| Basic Information | |
|---|---|
| Family ID | F083333 |
| Family Type | Metagenome |
| Number of Sequences | 113 |
| Average Sequence Length | 39 residues |
| Representative Sequence | NLALNRKRPGDTVTVTLYRGGKKMDIPVKLGERTGN |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.23 % |
| % of genes from short scaffolds (< 2000 bps) | 92.92 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.345 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (32.743 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.283 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (42.478 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 25.00% Coil/Unstructured: 75.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF04028 | DUF374 | 56.64 |
| PF13180 | PDZ_2 | 2.65 |
| PF00486 | Trans_reg_C | 1.77 |
| PF07978 | NIPSNAP | 1.77 |
| PF13474 | SnoaL_3 | 1.77 |
| PF14534 | DUF4440 | 1.77 |
| PF13470 | PIN_3 | 0.88 |
| PF00582 | Usp | 0.88 |
| PF10861 | DUF2784 | 0.88 |
| PF13561 | adh_short_C2 | 0.88 |
| PF07969 | Amidohydro_3 | 0.88 |
| PF02590 | SPOUT_MTase | 0.88 |
| PF07676 | PD40 | 0.88 |
| PF01791 | DeoC | 0.88 |
| PF13506 | Glyco_transf_21 | 0.88 |
| PF12840 | HTH_20 | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG2121 | Uncharacterized conserved protein, lysophospholipid acyltransferase (LPLAT) superfamily | Function unknown [S] | 56.64 |
| COG1576 | 23S rRNA pseudoU1915 N3-methylase RlmH | Translation, ribosomal structure and biogenesis [J] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.35 % |
| Unclassified | root | N/A | 2.65 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004091|Ga0062387_101025239 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300005177|Ga0066690_10336603 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300005343|Ga0070687_100791167 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300005434|Ga0070709_10063411 | All Organisms → cellular organisms → Bacteria | 2360 | Open in IMG/M |
| 3300005434|Ga0070709_11201541 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300005436|Ga0070713_100511493 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
| 3300005537|Ga0070730_10318528 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300005554|Ga0066661_10323113 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300005586|Ga0066691_10330138 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300005610|Ga0070763_10721959 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300005764|Ga0066903_102873390 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300005844|Ga0068862_101130596 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300006163|Ga0070715_10083453 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1455 | Open in IMG/M |
| 3300006174|Ga0075014_100388126 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300006903|Ga0075426_10989277 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300007258|Ga0099793_10323892 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 751 | Open in IMG/M |
| 3300009038|Ga0099829_10707821 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300009038|Ga0099829_11229729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
| 3300009038|Ga0099829_11528417 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300009088|Ga0099830_10226783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1471 | Open in IMG/M |
| 3300009088|Ga0099830_10295447 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1292 | Open in IMG/M |
| 3300009088|Ga0099830_10499970 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300009090|Ga0099827_11655893 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
| 3300009137|Ga0066709_100746423 | All Organisms → cellular organisms → Bacteria | 1412 | Open in IMG/M |
| 3300009631|Ga0116115_1085749 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 813 | Open in IMG/M |
| 3300009698|Ga0116216_10113506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1668 | Open in IMG/M |
| 3300010046|Ga0126384_10815987 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 836 | Open in IMG/M |
| 3300010048|Ga0126373_12429612 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300010339|Ga0074046_10591785 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
| 3300010361|Ga0126378_10649609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 1168 | Open in IMG/M |
| 3300010403|Ga0134123_10981273 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 859 | Open in IMG/M |
| 3300011269|Ga0137392_10160763 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1819 | Open in IMG/M |
| 3300011270|Ga0137391_10929396 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
| 3300011270|Ga0137391_11236880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
| 3300011271|Ga0137393_11406914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300012096|Ga0137389_10988970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 721 | Open in IMG/M |
| 3300012096|Ga0137389_11240695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
| 3300012189|Ga0137388_10603515 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1020 | Open in IMG/M |
| 3300012189|Ga0137388_11268141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 675 | Open in IMG/M |
| 3300012202|Ga0137363_10916679 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 744 | Open in IMG/M |
| 3300012205|Ga0137362_10180298 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1815 | Open in IMG/M |
| 3300012205|Ga0137362_11757291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae | 507 | Open in IMG/M |
| 3300012206|Ga0137380_10278809 | All Organisms → cellular organisms → Bacteria | 1501 | Open in IMG/M |
| 3300012356|Ga0137371_11028197 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
| 3300012361|Ga0137360_10801222 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 811 | Open in IMG/M |
| 3300012361|Ga0137360_10856169 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 783 | Open in IMG/M |
| 3300012362|Ga0137361_10060722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3161 | Open in IMG/M |
| 3300012363|Ga0137390_10192934 | All Organisms → cellular organisms → Bacteria | 2023 | Open in IMG/M |
| 3300012683|Ga0137398_10671823 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 719 | Open in IMG/M |
| 3300012685|Ga0137397_10740713 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 729 | Open in IMG/M |
| 3300012922|Ga0137394_10483889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1052 | Open in IMG/M |
| 3300012924|Ga0137413_11716219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300012925|Ga0137419_10176204 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1565 | Open in IMG/M |
| 3300012929|Ga0137404_11102075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 728 | Open in IMG/M |
| 3300012930|Ga0137407_12039799 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
| 3300012944|Ga0137410_10425845 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1074 | Open in IMG/M |
| 3300012949|Ga0153798_10120216 | Not Available | 1135 | Open in IMG/M |
| 3300012971|Ga0126369_12564544 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300013306|Ga0163162_10469930 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1389 | Open in IMG/M |
| 3300015241|Ga0137418_10495735 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 978 | Open in IMG/M |
| 3300015358|Ga0134089_10352791 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
| 3300016270|Ga0182036_10159608 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1615 | Open in IMG/M |
| 3300017928|Ga0187806_1173223 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
| 3300017955|Ga0187817_10066466 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2238 | Open in IMG/M |
| 3300017955|Ga0187817_10312148 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1003 | Open in IMG/M |
| 3300017999|Ga0187767_10016796 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1530 | Open in IMG/M |
| 3300018007|Ga0187805_10055802 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1774 | Open in IMG/M |
| 3300018007|Ga0187805_10142203 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1090 | Open in IMG/M |
| 3300018090|Ga0187770_11270424 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300019360|Ga0187894_10250109 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 840 | Open in IMG/M |
| 3300021180|Ga0210396_10383551 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1236 | Open in IMG/M |
| 3300021559|Ga0210409_11609267 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300024288|Ga0179589_10369384 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
| 3300024290|Ga0247667_1027368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1091 | Open in IMG/M |
| 3300025439|Ga0208323_1066378 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
| 3300025906|Ga0207699_10077593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2050 | Open in IMG/M |
| 3300025906|Ga0207699_10541709 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 843 | Open in IMG/M |
| 3300025938|Ga0207704_11748839 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300026298|Ga0209236_1201504 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300027738|Ga0208989_10177324 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 710 | Open in IMG/M |
| 3300027825|Ga0209039_10151144 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 966 | Open in IMG/M |
| 3300027825|Ga0209039_10397822 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300027846|Ga0209180_10461186 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
| 3300027862|Ga0209701_10689610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300027895|Ga0209624_10071614 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2237 | Open in IMG/M |
| 3300028047|Ga0209526_10171308 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1514 | Open in IMG/M |
| 3300028146|Ga0247682_1025678 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
| 3300031057|Ga0170834_110590394 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1367 | Open in IMG/M |
| 3300031231|Ga0170824_107073390 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
| 3300031231|Ga0170824_118921339 | Not Available | 863 | Open in IMG/M |
| 3300031546|Ga0318538_10282191 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 894 | Open in IMG/M |
| 3300031668|Ga0318542_10417275 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
| 3300031681|Ga0318572_10075033 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1870 | Open in IMG/M |
| 3300031715|Ga0307476_10568851 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300031740|Ga0307468_100634728 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 879 | Open in IMG/M |
| 3300031747|Ga0318502_10539616 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
| 3300031754|Ga0307475_10556309 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 920 | Open in IMG/M |
| 3300031770|Ga0318521_10939799 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300031799|Ga0318565_10626860 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300031833|Ga0310917_10400950 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 932 | Open in IMG/M |
| 3300031890|Ga0306925_12135630 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300031945|Ga0310913_10868216 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| 3300032180|Ga0307471_100495706 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1368 | Open in IMG/M |
| 3300032180|Ga0307471_102552140 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
| 3300032180|Ga0307471_103842609 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300032180|Ga0307471_104137473 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300032205|Ga0307472_100985910 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 788 | Open in IMG/M |
| 3300032261|Ga0306920_103779249 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300032829|Ga0335070_10271887 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1652 | Open in IMG/M |
| 3300032954|Ga0335083_11093016 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300033982|Ga0371487_0029023 | All Organisms → cellular organisms → Bacteria | 3570 | Open in IMG/M |
| 3300033983|Ga0371488_0478325 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 32.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.62% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.08% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.31% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.42% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.54% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.65% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.65% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.65% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.77% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.77% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.77% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.77% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.89% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.89% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.89% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.89% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.89% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.89% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.89% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.89% |
| Switchgrass Degrading | Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009631 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012949 | Switchgrass enrichment cultures co-assembly | Engineered | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300025439 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028146 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23 | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033982 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fraction | Environmental | Open in IMG/M |
| 3300033983 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062387_1010252392 | 3300004091 | Bog Forest Soil | ANQFDVNILLNHKRPGDKVTVAVYRGGKKVDLPITLSERPGSS* |
| Ga0066690_103366033 | 3300005177 | Soil | FDVNLVLNHHRPGDAVNVTIYRGGKKMDIPVKLGERDGN* |
| Ga0070687_1007911672 | 3300005343 | Switchgrass Rhizosphere | IDLNIALNRKRPGDTMTLTVYRGGKRMDIPVKLAERPVK* |
| Ga0070709_100634111 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | LDVNLALNKKRPGDVVDVTLFRGGKKMEVQVTLVERPGNS* |
| Ga0070709_112015411 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VILNRKRPGDSVTVTVYRAGKKLDIPVKLGERTENQRQQ* |
| Ga0070713_1005114932 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LDVNLALNKKRPGDTVDVTLFRGGKKMDLQIKLAERPGNN* |
| Ga0070730_103185281 | 3300005537 | Surface Soil | VILNRKRPGDSVTVTVYRAGKKIDIPVKLGERTENQRQQ* |
| Ga0066661_103231131 | 3300005554 | Soil | SELDVNLVLNKKRPGESITVTAYRGGKKIEIPVKLGERPNA* |
| Ga0066691_103301381 | 3300005586 | Soil | ILNHHRPGDKVTVTLYRGGKKMDVPVTLGERTGN* |
| Ga0070763_107219592 | 3300005610 | Soil | NLALNRKRPGDTVTVTLYRGGKKMDIPVKLGERTGN* |
| Ga0066903_1028733901 | 3300005764 | Tropical Forest Soil | VAGQFDVNVILNRKRPGDTVTVSLYRGGKKIDIPVKLGERSGS* |
| Ga0068862_1011305961 | 3300005844 | Switchgrass Rhizosphere | LNKKRPGEEVTVTLFRGGKKMDVKAKLSERPQSD* |
| Ga0070715_100834533 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | LVLNKKRPGDSIEVTAYRGGKKIEIPVKLGERPGA* |
| Ga0075014_1003881262 | 3300006174 | Watersheds | DVNVILNRKRPGDTVTITLYRGAKKLDIPVKLGERSGN* |
| Ga0075426_109892772 | 3300006903 | Populus Rhizosphere | GQKVSSELDVNLVLNKKRPGDSIEVTAYRGGKKIEIPVKLGERPGA* |
| Ga0099793_103238922 | 3300007258 | Vadose Zone Soil | LLNRKRPGDTVTVSVYRGAKKVDVPVKLGERDGN* |
| Ga0099829_107078211 | 3300009038 | Vadose Zone Soil | QKTSSQLDLSLVLNHKRPGNTVAVTFYRGGRKMDAQVTLGERSE* |
| Ga0099829_112297291 | 3300009038 | Vadose Zone Soil | LNKKRPGDTITVTVYRGRQKMDVRVTLAERSARS* |
| Ga0099829_115284171 | 3300009038 | Vadose Zone Soil | QTVSSPLYLNLALNKKRPGDAVPVTLFRGGKKMDLQIKLAERPGNN* |
| Ga0099830_102267833 | 3300009088 | Vadose Zone Soil | ILNRKRPGDTVNVTVYRGGKKMDIPVKLGERTGN* |
| Ga0099830_102954473 | 3300009088 | Vadose Zone Soil | VILNRKRPGDSVNVSLYRGGKKMDIPVKLGERPGN* |
| Ga0099830_104999703 | 3300009088 | Vadose Zone Soil | LNILLNRKRPGDAITLTIYRGGKKMKLPVKLGERPSS* |
| Ga0099827_116558931 | 3300009090 | Vadose Zone Soil | SQLDVNLALNHKRPGDNITVTLYRGGKKMDVPVKLGERTGN* |
| Ga0066709_1007464231 | 3300009137 | Grasslands Soil | NRVDVDLMLNKKRPGDEVTITLFRGGKKMDVKVKLGERQQSN* |
| Ga0116115_10857492 | 3300009631 | Peatland | LDVNMLLNRKRPGDSIKLTIYRGGRRMELKATLGERAGKS* |
| Ga0116216_101135061 | 3300009698 | Peatlands Soil | VNVVLNRKRPGDTVKVSLYRGGKKMDIPVKLGESTGN* |
| Ga0126384_108159872 | 3300010046 | Tropical Forest Soil | DVNLILNKKRPGDEVTVTLYRGGKKMDVKAKLSERPQSD* |
| Ga0126373_124296122 | 3300010048 | Tropical Forest Soil | VVLNRKRPGDTVTVTLYRGAKKLDIPVKLGEREGN* |
| Ga0074046_105917851 | 3300010339 | Bog Forest Soil | ILNRKRPGDSVTVTLYRGAKKMDVPVKLGEHDGN* |
| Ga0126378_106496091 | 3300010361 | Tropical Forest Soil | DVNLVLNHHRPGDTVHVSLYRGGKKMDLPVKLGENPGN* |
| Ga0136847_124935055 | 3300010391 | Freshwater Sediment | MNRLLNRKRPGERVRLTIYRGRQKTDVEVTLGER* |
| Ga0134123_109812731 | 3300010403 | Terrestrial Soil | LNIALNRKRPGDTMTLTVYRGGKRMDIPVKLAERPVK* |
| Ga0137392_101607631 | 3300011269 | Vadose Zone Soil | QKVASPFDLNILLNRKRPGDAITLNVYRGGKKMELPVKLGERPSS* |
| Ga0137391_109293961 | 3300011270 | Vadose Zone Soil | SPFDMNVILNRKRPGDTVKVSIYRGGKKMDIPVKLGERTGN* |
| Ga0137391_112368801 | 3300011270 | Vadose Zone Soil | ASQLDVNLALNHKRPGDNITVTLYRGGKKMDLPVKLGERTSN* |
| Ga0137393_114069141 | 3300011271 | Vadose Zone Soil | VNVLLNRKRPGDTVKVTLYRGGKKMDIPVKLGERTGN* |
| Ga0137389_109889701 | 3300012096 | Vadose Zone Soil | VNVMLNRKRPGDTVTVTIYRGGKKMDIPVKLGERTGN* |
| Ga0137389_112406953 | 3300012096 | Vadose Zone Soil | DQKIGSPFDMNVILNRKRPGDTVKVSIYRGGKKMDIPVKLGERTGN* |
| Ga0137388_106035152 | 3300012189 | Vadose Zone Soil | QLDVNLALNHKRPGDNITVTLYRGGKKMDLPVKLGERTGN* |
