| Basic Information | |
|---|---|
| Family ID | F083324 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 50 residues |
| Representative Sequence | VPLDVVIGRALAWCVHPSASWRRLPASGRVLLVAAYVSASYVTVLTLLFIV |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 41.96 % |
| % of genes near scaffold ends (potentially truncated) | 41.59 % |
| % of genes from short scaffolds (< 2000 bps) | 84.96 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (75.221 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (10.620 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.319 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.478 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.96% β-sheet: 0.00% Coil/Unstructured: 43.04% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF04679 | DNA_ligase_A_C | 10.62 |
| PF13088 | BNR_2 | 2.65 |
| PF08241 | Methyltransf_11 | 2.65 |
| PF00072 | Response_reg | 1.77 |
| PF00756 | Esterase | 1.77 |
| PF00069 | Pkinase | 1.77 |
| PF02687 | FtsX | 1.77 |
| PF06439 | 3keto-disac_hyd | 1.77 |
| PF10041 | DUF2277 | 1.77 |
| PF09361 | Phasin_2 | 0.88 |
| PF00226 | DnaJ | 0.88 |
| PF00313 | CSD | 0.88 |
| PF03965 | Penicillinase_R | 0.88 |
| PF02811 | PHP | 0.88 |
| PF05638 | T6SS_HCP | 0.88 |
| PF07676 | PD40 | 0.88 |
| PF12704 | MacB_PCD | 0.88 |
| PF16861 | Carbam_trans_C | 0.88 |
| PF04519 | Bactofilin | 0.88 |
| PF00857 | Isochorismatase | 0.88 |
| PF13517 | FG-GAP_3 | 0.88 |
| PF01850 | PIN | 0.88 |
| PF08388 | GIIM | 0.88 |
| PF13360 | PQQ_2 | 0.88 |
| PF13565 | HTH_32 | 0.88 |
| PF16576 | HlyD_D23 | 0.88 |
| PF01636 | APH | 0.88 |
| PF13263 | PHP_C | 0.88 |
| PF13637 | Ank_4 | 0.88 |
| PF13432 | TPR_16 | 0.88 |
| PF13564 | DoxX_2 | 0.88 |
| PF00989 | PAS | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 10.62 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 7.08 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.88 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.88 |
| COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 0.88 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.88 |
| COG3157 | Type VI protein secretion system component Hcp (secreted cytotoxin) | Intracellular trafficking, secretion, and vesicular transport [U] | 0.88 |
| COG3682 | Transcriptional regulator, CopY/TcrY family | Transcription [K] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 76.11 % |
| Unclassified | root | N/A | 23.89 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908008|FWIREl_GJ4R3DH01BLX1H | Not Available | 504 | Open in IMG/M |
| 3300002568|C688J35102_120012610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 846 | Open in IMG/M |
| 3300004114|Ga0062593_100025356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Caulobacter | 3250 | Open in IMG/M |
| 3300004156|Ga0062589_100018845 | All Organisms → cellular organisms → Bacteria | 3192 | Open in IMG/M |
| 3300004156|Ga0062589_100924645 | Not Available | 806 | Open in IMG/M |
| 3300004157|Ga0062590_100913018 | Not Available | 824 | Open in IMG/M |
| 3300004643|Ga0062591_102754809 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300005172|Ga0066683_10004472 | All Organisms → cellular organisms → Bacteria | 6600 | Open in IMG/M |
| 3300005175|Ga0066673_10429353 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300005293|Ga0065715_10121885 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2213 | Open in IMG/M |
