Tropical Forest Soil | MDYQSAVRYLLSLGRELAAPTQAAAAKFDLENVSVLLE |
| Ga0242661_11042531 | 3300022717 | Soil | MNYQAAVRYLLSLGRELAAPTQAAAAKFDLENITIL |
| Ga0208323_10202203 | 3300025439 | Peatland | MDYAAAVRQLLSLGRELASPTQASAGKFDLENIHALAGRLGRPERAYPI |
| Ga0207663_100323711 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MSYESAVRYLLSLGRELAAPTQASAAKFDLENITVL |
| Ga0207663_111379952 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MNYSESLQYLLSLGRELAAPSHARAMKFDLANIRALS |
| Ga0209838_10405231 | 3300026214 | Soil | MDYASAVNYLLSLGRELAAPTQAAAAKFNLENISVLDERLGHPS |
| Ga0209238_10207015 | 3300026301 | Grasslands Soil | MNYDESLKYLFSLGRELSAPTQAAAAKFDLENISTLAEALGH |
| Ga0209154_11725342 | 3300026317 | Soil | MKYEASVRYLLSLGRELAAPTQAAAAKFDLQNITVLA |
| Ga0257181_10802542 | 3300026499 | Soil | MKYEASVRYLLSLGRELAAPTQAAATKFDLQNITVLA |
| Ga0207779_10108633 | 3300026928 | Tropical Forest Soil | MNYASAVRYLLSLGRELAAPTQAAAAKFNLENIAVLTERL |
| Ga0207506_10214591 | 3300027460 | Soil | MNYEAAVRYLLSLGRELAAPTQAAAAKFDLENILILAERL |
| Ga0207761_10515432 | 3300027516 | Tropical Forest Soil | MNYDEAVRYLLSLGRELAAPTQAAATKFNLENITV |
| Ga0208044_10545102 | 3300027625 | Peatlands Soil | MNYETAVRYLLSLGRELAAPTQASAAKFDLQNITVL |
| Ga0209626_11500652 | 3300027684 | Forest Soil | MNYDAAVRYLLSLGRELAAPTQAAAAKFDLENITVL |
| Ga0209178_14271981 | 3300027725 | Agricultural Soil | MNYESAVRYLLSLGRELAAPTQAAAAKFDLENISILVE |
| Ga0208989_103110052 | 3300027738 | Forest Soil | MNYDSAVRYLLSLGRELAAPTQAAAAKFNLENIAILLD |
| Ga0209448_100603121 | 3300027783 | Bog Forest Soil | MNYEAAVRYLLSLGRELAAPTQAAAAKFDLENITVLTE |
| Ga0209488_105443051 | 3300027903 | Vadose Zone Soil | MNYDTAVRYLLTLGRELAAPTQAAAAKFDLENITILADR |
| Ga0209488_108640771 | 3300027903 | Vadose Zone Soil | MTYDQSVRYLLSLGRELASPQQARATKFDLENIRTLS |
| Ga0302218_100546723 | 3300028863 | Palsa | MTYLEAVRYLLSLGRELGAPTQAAAAKFDLENILALAE |
| Ga0310039_102732801 | 3300030706 | Peatlands Soil | MDYAEAVRYLLTLGRELAAPSHARAAKFDLANIRALASR |
| Ga0073994_100394411 | 3300030991 | Soil | MDYAAAVPYLLSLGRELAAPTQAAAAKFNLENITV |
| Ga0307497_106465771 | 3300031226 | Soil | MNYESAVRYLLTLGRELAAPTQAAAAKFNLENITVLMER |
| Ga0170824_1038494181 | 3300031231 | Forest Soil | MNYDSAARYLLSLGRELAAPTQAAAAKFDLENITV |
| Ga0170824_1269905372 | 3300031231 | Forest Soil | MNFQESVRYLLSLGRELAAPTQASAAKFNLESIAILAKS |
| Ga0302326_124464461 | 3300031525 | Palsa | MLYEDAIRYLLSLGRELASPRQARVQKFDLQNISALA |
| Ga0318516_101059241 | 3300031543 | Soil | MNYDASVRYLLTLGRELAAPTQAAAAKFDLENIAALAE |
| Ga0318528_106354711 | 3300031561 | Soil | MDYATAVRYLLSLGRELAAPTQAAAAKFNLENITILLERLGRP |
