| Basic Information | |
|---|---|
| Family ID | F083317 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MLATLIAATSGDVTKAGKAIGLALGVGLGALGAGVGI |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 99.12 % |
| % of genes near scaffold ends (potentially truncated) | 99.12 % |
| % of genes from short scaffolds (< 2000 bps) | 92.92 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.345 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (15.929 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.053 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (46.018 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.85% β-sheet: 0.00% Coil/Unstructured: 46.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF00119 | ATP-synt_A | 92.04 |
| PF13450 | NAD_binding_8 | 1.77 |
| PF00430 | ATP-synt_B | 0.88 |
| PF12697 | Abhydrolase_6 | 0.88 |
| PF13637 | Ank_4 | 0.88 |
| PF01047 | MarR | 0.88 |
| PF00137 | ATP-synt_C | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG0356 | FoF1-type ATP synthase, membrane subunit a | Energy production and conversion [C] | 92.04 |
| COG0636 | FoF1-type ATP synthase, membrane subunit c/Archaeal/vacuolar-type H+-ATPase, subunit K | Energy production and conversion [C] | 0.88 |
| COG0711 | FoF1-type ATP synthase, membrane subunit b or b' | Energy production and conversion [C] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.35 % |
| Unclassified | root | N/A | 2.65 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2140918008|ConsensusfromContig181898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 986 | Open in IMG/M |
| 3300000891|JGI10214J12806_10667908 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300000955|JGI1027J12803_108984235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1055 | Open in IMG/M |
| 3300002070|JGI24750J21931_1091744 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300004114|Ga0062593_101618022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 704 | Open in IMG/M |
| 3300005543|Ga0070672_100208635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1635 | Open in IMG/M |
| 3300005562|Ga0058697_10458469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 643 | Open in IMG/M |
| 3300005564|Ga0070664_100562136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1055 | Open in IMG/M |
| 3300005576|Ga0066708_11034688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 510 | Open in IMG/M |
| 3300005614|Ga0068856_100081812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3204 | Open in IMG/M |
| 3300005616|Ga0068852_102100870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 587 | Open in IMG/M |
| 3300005764|Ga0066903_105023984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 701 | Open in IMG/M |
| 3300005842|Ga0068858_102275864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 536 | Open in IMG/M |
| 3300006038|Ga0075365_11113967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 556 | Open in IMG/M |
| 3300006046|Ga0066652_102071697 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300006049|Ga0075417_10665881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 533 | Open in IMG/M |
| 3300006163|Ga0070715_10326728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 830 | Open in IMG/M |
| 3300006755|Ga0079222_11562802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 623 | Open in IMG/M |
| 3300006797|Ga0066659_10735875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 809 | Open in IMG/M |
| 3300006800|Ga0066660_11159045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 609 | Open in IMG/M |
| 3300006871|Ga0075434_100482362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1261 | Open in IMG/M |
| 3300006881|Ga0068865_100719251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 855 | Open in IMG/M |
| 3300006904|Ga0075424_100052106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 4276 | Open in IMG/M |
| 3300006904|Ga0075424_101884701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 632 | Open in IMG/M |
| 3300009012|Ga0066710_102048922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 845 | Open in IMG/M |
| 3300009038|Ga0099829_11472354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 562 | Open in IMG/M |
| 3300009094|Ga0111539_10269673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1981 | Open in IMG/M |
| 3300009098|Ga0105245_11622231 | Not Available | 699 | Open in IMG/M |
| 3300009101|Ga0105247_11621182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 532 | Open in IMG/M |
| 3300009174|Ga0105241_11653866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 621 | Open in IMG/M |
| 3300009177|Ga0105248_10764504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1090 | Open in IMG/M |
| 3300009553|Ga0105249_11609083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 722 | Open in IMG/M |
| 3300010040|Ga0126308_10678114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 707 | Open in IMG/M |
| 3300010043|Ga0126380_10647150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 841 | Open in IMG/M |
| 3300010077|Ga0127437_155226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 525 | Open in IMG/M |
| 3300010116|Ga0127466_1102689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 526 | Open in IMG/M |
| 3300010323|Ga0134086_10333564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 596 | Open in IMG/M |
| 3300010333|Ga0134080_10494147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 580 | Open in IMG/M |
| 3300010364|Ga0134066_10368510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 538 | Open in IMG/M |
| 3300010371|Ga0134125_12277684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 589 | Open in IMG/M |
| 3300010375|Ga0105239_10687226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1170 | Open in IMG/M |
| 3300010396|Ga0134126_10189797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2466 | Open in IMG/M |
| 3300010396|Ga0134126_11357353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 786 | Open in IMG/M |
| 3300011119|Ga0105246_10498894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1033 | Open in IMG/M |
| 3300012200|Ga0137382_11338962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 504 | Open in IMG/M |
| 3300012353|Ga0137367_10911656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 605 | Open in IMG/M |
| 3300012363|Ga0137390_11282148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 679 | Open in IMG/M |
| 3300012469|Ga0150984_114139220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1692 | Open in IMG/M |
| 3300012489|Ga0157349_1035032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 541 | Open in IMG/M |
| 3300012513|Ga0157326_1046688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 624 | Open in IMG/M |
| 3300012896|Ga0157303_10060938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 807 | Open in IMG/M |
| 3300012897|Ga0157285_10088920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 830 | Open in IMG/M |
| 3300012948|Ga0126375_11134562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 646 | Open in IMG/M |
| 3300012948|Ga0126375_11849880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 528 | Open in IMG/M |
| 3300012972|Ga0134077_10177904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 859 | Open in IMG/M |
| 3300012976|Ga0134076_10272861 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300012987|Ga0164307_10600475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 848 | Open in IMG/M |
| 3300013104|Ga0157370_11021053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 748 | Open in IMG/M |
| 3300013104|Ga0157370_11615723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 582 | Open in IMG/M |
| 3300013105|Ga0157369_10564638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1176 | Open in IMG/M |
| 3300013105|Ga0157369_11168394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 786 | Open in IMG/M |
| 3300013296|Ga0157374_10072484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3249 | Open in IMG/M |
| 3300015357|Ga0134072_10173534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 727 | Open in IMG/M |