| 3300005295|Ga0065707_10445502 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 806 | Open in IMG/M |
| 3300005295|Ga0065707_10744365 | Not Available | 621 | Open in IMG/M |
| 3300005345|Ga0070692_10897199 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
| 3300005468|Ga0070707_100432419 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1277 | Open in IMG/M |
| 3300005468|Ga0070707_101734603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300005549|Ga0070704_101764797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300005557|Ga0066704_10635880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
| 3300005569|Ga0066705_10518406 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 744 | Open in IMG/M |
| 3300005576|Ga0066708_10362564 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300005617|Ga0068859_100461336 | Not Available | 1366 | Open in IMG/M |
| 3300005713|Ga0066905_100092404 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2027 | Open in IMG/M |
| 3300005764|Ga0066903_100210912 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2925 | Open in IMG/M |
| 3300005764|Ga0066903_100745691 | All Organisms → cellular organisms → Bacteria | 1738 | Open in IMG/M |
| 3300006031|Ga0066651_10196312 | Not Available | 1067 | Open in IMG/M |
| 3300006046|Ga0066652_100086535 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2488 | Open in IMG/M |
| 3300006237|Ga0097621_101243336 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300006847|Ga0075431_100969125 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 818 | Open in IMG/M |
| 3300006852|Ga0075433_10722456 | Not Available | 872 | Open in IMG/M |
| 3300006894|Ga0079215_10487464 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300006903|Ga0075426_10022001 | All Organisms → cellular organisms → Bacteria | 4558 | Open in IMG/M |
| 3300006918|Ga0079216_11312326 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300007004|Ga0079218_11839403 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300007265|Ga0099794_10704397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300009012|Ga0066710_100003494 | All Organisms → cellular organisms → Bacteria | 13431 | Open in IMG/M |
| 3300009012|Ga0066710_102711422 | Not Available | 706 | Open in IMG/M |
| 3300009029|Ga0066793_10677980 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium RIFCSPLOWO2_12_FULL_71_22 | 586 | Open in IMG/M |
| 3300009038|Ga0099829_10683870 | Not Available | 853 | Open in IMG/M |
| 3300009088|Ga0099830_10295300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium → Sinorhizobium medicae | 1292 | Open in IMG/M |
| 3300009088|Ga0099830_10543350 | Not Available | 950 | Open in IMG/M |
| 3300009090|Ga0099827_10085427 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2475 | Open in IMG/M |
| 3300009094|Ga0111539_10045391 | All Organisms → cellular organisms → Bacteria | 5260 | Open in IMG/M |
| 3300009094|Ga0111539_12506515 | Not Available | 598 | Open in IMG/M |
| 3300009094|Ga0111539_12862138 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
| 3300009137|Ga0066709_100954281 | All Organisms → cellular organisms → Bacteria | 1253 | Open in IMG/M |
| 3300009153|Ga0105094_10051085 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2292 | Open in IMG/M |
| 3300009153|Ga0105094_10947608 | Not Available | 509 | Open in IMG/M |
| 3300009610|Ga0105340_1470357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
| 3300010046|Ga0126384_10840475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 825 | Open in IMG/M |
| 3300010047|Ga0126382_10839165 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300010166|Ga0126306_11693124 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300010301|Ga0134070_10343081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300010329|Ga0134111_10057519 | All Organisms → cellular organisms → Bacteria | 1425 | Open in IMG/M |
| 3300010358|Ga0126370_12332009 | Not Available | 530 | Open in IMG/M |
| 3300010399|Ga0134127_11157953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 839 | Open in IMG/M |
| 3300011120|Ga0150983_15254330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 846 | Open in IMG/M |
| 3300011270|Ga0137391_11434940 | Not Available | 536 | Open in IMG/M |
| 3300011445|Ga0137427_10146520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 969 | Open in IMG/M |
| 3300012202|Ga0137363_10426995 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1107 | Open in IMG/M |
| 3300012203|Ga0137399_11134027 | Not Available | 658 | Open in IMG/M |
| 3300012212|Ga0150985_109741818 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300012363|Ga0137390_10845859 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300012396|Ga0134057_1341906 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300012901|Ga0157288_10425958 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300012917|Ga0137395_10991494 | Not Available | 602 | Open in IMG/M |
| 3300012989|Ga0164305_10984577 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 715 | Open in IMG/M |
| 3300014154|Ga0134075_10135210 | Not Available | 1051 | Open in IMG/M |
| 3300014302|Ga0075310_1131128 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300015201|Ga0173478_10225530 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 803 | Open in IMG/M |
| 3300015371|Ga0132258_10596761 | All Organisms → cellular organisms → Bacteria | 2772 | Open in IMG/M |
| 3300015371|Ga0132258_11566843 | All Organisms → cellular organisms → Bacteria | 1663 | Open in IMG/M |
| 3300015374|Ga0132255_101791716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 932 | Open in IMG/M |
| 3300015374|Ga0132255_103347295 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 683 | Open in IMG/M |
| 3300018063|Ga0184637_10211834 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1187 | Open in IMG/M |
| 3300018429|Ga0190272_13229489 | Not Available | 508 | Open in IMG/M |
| 3300018433|Ga0066667_10439824 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1063 | Open in IMG/M |
| 3300018482|Ga0066669_10535616 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_64_6 | 1018 | Open in IMG/M |
| 3300018482|Ga0066669_11877838 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300019362|Ga0173479_10067261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1231 | Open in IMG/M |
| 3300019377|Ga0190264_11691469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
| 3300019870|Ga0193746_1029875 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
| 3300021344|Ga0193719_10034785 | All Organisms → cellular organisms → Bacteria | 2177 | Open in IMG/M |
| 3300021432|Ga0210384_10218033 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1717 | Open in IMG/M |
| 3300023072|Ga0247799_1079454 | Not Available | 573 | Open in IMG/M |
| 3300024055|Ga0247794_10132907 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 766 | Open in IMG/M |
| 3300025321|Ga0207656_10464306 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300025910|Ga0207684_11726089 | Not Available | 504 | Open in IMG/M |
| 3300025911|Ga0207654_10097795 | All Organisms → cellular organisms → Bacteria | 1803 | Open in IMG/M |
| 3300025922|Ga0207646_10558412 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1029 | Open in IMG/M |
| 3300025924|Ga0207694_10653780 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300025927|Ga0207687_11656347 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300025934|Ga0207686_10325189 | Not Available | 1150 | Open in IMG/M |
| 3300025942|Ga0207689_11628860 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300025986|Ga0207658_10168044 | All Organisms → cellular organisms → Bacteria | 1804 | Open in IMG/M |
| 3300025986|Ga0207658_10353604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Caulobacter | 1280 | Open in IMG/M |
| 3300026067|Ga0207678_10094236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Caulobacter | 2558 | Open in IMG/M |
| 3300026537|Ga0209157_1139034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1105 | Open in IMG/M |
| 3300026550|Ga0209474_10001483 | All Organisms → cellular organisms → Bacteria | 22795 | Open in IMG/M |
| 3300027846|Ga0209180_10316455 | Not Available | 893 | Open in IMG/M |
| 3300027862|Ga0209701_10153843 | Not Available | 1402 | Open in IMG/M |
| 3300027876|Ga0209974_10444971 | All Organisms → cellular organisms → Eukaryota → Sar | 513 | Open in IMG/M |
| 3300028884|Ga0307308_10463245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
| 3300028906|Ga0308309_10967048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis | 738 | Open in IMG/M |
| 3300031231|Ga0170824_107461424 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300031421|Ga0308194_10160408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 701 | Open in IMG/M |
| 3300031720|Ga0307469_12259030 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300031824|Ga0307413_11054126 | Not Available | 700 | Open in IMG/M |
| 3300031940|Ga0310901_10583273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300033811|Ga0364924_044986 | Not Available | 932 | Open in IMG/M |
| 3300034125|Ga0370484_0103135 | Not Available | 745 | Open in IMG/M |
| 3300034147|Ga0364925_0171728 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 792 | Open in IMG/M |
| 3300034151|Ga0364935_0042226 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
| 3300034817|Ga0373948_0055558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 859 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.08% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.19% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.31% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.42% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.54% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.54% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.65% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.65% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.65% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 