| Ga0310915_104666092 | 3300031573 | Soil | MNYASAVRYLLSLGRELAAPTQAAAAKFNLENIAVLT |
| Ga0318555_100403711 | 3300031640 | Soil | MDFEQAVGYLLSLGRELAAPTQAAAAKFNLENIQLLARHLGH |
| Ga0318561_101325271 | 3300031679 | Soil | MNFPQSVDYLLSLGRELARPTQASTAKFDLENISVLAEHLGHPERRYRSVH |
| Ga0318560_100752064 | 3300031682 | Soil | MNYASAVRYLLSLGRELAAPTQAAAAKFNLENIAVLAERL |
| Ga0310686_1067789831 | 3300031708 | Soil | MNYDAAVRYLLSLGRELAAPTQAAAAAKFDLENIT |
| Ga0307475_108003261 | 3300031754 | Hardwood Forest Soil | MNYESAVRYLLTLGRELAAPTQAAAAKFNLENITVLME |
| Ga0318535_101044501 | 3300031764 | Soil | MNYDASVRYLLTLGRELAAPTQATAAKFDLENIAVLAE |
| Ga0318521_104063941 | 3300031770 | Soil | MNYESAVRYLLSLGRELAAPTQAAAAKFNLENITVLM |
| Ga0318497_101665493 | 3300031805 | Soil | MNYDASVRYLLTLGRELAAPTQAAAAKFDLENIAA |
| Ga0307473_108184611 | 3300031820 | Hardwood Forest Soil | MNYDESLKYLFSLGRELSAPTQAAAAKFNLENISALAEALGHPEKQY |
| Ga0318527_101615651 | 3300031859 | Soil | MDFEQAVGYLLSLGRELAAPTQAAAAKFNLENIQLLARHLGHPEN |
| Ga0310916_117251472 | 3300031942 | Soil | MDYPSAVRYLLSLGRELAAPTQATATKFNLENIGVLLERLGRPDRAY |
| Ga0310913_107449752 | 3300031945 | Soil | MNYESALRYLLTLGRELAAPTQAAAAKFNLENITVL |
| Ga0310910_113512371 | 3300031946 | Soil | MDFEQAVGYLLSLGRELAAPTQAAAAKFNLENIQLLARHLG |
| Ga0307479_120787411 | 3300031962 | Hardwood Forest Soil | MNYDAAVRYLLSLGRELAAPTQAAAAKFDLENITVLAE |
| Ga0306922_100452838 | 3300032001 | Soil | MNFPEAVRYLLSLGRELAAPTQASAAKFNLENIAMLA |
| Ga0306922_114917342 | 3300032001 | Soil | MNYDAAVKYLLSLGRELASPTQARAAKFDLENMAV |
| Ga0318545_103052071 | 3300032042 | Soil | MNYESAVRYLLSLGRELGAPTQATAAKFNLENITVLME |
| Ga0318533_102017763 | 3300032059 | Soil | MNFPQSVDYLLSLGRELARPTQASTAKFDLENISVLAEHLGHPERRYRSVHI |
| Ga0318504_106483102 | 3300032063 | Soil | MDYQSAVRYLLSLGRELAAPTQAAAAKFDLEKVSALLERLGRPD |
| Ga0307470_102863311 | 3300032174 | Hardwood Forest Soil | MNFQESVRYLLSLGRELAAPTQAAAAKFNLENSTVL |
| Ga0307470_103087012 | 3300032174 | Hardwood Forest Soil | MNYDESVRYLLSLGRELASPRQASATKFDLFNITILCENL |
| Ga0307471_1000288061 | 3300032180 | Hardwood Forest Soil | MNYDAAVRYLLSLGRELAAPTQASATKFDLENITILAERL |
| Ga0307471_1008249872 | 3300032180 | Hardwood Forest Soil | MNYEAAVRYLLTLGRELAAPTQAAAAKFDLENITILAD |
| Ga0307472_1022120481 | 3300032205 | Hardwood Forest Soil | MNYDGAVRYLLSLGRELAAPTQAAAAKFDLENISVLS |
| Ga0335082_116792311 | 3300032782 | Soil | MDYASAVRYLLSLGRELAAPTQAAAAKFDLENTSVLLER |
| Ga0335079_120185061 | 3300032783 | Soil | MNYQSAVRYLLTLGRELAAPTQAAAAKFNLENITV |
| Ga0318519_108732942 | 3300033290 | Soil | MDYQSAVRYLLSLGRELAAPTQAAAAKFDLEKVSALLE |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |