Basic Information | |
---|---|
Family ID | F083322 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 113 |
Average Sequence Length | 40 residues |
Representative Sequence | PDDRHFVVPRRGHGEAVRTYIGRIDEATARLRRHPRQPD |
Number of Associated Samples | 93 |
Number of Associated Scaffolds | 113 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 12.39 % |
% of genes from short scaffolds (< 2000 bps) | 9.73 % |
Associated GOLD sequencing projects | 85 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.53 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (87.611 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (28.319 % of family members) |
Environment Ontology (ENVO) | Unclassified (45.133 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.558 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.37% β-sheet: 0.00% Coil/Unstructured: 74.63% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 113 Family Scaffolds |
---|---|---|
PF07681 | DoxX | 18.58 |
PF02148 | zf-UBP | 7.96 |
PF00210 | Ferritin | 6.19 |
PF07676 | PD40 | 5.31 |
PF13462 | Thioredoxin_4 | 4.42 |
PF07992 | Pyr_redox_2 | 2.65 |
PF00144 | Beta-lactamase | 2.65 |
PF03740 | PdxJ | 1.77 |
PF13669 | Glyoxalase_4 | 1.77 |
PF16542 | PNKP_ligase | 1.77 |
PF14094 | DUF4272 | 1.77 |
PF06983 | 3-dmu-9_3-mt | 1.77 |
PF00072 | Response_reg | 1.77 |
PF12867 | DinB_2 | 0.88 |
PF08447 | PAS_3 | 0.88 |
PF03699 | UPF0182 | 0.88 |
PF07690 | MFS_1 | 0.88 |
PF12840 | HTH_20 | 0.88 |
PF02518 | HATPase_c | 0.88 |
PF10017 | Methyltransf_33 | 0.88 |
PF00480 | ROK | 0.88 |
PF16536 | PNKP-ligase_C | 0.88 |
PF09365 | DUF2461 | 0.88 |
PF13414 | TPR_11 | 0.88 |
PF14522 | Cytochrome_C7 | 0.88 |
PF01850 | PIN | 0.88 |
PF00005 | ABC_tran | 0.88 |
PF00027 | cNMP_binding | 0.88 |
PF15887 | Peptidase_Mx | 0.88 |
PF00903 | Glyoxalase | 0.88 |
PF03703 | bPH_2 | 0.88 |
PF02065 | Melibiase | 0.88 |
COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
---|---|---|---|
COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 18.58 |
COG4270 | Uncharacterized membrane protein | Function unknown [S] | 18.58 |
COG5207 | Uncharacterized Zn-finger protein, UBP-type | General function prediction only [R] | 7.96 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 2.65 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 2.65 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 2.65 |
COG0854 | Pyridoxine 5'-phosphate synthase PdxJ | Coenzyme transport and metabolism [H] | 1.77 |
COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 1.77 |
COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 1.77 |
COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 1.77 |
COG1615 | Uncharacterized membrane protein, UPF0182 family | Function unknown [S] | 0.88 |