2.65% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.77% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.77% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.77% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.77% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.77% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.89% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.89% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.89% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.89% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.89% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.89% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.89% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908008 | Soil microbial communities from sample at FACE Site Metagenome WIR_Elev2 | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009153 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011445 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012396 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014302 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D2 | Environmental | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019870 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m1 | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300023072 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S151-409C-6 | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
| 3300033811 | Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17 | Environmental | Open in IMG/M |
| 3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
| 3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
| 3300034151 | Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17 | Environmental | Open in IMG/M |
| 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FWIREl_06520620 | 2124908008 | Soil | VPFDVVLGRALAWCANPYAAWRRLPASGRVLLVAAYVSAGYVTVLTLLLIS |
| C688J35102_1200126102 | 3300002568 | Soil | MNEIVPLDVALGRALACCLHPVASWRLLPAHGRVVLVAAYVSASYVTVFAALCFA* |
| Ga0062593_1000253564 | 3300004114 | Soil | MDVAIGRALACCVHPVVAWRRLTAYGRVGLVAAYVSASYVTMLAALLLA* |
| Ga0062589_1000188454 | 3300004156 | Soil | MDVVIGRALACCAHPVLSWRRLPAHGRVVLVAAYVSASYVTVLTALLLA* |
| Ga0062589_1009246451 | 3300004156 | Soil | LSGSVPLDIVIGRAVAYCMYPWASWRRLPALGRLMLVAAYVSASYVAVLALLLIA* |
| Ga0062590_1009130182 | 3300004157 | Soil | MTFEVVTGRALAFCVHPLSAWHRLPTSGRVLLVAAYVSASYALVLTALFIV* |
| Ga0062591_1027548093 | 3300004643 | Soil | FCAHPFASWRLLPASGRVLLVAAYVSASYVTVLTALLLA* |
| Ga0066683_100044725 | 3300005172 | Soil | VPLDIVIGRALACCVYPSASWRRLPATGRVLLVAAYVGAGYVTVLTLLFIA* |
| Ga0066673_104293531 | 3300005175 | Soil | VLLPAVIGRLLAYGLHPCAAWRRLPASGRAWLVAAYVSASYVAVLAFLLNARRF* |
| Ga0065715_101218853 | 3300005293 | Miscanthus Rhizosphere | MDVVLGRALACCAHPVLSWRRLPAYGRVGLVAAYVSASYVTVLTALLFA* |
| Ga0065707_104455022 | 3300005295 | Switchgrass Rhizosphere | MDVAIGRALACCVHPVVAWRRSTAYGRVGLVAAYVSASYVTMLAALLLA* |
| Ga0065707_107443652 | 3300005295 | Switchgrass Rhizosphere | MDVVIGRALACCAHPVLSWRRLPAYGRVGLVAAYVSASYVTVLAALLLA* |
| Ga0070692_108971992 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MTGGVPMDVVIGRALACCAHPVLSWRRLPAHGRVVLVAAYVSASYVTVLTALLLA* |
| Ga0070707_1004324193 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRVPFDVVIGRSLACCAHPAVAWRRLPASGRVLLIAAYVSASYVTVLTLLLIV* |
| Ga0070707_1017346031 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VPVDVAIGRSLACCAHPAAAWRRLPASGRVLLVAAYVSAGYVTVLSLLLIAR* |
| Ga0070704_1017647972 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | IGRSLACCVHPSASWRRLSAPGRVLLVAAYVSASYVAVLTLLFIV* |
| Ga0066704_106358801 | 3300005557 | Soil | MPLEVVIGRALACCVHPSASWRRLPASGRVLLVAAYVSASYATVLMLLFIA* |
| Ga0066705_105184062 | 3300005569 | Soil | IPVVIGRSLACCLHPWAAWRRLPASGRAWLVAAYVSASYVAVLAFLLNA* |