| Ga0137388_112681411 | 3300012189 | Vadose Zone Soil | VNVVLNRKRPGDTVNVTVYRGGKKMDIPVKLGERTGN* |
| Ga0137363_109166792 | 3300012202 | Vadose Zone Soil | MNVILNRKRPGDMVKVSIYRGGKRMDIPVKLGERTGN* |
| Ga0137362_101802983 | 3300012205 | Vadose Zone Soil | PFDLNILLNRKRPGETVTLTIYRGAKKMDLPVKLAERPGA* |
| Ga0137362_117572912 | 3300012205 | Vadose Zone Soil | VNLALNKKRPGDTVDVALFRGGKKMNLQVKLAERPGNN* |
| Ga0137380_102788094 | 3300012206 | Vadose Zone Soil | GSPFDMNVILNRKRPGDTVKVSIYRGGKKMDIPVKLGERTGN* |
| Ga0137371_110281973 | 3300012356 | Vadose Zone Soil | FDMNVILNRKRPGDTVKVSIYRGGKKMDIPVKLGERTGN* |
| Ga0137360_108012222 | 3300012361 | Vadose Zone Soil | QLDINLVLNRKRPGDTVNVSLFRGGKKMDVPVKLGERPGND* |
| Ga0137360_108561691 | 3300012361 | Vadose Zone Soil | NVLLNRKRPGDTVTVSVYRGAKKVEVPVKLGERDGN* |
| Ga0137361_100607224 | 3300012362 | Vadose Zone Soil | VLNRKRPGDTITVTVYRGGKKMDIPVKLRERPGN* |
| Ga0137390_101929341 | 3300012363 | Vadose Zone Soil | PFDLNILLNRKRPGDAITLTIYRGGKKMELPVKLGERPSS* |
| Ga0137398_106718232 | 3300012683 | Vadose Zone Soil | VLNHKRPGDNVTVTVYRGGKKMDIPVKLGERTGN* |
| Ga0137397_107407133 | 3300012685 | Vadose Zone Soil | VNVVLNRKRPGDTVNVSVYRGGKKMDIPVKLGERTSN* |
| Ga0137394_104838891 | 3300012922 | Vadose Zone Soil | TGQLDVNVVLNRKRPGDTVNVSVYRGGKKIDIPVKLGERTGS* |
| Ga0137413_117162192 | 3300012924 | Vadose Zone Soil | LNIILNRKRPGDSVTLTVYRGGKKLDIPVKLGERNENTR* |
| Ga0137419_101762043 | 3300012925 | Vadose Zone Soil | VLNHKRPGDTVNVTLYRGGKKMDIPVKLGERTGN* |
| Ga0137404_111020751 | 3300012929 | Vadose Zone Soil | VNLALNHKRPGDNITVTVYRGGKKMDIPVKLGERTAK* |
| Ga0137407_120397992 | 3300012930 | Vadose Zone Soil | NVVLNRKRPGDTVNVSVYRGGKKIDIPVKLGERSGN* |
| Ga0137410_104258452 | 3300012944 | Vadose Zone Soil | DVNLVLNRKRPGDTVSVSLFRGGKKMDVPVKLGERPGNN* |
| Ga0153798_101202161 | 3300012949 | Switchgrass Degrading | VIFNNHKPGDKVTVTVDRDGKKLDIPVVLGEMPRE* |
| Ga0126369_125645441 | 3300012971 | Tropical Forest Soil | RILNHRRPGDTVNVTVYRGGQKTDIAVKRGELDRN* |
| Ga0163162_104699301 | 3300013306 | Switchgrass Rhizosphere | KMSSPIDLNIALNRKRPGDTMTLTVYRGGKRMDIPVKLAERPVK* |
| Ga0137418_104957353 | 3300015241 | Vadose Zone Soil | DVNVVLNRKRPGDTVNVSVYRGGKKMDIPVKLGERTGN* |
| Ga0134089_103527911 | 3300015358 | Grasslands Soil | KIASPFDMNVILNRKRPGDTVKVSIYRGGKKMDIPVKLGERTGN* |
| Ga0182036_101596083 | 3300016270 | Soil | ANQFDMNLLLNRKRPGDSVTITVYRGAKKMEIPVKLGERDGN |
| Ga0187806_11732231 | 3300017928 | Freshwater Sediment | QFDINVILNRKRPGDTVTITLYRGAKKLDIPVKLGERDGN |
| Ga0187817_100664661 | 3300017955 | Freshwater Sediment | DINVILNRKRPGDTVTLTIYRGAKKLDITVKLGEHDGN |
| Ga0187817_103121481 | 3300017955 | Freshwater Sediment | MNVILNHKRPGDSVNVTLYRGGKKMDIAVKLGERSGNG |
| Ga0187767_100167961 | 3300017999 | Tropical Peatland | EFDMNVLLNRKRPGDTVNITLYRGAKKLDIPVKLGEHDGN |
| Ga0187805_100558021 | 3300018007 | Freshwater Sediment | KVANQFDINVVLNRKRPGDTVTVTLYRGAKKVDIPVKLGERDGN |
| Ga0187805_101422032 | 3300018007 | Freshwater Sediment | LDMNVILNHKRPGESVNVTLYRGGKKMDIAVKLGERSGNS |
| Ga0187770_112704242 | 3300018090 | Tropical Peatland | LDLGVLLNRHRPGDAVTLTIYRGSQKMELRATLGER |
| Ga0187894_102501091 | 3300019360 | Microbial Mat On Rocks | DMNVVLNRKRPGDTIKVTIYRGGSKMNINVTLSELSGIT |
| Ga0210396_103835511 | 3300021180 | Soil | NVLLNRKRPGDSVTVSVYRGAKKVDIPVKLGERDGN |
| Ga0210409_116092672 | 3300021559 | Soil | NPMDLDIILNRKRPGDTVTLSVYRGAKKTDIPVKLGERTGN |
| Ga0179589_103693842 | 3300024288 | Vadose Zone Soil | DMNVLLNRKRPGDSVTVTVYRGAKKVDVPVKLGERDGN |
| Ga0247667_10273681 | 3300024290 | Soil | DVKLVLNKKRPGESITVTAYRGGKKIEIPVKLGEREK |