| 3300015374|Ga0132255_100348263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2145 | Open in IMG/M |
| 3300017657|Ga0134074_1257174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 629 | Open in IMG/M |
| 3300018056|Ga0184623_10379017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 628 | Open in IMG/M |
| 3300018071|Ga0184618_10263737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 730 | Open in IMG/M |
| 3300018072|Ga0184635_10064685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1423 | Open in IMG/M |
| 3300019361|Ga0173482_10329088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 684 | Open in IMG/M |
| 3300020081|Ga0206354_10418099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1555 | Open in IMG/M |
| 3300022467|Ga0224712_10048100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1645 | Open in IMG/M |
| 3300023069|Ga0247751_1049496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 703 | Open in IMG/M |
| 3300023077|Ga0247802_1064283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 598 | Open in IMG/M |
| 3300025898|Ga0207692_10509449 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300025899|Ga0207642_10464987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 769 | Open in IMG/M |
| 3300025906|Ga0207699_10772198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 706 | Open in IMG/M |
| 3300025911|Ga0207654_10296482 | Not Available | 1098 | Open in IMG/M |
| 3300025921|Ga0207652_10924492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 770 | Open in IMG/M |
| 3300025927|Ga0207687_11907746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 508 | Open in IMG/M |
| 3300025939|Ga0207665_11048579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 649 | Open in IMG/M |
| 3300025940|Ga0207691_10396854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1177 | Open in IMG/M |
| 3300025940|Ga0207691_10560297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 968 | Open in IMG/M |
| 3300025972|Ga0207668_10057756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2709 | Open in IMG/M |
| 3300026023|Ga0207677_10847313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 821 | Open in IMG/M |
| 3300026078|Ga0207702_10874496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 890 | Open in IMG/M |
| 3300026295|Ga0209234_1087092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1184 | Open in IMG/M |
| 3300027725|Ga0209178_1195129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 715 | Open in IMG/M |
| 3300027874|Ga0209465_10361777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 727 | Open in IMG/M |
| 3300027903|Ga0209488_11184666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 515 | Open in IMG/M |
| 3300028379|Ga0268266_10145220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2132 | Open in IMG/M |
| 3300028380|Ga0268265_12715623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 500 | Open in IMG/M |
| 3300028573|Ga0265334_10136942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 869 | Open in IMG/M |
| 3300028707|Ga0307291_1032638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1223 | Open in IMG/M |
| 3300028707|Ga0307291_1101787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 716 | Open in IMG/M |
| 3300028713|Ga0307303_10133927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 587 | Open in IMG/M |
| 3300028717|Ga0307298_10091639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 859 | Open in IMG/M |
| 3300028755|Ga0307316_10199971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 720 | Open in IMG/M |
| 3300028755|Ga0307316_10390028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 515 | Open in IMG/M |
| 3300028768|Ga0307280_10229158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 663 | Open in IMG/M |
| 3300028793|Ga0307299_10360578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 545 | Open in IMG/M |
| 3300028802|Ga0307503_10074666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1374 | Open in IMG/M |
| 3300028814|Ga0307302_10111928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1308 | Open in IMG/M |
| 3300028884|Ga0307308_10023330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2852 | Open in IMG/M |
| 3300030902|Ga0308202_1005828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1543 | Open in IMG/M |
| 3300031096|Ga0308193_1094550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 506 | Open in IMG/M |
| 3300031226|Ga0307497_10509907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 595 | Open in IMG/M |
| 3300031712|Ga0265342_10405206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 704 | Open in IMG/M |
| 3300032770|Ga0335085_12326758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 535 | Open in IMG/M |
| 3300032782|Ga0335082_10719314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 860 | Open in IMG/M |
| 3300034090|Ga0326723_0190987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 906 | Open in IMG/M |
| 3300034659|Ga0314780_194613 | Not Available | 526 | Open in IMG/M |
| 3300034666|Ga0314788_101264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 648 | Open in IMG/M |
| 3300034820|Ga0373959_0028684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1112 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 15.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 7.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.31% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.42% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.42% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.54% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.54% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.65% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.65% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.77% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.77% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.77% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.77% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.77% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.89% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.89% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.89% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.89% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.89% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.89% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918008 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_all | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Host-Associated | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010077 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010116 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012489 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.5.yng.040610 | Environmental | Open in IMG/M |
| 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Host-Associated | Open in IMG/M |
| 3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023069 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S049-202B-5 | Environmental | Open in IMG/M |
| 3300023077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S076-202R-6 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Host-Associated | Open in IMG/M |
| 3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
| 3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031096 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_194 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| 3300034659 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034666 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Bog_all_C_06175150 | 2140918008 | Soil | MLLNLLASAASDSPITHAGKAIGLALGVGLGALGAG |
| JGI10214J12806_106679082 | 3300000891 | Soil | VSALLAATSGDVTKAGKAIGLALGVGLGALGAGVGIGN |
| JGI1027J12803_1089842352 | 3300000955 | Soil | LVAATTGDVTKAGKAIGLALGVGLGALGAGVGIGNI |
| JGI24750J21931_10917441 | 3300002070 | Corn, Switchgrass And Miscanthus Rhizosphere | VLATILAATSGDVTKAGKAVGLALGVGLGAAGAGVGI |
| Ga0062593_1016180222 | 3300004114 | Soil | MLSALIAATTGDVTKAGKAIGLALGVGLGALGAGVGIGNI |
| Ga0070672_1002086351 | 3300005543 | Miscanthus Rhizosphere | VLATILAATTGDVTKAGKAIGIALGVGLGSAGAGVGIGL |
| Ga0058697_104584692 | 3300005562 | Agave | LSTLLAATSGDVTKAGKAIGLALGVGLGAAGAGVG |
| Ga0070664_1005621361 | 3300005564 | Corn Rhizosphere | MLSAFFVLAETTGDVADAGKAIALALGIGLGALGAG |
| Ga0066708_110346882 | 3300005576 | Soil | MYNLLFSAASNSPITHAGKAIGLALGVGLGALGAGV |
| Ga0068856_1000818121 | 3300005614 | Corn Rhizosphere | VLATILAQTSGDVTKAGKAIGIALGVGLGSAGAGVG |
| Ga0068852_1021008702 | 3300005616 | Corn Rhizosphere | LLATVIAATSGDVTKAGKAIGLALGVGLGALGAGVGIGN |
| Ga0066903_1050239841 | 3300005764 | Tropical Forest Soil | MLSSFLVFAEAPVISAGKAIALALGIGLGAAGAGPGIGFIF |
| Ga0068858_1022758642 | 3300005842 | Switchgrass Rhizosphere | MLSALIAATTGDVTDAGKAIGLALGVGLGALGAGV |
| Ga0075365_111139672 | 3300006038 | Populus Endosphere | MLSSFFVLAETTGDVADAGKAIALALGIGLGALGAG |
| Ga0066652_1020716971 | 3300006046 | Soil | MIGYILAATSGDVTKAGKAIGLALGVGLGAAGAGVGI |
| Ga0075417_106658811 | 3300006049 | Populus Rhizosphere | VSALLAATSGDVTKAGKAIGLALGVGLGALGAGVG |
| Ga0070715_103267282 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSALIAATTGDVTKAGKAIGLALGVGLGALGAGVG |
| Ga0079222_115628021 | 3300006755 | Agricultural Soil | MVGYILAATTGDVTKAGKAIGLALGVGLGALGAGVG |
| Ga0066659_107358751 | 3300006797 | Soil | MFNLLASAASNSPITHAGKAIGLALGVGLGALGAGVGI |
| Ga0066660_111590451 | 3300006800 | Soil | MVHLLFSATSDSPITHAGKAIGLALGVGLGALGAGIGIGNI |
| Ga0075434_1004823621 | 3300006871 | Populus Rhizosphere | MLHTVIAATSGDVTKAGKAIALALGIGLGSLGAGVGIG |
| Ga0068865_1007192511 | 3300006881 | Miscanthus Rhizosphere | MLSALIAATTGDVTKAGKAIALALGIGLGALGAGVGIG |
| Ga0075424_1000521067 | 3300006904 | Populus Rhizosphere | VIATVLAATTGDVTKAGKAIGLALGVGLGALGAGV |
| Ga0075424_1018847012 | 3300006904 | Populus Rhizosphere | MLATLIAATSGDVTKAGKAIGLALGVGLGALGAGVGI |
| Ga0066710_1020489222 | 3300009012 | Grasslands Soil | VNALLAATSGDVTKAGKAIGLALGVGLGALGAGVGIGNI |
| Ga0099829_114723541 | 3300009038 | Vadose Zone Soil | VSTTLLAATSGDVEKAGKAIGLALGVGLGALGAGVGIGN |
| Ga0111539_102696731 | 3300009094 | Populus Rhizosphere | MIGYILAATTGDVTKAGKAIGLALGVGLGAAGAGVGI |
| Ga0105245_116222311 | 3300009098 | Miscanthus Rhizosphere | MSALSIVGAVDGNVADAGKAIALALGIGLGSLGAG |
| Ga0105247_116211821 | 3300009101 | Switchgrass Rhizosphere | MLGTIIATTGDVTKAGKAIGLALGVGLGALGAGIGIGNI |
| Ga0105241_116538662 | 3300009174 | Corn Rhizosphere | MNHMLAALIAATTGDVTKAGKAIGLALGVGLGALGAGVGIG |
| Ga0105248_107645041 | 3300009177 | Switchgrass Rhizosphere | VLGTLIAATSGDVTKAGKAIGLALGVGLGALGAGVGI |
| Ga0105249_116090831 | 3300009553 | Switchgrass Rhizosphere | MIGYILAATTGDVTKAGKAIGLALGVGLGAAGAGV |
| Ga0126308_106781141 | 3300010040 | Serpentine Soil | VLTNLIAATSGDVTKAGKAIGLALGVGLGALGAGVGI |
| Ga0126380_106471501 | 3300010043 | Tropical Forest Soil | MAVIQLLAATSGDVTKAGKAIGLALGVGLGALGAGVGI |
| Ga0127437_1552261 | 3300010077 | Grasslands Soil | MHALLATTGDVTKAGKAIALALGIGLGSLGAGIGI |
| Ga0127466_11026891 | 3300010116 | Grasslands Soil | MTMSTLLAATTGDVTKAGKAIGLALGVGLGALGAGVGIGNI |
| Ga0134086_103335641 | 3300010323 | Grasslands Soil | VHTLLAATSGDVTKAGKAIGLALGVGLGALGAGVGI |
| Ga0134080_104941471 | 3300010333 | Grasslands Soil | MHSFLIAAVTGDATKAGKAVALALGIGLGALGAGVG |
| Ga0134066_103685101 | 3300010364 | Grasslands Soil | MSTLSLIAATTGDVTKAGKAIGLALGVGLGALGAGVGIGNI |
| Ga0134125_122776842 | 3300010371 | Terrestrial Soil | MNHMLAALIAATTGDVTKAGKAIGLALGVGLGALGAGVGI |
| Ga0105239_106872263 | 3300010375 | Corn Rhizosphere | MLSAFFVLAETTGDVADAGKAIALALGIGLGALGAGVG |
| Ga0134126_101897976 | 3300010396 | Terrestrial Soil | VLATVLAATSGDVTKAGKAIGLALGVGLGAAGAGVG |
| Ga0134126_113573532 | 3300010396 | Terrestrial Soil | MLSAFFVLAETTGDVADAGKAIALALGIGLGAAGAG |
| Ga0105246_104988941 | 3300011119 | Miscanthus Rhizosphere | VLATILAATSGDVTRAGKAVGLALGVGLGAAGAGVGIGLIFS |
| Ga0137382_113389621 | 3300012200 | Vadose Zone Soil | VLATVLAATSGDVTKAGKAIGLALGVGLGALGAGVGIGNI |
| Ga0137367_109116561 | 3300012353 | Vadose Zone Soil | VVGTLVAATTGDVADAGKAIALALGIGLGALGAGV |
| Ga0137390_112821481 | 3300012363 | Vadose Zone Soil | MLQLLASAASNSPITHAGKAIGLALGVGLGALGAGVGI |