COG3345 | Alpha-galactosidase | Carbohydrate transport and metabolism [G] | 0.88 |
COG3402 | Uncharacterized membrane protein YdbS, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.88 |
COG3428 | Uncharacterized membrane protein YdbT, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.88 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 87.61 % |
All Organisms | root | All Organisms | 12.39 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300005451|Ga0066681_10007240 | All Organisms → cellular organisms → Bacteria | 5242 | Open in IMG/M |
3300009012|Ga0066710_100107573 | All Organisms → cellular organisms → Bacteria | 3755 | Open in IMG/M |
3300010329|Ga0134111_10085144 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1196 | Open in IMG/M |
3300010335|Ga0134063_10446683 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
3300012200|Ga0137382_10258220 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1208 | Open in IMG/M |
3300012208|Ga0137376_10365213 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1253 | Open in IMG/M |
3300012349|Ga0137387_10321800 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
3300012350|Ga0137372_10392078 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
3300012930|Ga0137407_10410923 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1254 | Open in IMG/M |
3300018084|Ga0184629_10172540 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
3300026328|Ga0209802_1251429 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
3300026524|Ga0209690_1304036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
3300026551|Ga0209648_10049992 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 3585 | Open in IMG/M |
3300031720|Ga0307469_10166560 | All Organisms → cellular organisms → Bacteria | 1674 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 28.32% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 17.70% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 15.93% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 11.50% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.19% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.31% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.54% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.65% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.65% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.77% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.89% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.89% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012372 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012380 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012406 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25381J37097_10131581 | 3300002557 | Grasslands Soil | SRPDDRHFVVPRRAQGEALRAYIRRIDEATAKLGRHPRQPDP* |
JGI25383J37093_101606261 | 3300002560 | Grasslands Soil | LKSSRPDDRHFVVPRRAHGEAVRTYIGRIDEATAQLRRHPRQPD* |
JGI25382J37095_100743293 | 3300002562 | Grasslands Soil | PDDRHFVVPRRAHGEAVRKYIGRIDEATTQLRRHPRQRD* |
JGI25382J43887_102158093 | 3300002908 | Grasslands Soil | PDDRHFVVPRRGHGEAVRTYIGRIDEATARLRRHPRQPD* |
JGI25386J43895_100717482 | 3300002912 | Grasslands Soil | PDDAHFVVPRRDHGEAVRAYIGRIDDATARLRRHPRHTD* |
Ga0066674_100408851 | 3300005166 | Soil | TQPDDRHFVLPRREHGESIRTYVSRIDAAASALRKHPRRPD* |
Ga0066674_101008614 | 3300005166 | Soil | KSAQPDDRHFVVPRRGHGEAVRAYIGRIDEATARLRRHPRQPD* |
Ga0070683_1018852791 | 3300005329 | Corn Rhizosphere | DLQSSRPDDQHFVLPRRQAGEAIRAYIVRVEEATVRLRDHPRRAD* |
Ga0066682_109518932 | 3300005450 | Soil | PDDRHFVVPRRARGEALRTYIGRIDEATARLRAHPRQPD* |
Ga0066681_100072409 | 3300005451 | Soil | LKSAQPDDRHFVLPRRESGEAVRAYIVRIDTATIALRKHKRGTD* |
Ga0070681_100327058 | 3300005458 | Corn Rhizosphere | SRPDDQHFVLPRRQAGEAIRAYIVRVEEATVRLRDHPRRAD* |
Ga0066697_101742151 | 3300005540 | Soil | HFVVPRRARGEAVHSYIVRIVDAAARLGDHPRHPD* |
Ga0070704_1006071971 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | DDRHFVLPRRDHAELIRAYIGRIRAATSGLRKHPRHLDS* |
Ga0066692_106681191 | 3300005555 | Soil | DDRHFVVPRRGPGEAVRADIGRIDEATARLRRHPRQPD* |
Ga0066670_108443361 | 3300005560 | Soil | PDDRHFVVPRRAQGEAVRAYIRRIDEATAKLGRHPRQPEP* |
Ga0066694_103406521 | 3300005574 | Soil | SHFVVPRRGHGETVRAYVVRIDEAAARLRGHPRKPD* |
Ga0066702_108411951 | 3300005575 | Soil | KSAQPDDRHFVVPRRAHAEPVRTYIRRIDEATAQLHRHPRQPDR* |
Ga0066654_101058641 | 3300005587 | Soil | RPDDSHFVVPRRAPGEGVRAYIGRIDAATAGLRRHPRQRD* |
Ga0070715_102134053 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | FVLPRRVPGESVRAYINRIDAAAAALRKHPRRPD* |
Ga0066658_101466481 | 3300006794 | Soil | DRHFVVPRRARGETVRAYLVRIDEAAAELRRHPRQPD* |
Ga0066665_106596561 | 3300006796 | Soil | LKSAEPDDRHFVVPRRAHGEAVRKYIGRIDEATAQLRRHPRQRD* |
Ga0066665_111559381 | 3300006796 | Soil | DRHFVLPRREHGESVPTYVKRIDAATAGLRRHPRRPD* |
Ga0066659_116082422 | 3300006797 | Soil | PDDRHFVLPRRESGEAVRDYIARIDAATGALRKHKRGTD* |
Ga0075434_1010655851 | 3300006871 | Populus Rhizosphere | DDPHFVVPRRHPGESLRSYIQRIDTATRDLQRHPVRE* |
Ga0075426_100853511 | 3300006903 | Populus Rhizosphere | EPDDRHFVVPRREPGESIRAYVGRIDDATVQLRRHPRPPD* |
Ga0075424_1000557981 | 3300006904 | Populus Rhizosphere | FVVPRRGHGETVRAYVVRIDEAAGRLRRHPRQTD* |
Ga0075435_1006650251 | 3300007076 | Populus Rhizosphere | PDDRHFVLPRRAHAEPIRAYIGRISAATSGLKKHPRHTDS* |
Ga0099793_101228461 | 3300007258 | Vadose Zone Soil | AHYVVPRREHGEVIRAYIGRIDEATASLRRHPRRPD* |
Ga0066710_1001075736 | 3300009012 | Grasslands Soil | DLKSVQPDDRHFVVPRRAHAEAVRVYITRIDAATARLRTHPRRTD |
Ga0066710_1044804411 | 3300009012 | Grasslands Soil | SSRPDDRHFVVPRRARGEAVRKYIGRIDEATAQLRRHPPQRD |
Ga0099829_102237181 | 3300009038 | Vadose Zone Soil | HFVLPRRTRGEAIRAYIGRIDEATVRLRRHPRQRD* |
Ga0099827_101169891 | 3300009090 | Vadose Zone Soil | KSSQPDDRHFVVPRRARGEAVRAYIVRIDAAAGELRRHPRQPD* |
Ga0111539_110747543 | 3300009094 | Populus Rhizosphere | RPDDRHFVLPRRGKDESARAYMVRIDEAAMALRRHPRHPG* |
Ga0075423_104370752 | 3300009162 | Populus Rhizosphere | PDDRHFVLPRRAHAETIRAYVVRIDDATAGLRRHPRKPD* |
Ga0075423_118480281 | 3300009162 | Populus Rhizosphere | HFVLPRRAPGEAVRAYISRIDAATSALRKHPRKPD* |
Ga0134084_102952491 | 3300010322 | Grasslands Soil | FVVPRRAHGEAMRTYIARIDEAAARLRRHPRRPV* |
Ga0134086_103825811 | 3300010323 | Grasslands Soil | HFVLPRRAHAEAVRAYIGRIDEATARLRRHPRQPD* |
Ga0134086_104304992 | 3300010323 | Grasslands Soil | FVVPRRGAREPVRAYIGRIDEAAALLRRHPPQPD* |
Ga0134065_105149772 | 3300010326 | Grasslands Soil | LKSAQPDDRHFVLPRRESGEAVRDYIARIDAATGALRKHKRGTD* |
Ga0134111_100851443 | 3300010329 | Grasslands Soil | DDLKSAQPDDRHFVLPRRESGEAVRDYIARIDAATGALRKHKRGTD* |
Ga0134080_105681211 | 3300010333 | Grasslands Soil | SSRPDDRHFVVPRRAHGEVVRAYITRIDEATAQLRRHPRQPD* |
Ga0134063_104466833 | 3300010335 | Grasslands Soil | DLKSAQPDDRHFVVPRRGHGEAVRTYIGRIDEATARLHRHPRQPD* |
Ga0134125_130136761 | 3300010371 | Terrestrial Soil | QPDDSHFVVPRRGHGETVRAYVIRIDEAAARLRGHPRKPD* |
Ga0134128_127503271 | 3300010373 | Terrestrial Soil | SSRPDDQHFVLPRRQAGEAIRAYIVRVEEATVRLRDHPRRAD* |
Ga0134123_119110731 | 3300010403 | Terrestrial Soil | RHFVLPRRAHAETIRAYIVRIDEATAGLRRHPRKPD* |
Ga0137392_102884091 | 3300011269 | Vadose Zone Soil | SSQPDDQHFVVPRRGPGETVRAYVVRIDEAAGRLRRHPRQPD* |
Ga0137389_108529861 | 3300012096 | Vadose Zone Soil | DDPHFVLPRRARGEAIRAYIGRIDEATGNLRRHPRQRD* |
Ga0137388_100285728 | 3300012189 | Vadose Zone Soil | HFVLPRREHGESIRTYIIRIDEAAAGLRRHPRRPD* |
Ga0137364_113952472 | 3300012198 | Vadose Zone Soil | PDDRHFVLPRRAHAEAVRAYIGRIDEATARLRRHPRQPD* |
Ga0137382_100504421 | 3300012200 | Vadose Zone Soil | HFVVPRRGARETVRAYIGRIDEAAALLRRHPPQPD* |
Ga0137382_102582203 | 3300012200 | Vadose Zone Soil | VDDLKSEQPDDRHFVLPRRERGEATRAYIIRIDNAADALRRHPRLPD* |
Ga0137365_104749712 | 3300012201 | Vadose Zone Soil | DDSHFVVPRRGHGETVRAYVVRIDEAAARLRGHPRKPD* |
Ga0137365_109024441 | 3300012201 | Vadose Zone Soil | SSQPDDSHFVVPRRGHGETVRAYVVRIDEAAARLRGHPPKPD* |
Ga0137380_116354222 | 3300012206 | Vadose Zone Soil | HFVVPRRGHGETVRAYVVRIDEAAARLRGHPRKPD* |
Ga0137376_103652131 | 3300012208 | Vadose Zone Soil | DSHFVVPRRGHGETVRAYVVRIDEAAARLRGHPRKPD* |
Ga0137376_105322194 | 3300012208 | Vadose Zone Soil | HFVVPRRARGEALRTYIGRIDEATARLRAHPRQPD* |
Ga0137379_112730352 | 3300012209 | Vadose Zone Soil | LKSAQPDDRHFVVPRRAHGEAVRIYINRIDAATAGLRTHPRRTD* |
Ga0137377_108293873 | 3300012211 | Vadose Zone Soil | KSSQPDDSHFVVPRRGHGETVRAYVVRIDEAAARLRGHPRKPD* |
Ga0137387_103218001 | 3300012349 | Vadose Zone Soil | DLKSAQPDDRHFVVPRRGHGESVRAYIGRIDEATARLRRHPRQPD* |
Ga0137387_105301471 | 3300012349 | Vadose Zone Soil | SSQPDDSHFVVPRRGHGETVRAYVVRIDEAAARLRGHPPKPY* |
Ga0137387_106942491 | 3300012349 | Vadose Zone Soil | PDDQHFVVPRRAHGEAMRTYIARIDEATARLRRHPRRPD* |
Ga0137387_111864371 | 3300012349 | Vadose Zone Soil | SRPDDQHFVVPRRTHAEPVRTYIGRIDEATARLRSHPRHTD* |
Ga0137372_103920783 | 3300012350 | Vadose Zone Soil | DDLKSAQPDDRHFVLPRRAHAEAVRAYIGRIDEATARLRRHPRQPD* |
Ga0137369_104916431 | 3300012355 | Vadose Zone Soil | SRPDDRHFVLPRRAQAESARAYMVRIDAATEALQRHPRHPG* |
Ga0137385_114398581 | 3300012359 | Vadose Zone Soil | PDDHHFVVPRRTHAEPVRTYIGRIDEATARLRTHPRHTA* |
Ga0134037_10260551 | 3300012372 | Grasslands Soil | HYVVPRRALGEGTRAYIARIDAATAGLRRHPRRPD* |
Ga0134047_10424651 | 3300012380 | Grasslands Soil | RSSRPDDPHYVVPRRQHGEVIRAYIGRIDEATASLRRHPRRPD* |
Ga0134053_11410872 | 3300012406 | Grasslands Soil | YVVPRRAHGEGIRAYIGRIDEATAGLRRHPPRPD* |
Ga0137398_108327211 | 3300012683 | Vadose Zone Soil | KSAQPDDRHFVLPRREHGESIRTYVSRIDAAASALRKHPRRPD* |
Ga0137397_105715091 | 3300012685 | Vadose Zone Soil | LKSSQPDDSHFVVPRRGHGETVRAYVARIDEAAARLRGHPRKPD* |
Ga0137396_107420803 | 3300012918 | Vadose Zone Soil | RHFVVPRRAHAEAVRTYIGRIDEATARLRRHPRQPDR* |
Ga0137394_111584332 | 3300012922 | Vadose Zone Soil | HFVVPRRGHGETVRAYVARIDEAAARLRGHPRKPD* |
Ga0137404_102976831 | 3300012929 | Vadose Zone Soil | HFVVPRRGNGETVRAYVARIDEAAARLRGHPRKPD* |
Ga0137407_104109233 | 3300012930 | Vadose Zone Soil | DDLKSVQPDDAHFVLPRRSTGEAVRAYIGRIVAAMAKLRDHPRKPD* |
Ga0137410_119717982 | 3300012944 | Vadose Zone Soil | FVLPRRAQAESARAYMVRIDAATEALRQHPRHPG* |
Ga0157370_109649102 | 3300013104 | Corn Rhizosphere | QHFVLPRRQAGEAIRAYIVRVEEATVRLRDHPRRAD* |
Ga0134079_104203991 | 3300014166 | Grasslands Soil | LKSSRPDDRHFVLPRRGNAESARAYMVRIDGATEALRRHPRHPG* |
Ga0137411_12481231 | 3300015052 | Vadose Zone Soil | VPRRGHGETVRAYDGETVRAYVARIDEAAARLRGHPRKPD* |
Ga0134069_10222911 | 3300017654 | Grasslands Soil | SSRPDDRHFVVPRRGPAEAVRKYIVRIDAAAAELRRHPRQPD |
Ga0134069_10360943 | 3300017654 | Grasslands Soil | PDDRHFVLPRREHGESIRTYVSRIDAAASALRKHPRRPD |
Ga0187778_105094721 | 3300017961 | Tropical Peatland | KSAAPDDPHFVLPRRKHDEAIRAYIARIDAATTHLRRHQRRAD |
Ga0184608_104129262 | 3300018028 | Groundwater Sediment | VQPDDRHFVLPRRNHGEAIRPYIIRIDAATSGLRKHPRRPD |
Ga0184629_101725402 | 3300018084 | Groundwater Sediment | DLKSAQPDDPHFVVPRRAHAEAIRTYIVRIDEATAGLRRHPRHTD |
Ga0066667_118355482 | 3300018433 | Grasslands Soil | RPDDRHFVVPRRAHGEAVRTYIVRIDEATTQLRRHPPQPD |
Ga0215015_103693991 | 3300021046 | Soil | PDDPHFVLPRRTRGETVRAYIARIDEATARLRKHPRRPD |
Ga0207653_103254772 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | VDDLKSSRPDDRHFVLPRRGKDESARAYLVRIDEAAMALRRHPRHPG |
Ga0207685_102351161 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | QPDDRHFVLPRRVPGESVRAYINRIDAAAAALRKHPRRPD |
Ga0207707_100311661 | 3300025912 | Corn Rhizosphere | PDDQHFVLPRRQAGEAIRAYIVRVEEATVRLRDHPRRAD |
Ga0207695_100449779 | 3300025913 | Corn Rhizosphere | QSSRPDDQHFVLPRRQAGEAIRAYIVRVEEATVRLRDHPRRAD |
Ga0207657_113168522 | 3300025919 | Corn Rhizosphere | DLQSSRPDDQHFVLPRRQAGEAIRAYIVRVEEATVRLRDHPRRAD |
Ga0209438_10092948 | 3300026285 | Grasslands Soil | DDRHFVLPRRGKAESARAYIVRIDAATEALRQHPRHPG |
Ga0209235_10561711 | 3300026296 | Grasslands Soil | SRPDDRHFVVPRRARGEAVRAYIGRIDEATAQLRRHPRQPD |
Ga0209235_11299031 | 3300026296 | Grasslands Soil | RHFVVPRRARGEAVRAYMVRIDEAAAELRRHPRQPD |
Ga0209235_12203541 | 3300026296 | Grasslands Soil | DDRHFVVPRRAHGEAVRTYIGRIDEATAQLRRHPRQPD |
Ga0209237_10918433 | 3300026297 | Grasslands Soil | RHFVVPRRAHGEAVRTYIGRIDEATAQLRRHPRQPD |
Ga0209237_11812471 | 3300026297 | Grasslands Soil | KSSQPDDSHFVVPRRGHGETVRAYVVRIDEAAARLRGHPRKPD |
Ga0209027_11636591 | 3300026300 | Grasslands Soil | RHFVVPRRAQGEAVRAYIRRIDEATAKLGRHPRQPEP |
Ga0209469_11155691 | 3300026307 | Soil | RHFVVPRRGPAEAVRKYIVRIDAAAAELRRHPRQPD |
Ga0209801_12840861 | 3300026326 | Soil | PHFVLPRRAQGERIRAYTARIDAATAGLGRHPRQPD |
Ga0209266_11129354 | 3300026327 | Soil | LKSAEPDDRHFVVPRRGHGEAVRTYIGRIDEATARLRRHPRQPD |
Ga0209802_12514291 | 3300026328 | Soil | LKSSRPDDRHFVVPRRAPGEAVGAYIGRIDAATAGLRRHPRRPD |
Ga0209690_13040362 | 3300026524 | Soil | DLKSAKPDDRHFVVPRRAHGEAVRKYIGRIDEATAQLRRHPRQRD |
Ga0209161_100373841 | 3300026548 | Soil | QHFVVPRRAHGEAMRTYIARIDEATARLRRHPRRPD |
Ga0209648_100499926 | 3300026551 | Grasslands Soil | RHFVVPRRTAGEAIRAYIGRIDEATARLRRHAPRPD |
Ga0209648_105147913 | 3300026551 | Grasslands Soil | SQPDDPHFVLPRRARGDTVRAYIGRIDEATARLRKHPRQRD |
Ga0209648_105162642 | 3300026551 | Grasslands Soil | RHFVVPQRARGEAVRAYIVRIDEAAAGLHRHPRRPD |
Ga0209180_104047972 | 3300027846 | Vadose Zone Soil | DQHFVVPRRGPGETVRAYVVRIDEAAGRLQRHPRQPD |
Ga0307469_101665601 | 3300031720 | Hardwood Forest Soil | DDLKSSQPDDRHFVLPRRAPGEAVRAYISRIDAATSALRKHPRKPD |
Ga0307469_101939993 | 3300031720 | Hardwood Forest Soil | PDDRHFVLPRRVPGESVRAYINRIDAAAAALRKHPRRPD |
Ga0307469_111434151 | 3300031720 | Hardwood Forest Soil | PDDRHFVVPRRGHGETVRAYVVRIDEAAARLRGHPRKPD |
Ga0307469_122467201 | 3300031720 | Hardwood Forest Soil | LQSSRPDDRHFVMPRRAHGEAVRAYIGRIDEATAQLRRHPRQPD |
Ga0307468_1017024992 | 3300031740 | Hardwood Forest Soil | RHFVVPRRGHGETVRAYVVRIDEAAARLRGHPRKPD |
Ga0307473_111110922 | 3300031820 | Hardwood Forest Soil | SAQPDDRHFVVPRRAPAEAVRTYIGRIDEATARLRRHPRQPDR |
⦗Top⦘ |