| Ga0066708_103625642 | 3300005576 | Soil | VLLPAVIGRLLAYGLHPCAAWRRLPASGRAWLVAAYVSASYVAVLAFLLNA* |
| Ga0068859_1004613363 | 3300005617 | Switchgrass Rhizosphere | ACCAHPVLSWRRLPAHGRVVLVAAYVSASYVTVLTALLLA* |
| Ga0066905_1000924043 | 3300005713 | Tropical Forest Soil | VPLELAIGRALACCAHPAISWRRLPASGRVMLVAAYVSASYVTVLTLLMLI* |
| Ga0066903_1002109122 | 3300005764 | Tropical Forest Soil | LVSRVPLDVAMGRSLAYAMNPTTSWRRLSARGRVGLVAAYVSASYVAVLMLLFAFRSP* |
| Ga0066903_1007456911 | 3300005764 | Tropical Forest Soil | VRLAVFLGRSFTYCRYPCAAWRRLPASGRALLLAAYAGVSYVTVLALLLIA* |
| Ga0066651_101963122 | 3300006031 | Soil | MPLEVVTGRALAFCAHPLSAWDRLPASGRILLVAAYVSASYAIVLMALFIA* |
| Ga0066652_1000865354 | 3300006046 | Soil | VRLPVFLGRSFIYCLYPCAGWRRLPASGRALLLAAYVGVSYVTVLALLLIA* |
| Ga0070715_101923152 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTGVPLDVAIGRALACCVHPVASWRLLPAYGRVVLVAAYVSASY |
| Ga0097621_1012433363 | 3300006237 | Miscanthus Rhizosphere | VVAMKTGVPLDVAIGRALACCVHPVASWRLLPAYGRVVLVAAYVSASYVTVLTALLLA* |
| Ga0075431_1009691251 | 3300006847 | Populus Rhizosphere | AQLEGVPFDVLIGRTLAWWVHPQASWRHLKATGRVVLVAAYVSAGYVTVLTLLLIA* |
| Ga0075433_107224562 | 3300006852 | Populus Rhizosphere | MGRALALCVHPLAAWRRLPASGRVLLVAAYVSASYLIVLSALFIV* |
| Ga0079215_104874642 | 3300006894 | Agricultural Soil | LPDFVPFDVVIGRVLACCVHPRASWRILPARGRLMLVAAYVSASYMTVLTLLFIA* |
| Ga0075426_100220013 | 3300006903 | Populus Rhizosphere | MPLEVVIGRGLACCVHPSASWRRLPASGRVFLVAAYVSASYATVLTLLFIA* |
| Ga0079216_113123261 | 3300006918 | Agricultural Soil | WCAHPYLSWRRLPASGRVLLVAAYVSASYVTVLTLLLVA* |
| Ga0079218_118394032 | 3300007004 | Agricultural Soil | VSFEARLGRSLAFCAYPEAAWRRLPARGRALLVTAYLLAAYVTVLSALLAL* |
| Ga0099794_107043972 | 3300007265 | Vadose Zone Soil | VPFDVVIGRSLACCAHPAVAWRRLPASGRVLLIAAYVSASYVTVLALLLIV* |
| Ga0066710_1000034943 | 3300009012 | Grasslands Soil | MPLEVVIGRALACCVHPSASWRRLPAPGRVLLVAAYVSASYVTVLMLLFIG |
| Ga0066710_1027114221 | 3300009012 | Grasslands Soil | VPLDVVIGRALAFSVHPSASWRRLPASGRVLLIAAYVSASYVTVLTLLFIG |
| Ga0066793_106779801 | 3300009029 | Prmafrost Soil | TWNRCCSASRVPLDVVIGRALAWCVHPSASWRRLPASGRVLLVAAYVSASYVTVRTLLFIV* |
| Ga0099829_106838701 | 3300009038 | Vadose Zone Soil | VPLDVVIGRALAFSVHPSASWRRLPASGRVLLVAAYVSASYVTVLTLLFIV* |
| Ga0099830_102953001 | 3300009088 | Vadose Zone Soil | LAYCVHPSASWRRLPATGRALLIAAFVSASYVTVLILLLIV* |
| Ga0099830_105433501 | 3300009088 | Vadose Zone Soil | VPLDVVIGRALAFSVHPSASCSRLPASGRVLLVAAYVSASYVTVLTLLFIV* |
| Ga0099827_100854272 | 3300009090 | Vadose Zone Soil | VPFDVVIGRSLACCAHPVVAWRRLPASGRVLLIAAYVSASYLTVLTLLLVV* |
| Ga0111539_100453915 | 3300009094 | Populus Rhizosphere | VIDVPFDVAIGRALAWCAHPYLSWGRLPASGRVVLVAAYVSAGYVTVLTLLLIA* |
| Ga0111539_125065152 | 3300009094 | Populus Rhizosphere | VIGVPFDVAIGRALAWCALPHLSWRRLPASGRVLLVAAYVSAGYVTVLTLLLIA* |
| Ga0111539_128621382 | 3300009094 | Populus Rhizosphere | VPLDIVLGRALACCAHPWASWRLLPARGRLWLVAAYVSASYVTVLSLLLIA* |
| Ga0066709_1009542812 | 3300009137 | Grasslands Soil | MPLEVVIGRALACCVHPSASWRRLPAPGRVLLVAAYVSASYVTVLMLLFIG* |
| Ga0105094_100510851 | 3300009153 | Freshwater Sediment | GRALAWCVHPVAAWQRLPARGRVLLVAAYVGASYTTVLSLLFMV* |
| Ga0105094_109476081 | 3300009153 | Freshwater Sediment | VPLDLFIGRALAWCVHPVAAWQRLPARGRVVLVAAYVSASYTTVLTVLFLV* |
| Ga0105340_14703571 | 3300009610 | Soil | IRSVPIDVVLGRALAWCANPYASWRRLPASGRVWLVAAYVSASYVTVLTLLLIS* |
| Ga0126384_108404752 | 3300010046 | Tropical Forest Soil | MSGTVPLELAIGRALACCAHPAISWRRLPASGRVMLVAAYVSASYVTVLTLLLLI* |