| Ga0208323_10663781 | 3300025439 | Peatland | LDVNMLLNRKRPGDSIKLTIYRGGRRMELKATLGERAGKS |
| Ga0207699_100775933 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | DVNLALNKKRPGDVVDVTLFRGGKKMEVQVTLVERPGNS |
| Ga0207699_105417092 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | IALNRKRPGDIMTLTVYRGGKKMDVPVKLAERPGK |
| Ga0207704_117488391 | 3300025938 | Miscanthus Rhizosphere | NIALNRKRPGDTMTLTVYRGGKRMDIPVKLAERPVK |
| Ga0209236_12015042 | 3300026298 | Grasslands Soil | QKTASQLDLSLVLNHKRPGNTVAVTFYRGGRKMDAQVTLGERGE |
| Ga0208989_101773241 | 3300027738 | Forest Soil | LDVNLVLNHKRPGDSVTVTVYRGGKKMDIPVKLGERTGN |
| Ga0209039_101511442 | 3300027825 | Bog Forest Soil | DIDVNLILNRKRPGDSVTITLYRGAKKMDVPVKLGEHDGN |
| Ga0209039_103978221 | 3300027825 | Bog Forest Soil | VLLNRKRPGDTVTLTVYRGAKKVDVPVKLGEHDGN |
| Ga0209180_104611861 | 3300027846 | Vadose Zone Soil | VMLNRKRPGDTVTVSVYRGGKKMDIPVKLGERTGN |
| Ga0209701_106896102 | 3300027862 | Vadose Zone Soil | SPFDLNLILNHHRPGDKVTVTLYRDGKKMDVPLALGERTN |
| Ga0209624_100716141 | 3300027895 | Forest Soil | VVLNHKRPGDTVTVTLYRAGKKLDIPVKLGERTDNQRQQ |
| Ga0209526_101713081 | 3300028047 | Forest Soil | MDLNIALNRKRPGDTMTLTVYRSGKKMDVPVKLAERTGK |
| Ga0247682_10256783 | 3300028146 | Soil | LDVNLVLNKKRPGDSIEVTVYRGGKKIEIPVKLGERPGA |
| Ga0170834_1105903941 | 3300031057 | Forest Soil | VLLNRKRPGDSVTVTVYRGAKKVDVPVKLGERDGN |
| Ga0170824_1070733902 | 3300031231 | Forest Soil | PLDVNLALNKKRPGDTVDVTIFRGGKKMDLQIKLAERPGNS |
| Ga0170824_1189213392 | 3300031231 | Forest Soil | KIMNRKRPGDVVPVTLYRGGKKMDLQVKLAERTQK |
| Ga0318538_102821911 | 3300031546 | Soil | NVILNRKRPGDTVTVTLYRGAKKMDIPVKLGEREGN |
| Ga0318542_104172752 | 3300031668 | Soil | QKVANQFDMNVILNRKRPGDTVTVTLYRGAKKMDIPVKLGEREGN |
| Ga0318572_100750333 | 3300031681 | Soil | QFDMNVILNRKRPGDSVTVTVYRGAKKMDIAVKLGEREGN |
| Ga0307476_105688512 | 3300031715 | Hardwood Forest Soil | DLNVILNHKKPGETVRVTVFRGGKKMDFNVTLGEAAQSVSR |
| Ga0307468_1006347282 | 3300031740 | Hardwood Forest Soil | DVNLVLNKKRPGDEVTVSLYRGGKKMDVKVKLSERPENN |
| Ga0318502_105396162 | 3300031747 | Soil | NVVLNRKRPGDTVTVTLYRGAKKLDIPVKLGEREGN |
| Ga0307475_105563091 | 3300031754 | Hardwood Forest Soil | NLVLNKKRPGDEVKVSLFRGGKKMDVEVKLGERPGS |
| Ga0318521_109397992 | 3300031770 | Soil | INVVLNRKRPGDTVTVTLYRGAKKLDIPVKLGEREGN |
| Ga0318565_106268601 | 3300031799 | Soil | NLVLNKKRPGEEVTVSLYRGGKAMEVKVKLGERKEN |
| Ga0310917_104009501 | 3300031833 | Soil | NQFDMNLLLNRKRPGDSVTITVYRGAKKMEIPVKLGERDGN |
| Ga0306925_121356302 | 3300031890 | Soil | DLNLVLNKKRPGDEVTVSLFRGGKAMEVKVKLGERKEI |
| Ga0310913_108682162 | 3300031945 | Soil | ANQFDMNVILNRKRPGDTVTVTLYRGAKKMDIPVKLGEREGN |
| Ga0307471_1004957063 | 3300032180 | Hardwood Forest Soil | VLLNRKRPGDTVTVSVYRGAKKVDVPVKLGERDGN |
| Ga0307471_1025521401 | 3300032180 | Hardwood Forest Soil | DVNLALNHKRPGDTVTVALYRGGKKMDISVKLGERTGN |
| Ga0307471_1038426091 | 3300032180 | Hardwood Forest Soil | MNVLLNRKRPGDTVAITVYRGAKKVDILVKLGERDGN |
| Ga0307471_1041374732 | 3300032180 | Hardwood Forest Soil | QKVSNQFDLNVILNRKRPADMVSVTVYRGGKKMDVPVKLGERTGN |
| Ga0307472_1009859101 | 3300032205 | Hardwood Forest Soil | TSPLDFNLALKKKRPGDTVNVTLFRGGKKMDLQIKLAERPGNS |
| Ga0306920_1037792492 | 3300032261 | Soil | TQFDVNLVLNKKRPGDSVTVTVFRGGKKLDLPVKLGERPRG |
| Ga0335070_102718871 | 3300032829 | Soil | QFDVNVILNRKRPGDTVTVTIYRGAKKLDVPVKLGERDGN |
| Ga0335083_110930161 | 3300032954 | Soil | NTMDLSVVLNRKRPGDTVTVTLYRSGKKMDIPVKLGERTENQRQQ |
| Ga0371487_0029023_3442_3570 | 3300033982 | Peat Soil | SNEIDINLILNRKRPGDNLTVTLYRGAKKMDVTVKLGEHDGN |
| Ga0371488_0478325_445_564 | 3300033983 | Peat Soil | FDVNVILNRKRPGETVTVTIYRGSKKLDIPVKLGEHDGN |
| ⦗Top⦘ |