| Ga0126382_108391652 | 3300010047 | Tropical Forest Soil | MPYEVVMGRALAFYVHPLAAWRRLPTSHRALLLAAYASAGYLIVLAALFIV* |
| Ga0126306_116931241 | 3300010166 | Serpentine Soil | AWCAHPYASWRRLPASGRVLLVAAYVSASYVTVLTVLLVARI* |
| Ga0134070_103430812 | 3300010301 | Grasslands Soil | VPLDIVIGRALACCVYPSASWRRLPASGRVLLVAAYVSASYATVLMLLFI |
| Ga0134111_100575192 | 3300010329 | Grasslands Soil | VPLDIVIGRALACCVYPSASWRRLPATGRVLLVAAYGGAGYVTVLTLLFIA* |
| Ga0126370_123320091 | 3300010358 | Tropical Forest Soil | MPYEVVMGRALAFYVHPVAAWRRLPTSHRALLLAAYASAGYLIVLAALFIV* |
| Ga0134127_111579532 | 3300010399 | Terrestrial Soil | VEPLLLSAGLVALDVLIGRALAWCLHPAAAWQRLPAGGRVLLVAAYVSASYMTVLTLLLIA* |
| Ga0150983_152543301 | 3300011120 | Forest Soil | RWNRCCSAGTMPLDVVVGRALAHCVHPSVSWRRLPASGRVLLVAAYVSASYVTVLTLLFLIV* |
| Ga0137391_114349401 | 3300011270 | Vadose Zone Soil | MTPEVVVGRALAYCAHPSASWRRLPAPGRALLVAAYVSASYVTVLILLFIV* |
| Ga0137427_101465202 | 3300011445 | Soil | VPSDVAIERALTCCVDATISWRRLPASGRVQLVAAYVSASYVTVLDAAPR |
| Ga0137363_104269953 | 3300012202 | Vadose Zone Soil | CVHPYASWRQLSASGRAWLIAAYVGAGYLTVLSLLFIV* |
| Ga0137399_111340273 | 3300012203 | Vadose Zone Soil | YPAAAWRRLPASGRVLLLAAYVSASYVTVLTLLFVV* |
| Ga0150985_1097418182 | 3300012212 | Avena Fatua Rhizosphere | MAYSIVIGRSLAYCVHPWASWRRLPASGRTMLVAAYAGASYVTVLTLLLVK* |
| Ga0137390_108458592 | 3300012363 | Vadose Zone Soil | VAPAGPVPLDVVIGRALAFSVHPSASWRRLPASGRVLLVAAYVSASYVTVLTLLFIV* |
| Ga0134057_13419061 | 3300012396 | Grasslands Soil | IGRGLACCVHPSASWRRLPASGRVLLVAAYVSASYATVLMLLFIR* |
| Ga0157288_104259583 | 3300012901 | Soil | LACCVHPVVAWRRLTAYGRVGLVAAYVSASYVTMLAALLLA* |
| Ga0137395_109914942 | 3300012917 | Vadose Zone Soil | VLLPAVIGRLLAYGLHPCAAWRRLPAPGRAWLVAAYVSASYVTVLAFLLTA* |
| Ga0164305_109845772 | 3300012989 | Soil | MKTGVPLDVAIGRALACCVHPVASWRLLPAYGRVVLVAAYVSASYVTVLTALLLA* |
| Ga0134075_101352102 | 3300014154 | Grasslands Soil | ACCVYPSASWRRLPATGRVLLVAAYVGAGYVTVLTLLFIA* |
| Ga0075310_11311282 | 3300014302 | Natural And Restored Wetlands | EVFLGRSAAFCVHPFAAWRRLPTTGRVLLVGVYFSGSYVGVLTALLIG* |
| Ga0173478_102255302 | 3300015201 | Soil | MTFEVVTGRALAFCVHPLSAWHRLPTSGRVLLVAAYVSASYAIVLMALFIV* |
| Ga0132258_105967613 | 3300015371 | Arabidopsis Rhizosphere | VLPVFLGRSFIYCLYPCAAWRRLPASGRALLLAAYAGVSYVTVLTLLLIA* |
| Ga0132258_115668434 | 3300015371 | Arabidopsis Rhizosphere | AHPVLSWRRLPAHGRVVLVAAYVSASYVTVLTALLLA* |
| Ga0132255_1017917162 | 3300015374 | Arabidopsis Rhizosphere | GPVPPRRVIGRALEGGVHALISWRRLAVSGRVPLVAAYVSASYATVLNRGANPDVVA* |
| Ga0132255_1033472952 | 3300015374 | Arabidopsis Rhizosphere | MTAGVPMDVVIGRFLACCAHPVLSWRRLPAFGRVGLVAAYVSASYVTVLTALLLA* |
| Ga0184637_102118343 | 3300018063 | Groundwater Sediment | VPINVVIGRALACCVYPLASWRRLPASGRVALVAAYVSAGYVTVLTLLFIV |
| Ga0190272_132294891 | 3300018429 | Soil | IGRALAWCVHPAAAWHRLPARGRVLLVAAYVSASYMTVLTLLFIV |
| Ga0066667_104398241 | 3300018433 | Grasslands Soil | VPLDIVIGRALACCVYPSASWRRLPATGRVLLVAAYVGAGYVTVLTLLFIA |
| Ga0066669_105356161 | 3300018482 | Grasslands Soil | VLLPAVIGRLLAYGLHPCAAWRRLPASGRAWLVAAYVSASYVAVLVFLLNA |
| Ga0066669_118778381 | 3300018482 | Grasslands Soil | AVLSPVVIGRSLACCLHPWAAWRRLPASGRAWLVAAYVSASYVTVLAVLLIA |
| Ga0173479_100672612 | 3300019362 | Soil | MTFEVVTGRALAFCVHPLSAWHRLPTSGRVLLVAAYVSASYALVLTALFIV |
| Ga0190264_116914692 | 3300019377 | Soil | CLQPAPAWRRLPASGRALLVAAYVSDSYVTVLTLLFMCHAKG |
| Ga0193746_10298751 | 3300019870 | Soil | MRLLVPLDVAIGRALACCVHPSASWRLLPASGRVLLVAAYVSASYVTVLTLLFVA |
| Ga0193719_100347853 | 3300021344 | Soil | MDVVIGRALACGAHPSASWRRLPASGRVLLVAAYVSASYVTVLTLLFIL |
| Ga0210384_102180332 | 3300021432 | Soil | MPLDVVVGRALAHCVHPSVSWRRLPASGRVLLVAAYVSASYVTVLLLCFIV |
| Ga0247799_10794542 | 3300023072 | Soil | MDVAIGRALACCVHPVVAWRRLTAYGRVGLVAAYVSASYVTMLAALLLA |
| Ga0247794_101329073 | 3300024055 | Soil | MDVVIGRALACCAHPVLSWRRLPAHGRVVLVAAYVSASYVTVLTALLLA |
| Ga0207656_104643063 | 3300025321 | Corn Rhizosphere | MTGGVPMDVVIGRALACCAHPVLSWRRLPAHGRVVLVAAYVSASYVTVLTALLLA |
| Ga0207684_117260891 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLEAVVGRALAYCVHPSASWRRLPARGRVLLVAAYVSASYVTVLILLFMV |
| Ga0207654_100977951 | 3300025911 | Corn Rhizosphere | PMDVVIGRALACCAHPVLSWRRLPAHGRVVLVAAYVSASYVTVLTALLLA |
| Ga0207646_105584123 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRVPFDVVIGRSLACCAHPAVAWRRLPASGRVLLIAAYVSASYVTVLTLLLIV |
| Ga0207694_106537803 | 3300025924 | Corn Rhizosphere | AMTGGVPMDVVIGRALACCAHPVLSWRRLPAHGRVVLVAAYVSASYVTVLTALLLA |
| Ga0207687_116563473 | 3300025927 | Miscanthus Rhizosphere | LACCAHPVLSWRRLPAHGRVVLVAAYVSASYVTVLTALLLA |
| Ga0207686_103251893 | 3300025934 | Miscanthus Rhizosphere | VVIGRALACCAHPVLSWRRLPAHGRVVLVAAYVSASYVTVLTALLLA |
| Ga0207689_116288601 | 3300025942 | Miscanthus Rhizosphere | ACCAHPVLSWRRLPAHGRVVLVAAYVSASYVTVLTALLLA |
| Ga0207658_101680441 | 3300025986 | Switchgrass Rhizosphere | VPMDVVIGRALACCAHPVLSWRRLPAHGRVVLVAAYVSASYVTVLTALLLA |
| Ga0207658_103536043 | 3300025986 | Switchgrass Rhizosphere | MDVVIGRALACCAHPVLSWRRLPAHGRVVLVAAYVSASYVTVLTAL |
| Ga0207678_100942362 | 3300026067 | Corn Rhizosphere | MDVVIGRTLACCAHPVLSWRRLPAHGRVVLVAAYVSASYAIVLMALFIA |
| Ga0209157_11390343 | 3300026537 | Soil | DVPLDVVIGRGLACCVHPSASWRRLPASGRVLLVAAYVSASYATVLTLLFIA |
| Ga0209474_100014836 | 3300026550 | Soil | VLLPAVIGRLLAYGLHPCAAWRRLPASGRAWLVAAYVSASYVAVLAFLLNA |
| Ga0209180_103164551 | 3300027846 | Vadose Zone Soil | LAFSVHPSASWRRLPASGRVLLVAAYVSASYVTVLTLLFIV |
| Ga0209701_101538432 | 3300027862 | Vadose Zone Soil | VPLDVVIGRALAFSVHPSASWRRLPASGRVLLVAAYVSASYVTVLTLLFIV |
| Ga0209974_104449712 | 3300027876 | Arabidopsis Thaliana Rhizosphere | LIGRALAWCVHPVAAWQRLPARGRVLLVAAYVGASYTTVLAVLLMA |
| Ga0307308_104632451 | 3300028884 | Soil | LAYCVHPSAAWRRLPTSGRVLLVAAYVSASYVTVLTALFIV |
| Ga0308309_109670482 | 3300028906 | Soil | AHPSASWRRLPAPGRALLVAAYVGVSYVTVLILLFIV |
| Ga0170824_1074614241 | 3300031231 | Forest Soil | VVIGRAVACCVHPSASWRRLPAPGRVLLVAAYVSASYVTVLTLLFFLV |
| Ga0308194_101604082 | 3300031421 | Soil | RSLAYCVHPSAAWRRLPTSGRVLLVAAYVSASYVTVLTALFIV |
| Ga0307469_122590302 | 3300031720 | Hardwood Forest Soil | HVPIEVVIGRSLACCVHPSVSWRRLPASGRVLLVAAYVSASYVAVLTLLFIV |
| Ga0307413_110541262 | 3300031824 | Rhizosphere | MDVPFDVAIGRALAWCAHPYLSWRRLPASGRVLLVAAYVSASYVTVLTLLLVA |
| Ga0310901_105832732 | 3300031940 | Soil | IEVAQEIDVPFDVAIGRALAWCAHPYLSWGRLPASGRVVLVAAYVSAGYVTVLTLLLIA |
| Ga0364924_044986_368_481 | 3300033811 | Sediment | VYPFASWRRLPASGRVALVAAYVSAGYVTVLTLLFIV |
| Ga0370484_0103135_467_622 | 3300034125 | Untreated Peat Soil | VPLDVVIGRALAWCVHPSASWRRLPASGRVLLVAAYVSASYVTVLTLLFIV |
| Ga0364925_0171728_655_792 | 3300034147 | Sediment | MPSDVAIERALTCCVDAAISWRRLPASGRVQLVAAYVSASYVTVLD |
| Ga0364935_0042226_2_121 | 3300034151 | Sediment | YCVYPWASWRRLPARGRLMLVAAYVSASYVTVLALLLMV |
| Ga0373948_0055558_531_680 | 3300034817 | Rhizosphere Soil | MDVVIGRALACCAHPVLSWRRLPAHGRVVLVAAYVSASYVTMLAALLLA |
| ⦗Top⦘ |