| Ga0150984_1141392204 | 3300012469 | Avena Fatua Rhizosphere | LLATVIAATTGDVTKAGKAIGLALGVGLGALGAGVGI |
| Ga0157349_10350322 | 3300012489 | Unplanted Soil | MLSALIAATTGDVTKAGKAIGLAMGVGLGALGAGIG |
| Ga0157326_10466881 | 3300012513 | Arabidopsis Rhizosphere | VLATVIAATSGDVTKAGKAIGLALGVGLGALGAGVGI |
| Ga0157303_100609382 | 3300012896 | Soil | MIGYILAATTGDVTKAGKAIGLALGVGLGAAGAGVG |
| Ga0157285_100889201 | 3300012897 | Soil | VLATILAATSGDVTKAGKAIGLALGVGLGAAGAGV |
| Ga0126375_111345621 | 3300012948 | Tropical Forest Soil | MNTLSLLAATSGDVTKAGKAIGLALGVGLGALGAGVGI |
| Ga0126375_118498801 | 3300012948 | Tropical Forest Soil | LLATLIAATSGDVTKAGKAIGIALGVGLGSLGAGVGI |
| Ga0134077_101779041 | 3300012972 | Grasslands Soil | MLATLIAATSGDVTKAGKAIGLALGVGLGALGAGVG |
| Ga0134076_102728613 | 3300012976 | Grasslands Soil | MLGYILAATTGDVTKAGKAIGLALGVGLGALGAGVGIGNILAR* |
| Ga0164307_106004752 | 3300012987 | Soil | MAVIQLLAATTGDVTKAGKAIGLALGVGLGALGAGV |
| Ga0157370_110210532 | 3300013104 | Corn Rhizosphere | VLATVLAATTGDVTKAGKAIGLALGVGLGALGAGVGIGNI |
| Ga0157370_116157232 | 3300013104 | Corn Rhizosphere | MLHTVIAAASGDVTKAGKAIALTPGIGLGWLGAAIGIGT |
| Ga0157369_105646381 | 3300013105 | Corn Rhizosphere | MLHTVIAAASGDTVKAGKAIALALGIGLGSLGAGIGI |
| Ga0157369_111683941 | 3300013105 | Corn Rhizosphere | MLATVIAATSGNVADAGKAIALALGIGLGSLGAGIG |
| Ga0157374_100724841 | 3300013296 | Miscanthus Rhizosphere | MLGYILATTGDVTKAGKAVGLALGVGLGALGAGVGIGN |
| Ga0134072_101735342 | 3300015357 | Grasslands Soil | MSTLLAATTGDVTKAGKAIGLALGVGLGALGAGVGI |
| Ga0132255_1003482631 | 3300015374 | Arabidopsis Rhizosphere | MLSAFFVLAETTGDVADAGKAIALAMGIGLGALGA |
| Ga0134074_12571741 | 3300017657 | Grasslands Soil | VLASVIAATSGDVTKAGKAVGLALGVGLGALGAGVGIG |
| Ga0184623_103790172 | 3300018056 | Groundwater Sediment | LLATLIAATSGDVTKAGKAIGLALGVGLGALGAGI |
| Ga0184618_102637371 | 3300018071 | Groundwater Sediment | MVHSLILAAAGDNVKAGKAIALALGIGLGSLGAGI |
| Ga0184635_100646853 | 3300018072 | Groundwater Sediment | VLATILAATSGDVTKAGKAIGLALGVGLGAAGAGVGIGLIFA |
| Ga0173482_103290882 | 3300019361 | Soil | VLGTVLAATTGDVTKAGKAIGLALGVGLGALGAGVGIGNI |
| Ga0206354_104180991 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | MVGYILAQTTGDVTKAGKAIGLALGVGLGALGAGVGI |
| Ga0224712_100481004 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | MIGYILAATTGDVTKAGKAIGLALGVGLGAAGAGVGIGII |
| Ga0247751_10494961 | 3300023069 | Soil | VIATMLAAVDGDVTKAGKAIGLALGVGLGALGAGV |
| Ga0247802_10642832 | 3300023077 | Soil | MLGTIIAATSGDVTKAGKAIGLALGVGLGALGAGIGI |
| Ga0207692_105094491 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MLGYILAATTGDVTKAGKAVGLALGVGLGALGAGVGI |
| Ga0207642_104649872 | 3300025899 | Miscanthus Rhizosphere | MLGTILAATSGDVTKAGKAVGLALGVGLGALGAGVGIGNI |
| Ga0207699_107721981 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VLATVLAATSGDVTKAGKAIGLALGVGLGAAGAGV |
| Ga0207654_102964821 | 3300025911 | Corn Rhizosphere | VLGTVLAATSGDVTKAGKAIGLALGVGLGALGAGVGIGNI |
| Ga0207652_109244922 | 3300025921 | Corn Rhizosphere | MPTLLAATADATVDAAKAIAFALGIGLGALGAGIG |
| Ga0207687_119077461 | 3300025927 | Miscanthus Rhizosphere | VHTLLAATSGDVTKAGKAIGLALGVGLGALGAGVGIG |
| Ga0207665_110485792 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MLATLIAATSGDVTKAGKAIGLALGVGLGALGAGV |
| Ga0207691_103968541 | 3300025940 | Miscanthus Rhizosphere | VLATILAATTGDVTKAGKAIGIALGVGLGSAGAGVGIGLIFSSMIQ |
| Ga0207691_105602973 | 3300025940 | Miscanthus Rhizosphere | MLAALLAATTGDVTKAGKAIGLALGVGLGALGAGVGIG |
| Ga0207668_100577565 | 3300025972 | Switchgrass Rhizosphere | MLSSFFVLAETTGDVADAGKAIALALGIGLGALGAGV |
| Ga0207677_108473132 | 3300026023 | Miscanthus Rhizosphere | MIGYILAATTGDVTKAGKAIGLALGVGLGAAGAGVGIGIIF |
| Ga0207702_108744961 | 3300026078 | Corn Rhizosphere | MVGYILAATTGDVTKAGKAIGLALGVGLGALGAGVGIGNI |
| Ga0209234_10870921 | 3300026295 | Grasslands Soil | MSSLLVAATTGDVTKAGKAIGLALGVGLGALGAGV |
| Ga0209178_11951291 | 3300027725 | Agricultural Soil | VLGTVLAATSGDVTKAGKAIGLALGVGLGALGAGVGIGN |
| Ga0209465_103617771 | 3300027874 | Tropical Forest Soil | MLATIIAATSGDVTKAGKAVGLALGVGLGALGAGVGIGN |
| Ga0209488_111846662 | 3300027903 | Vadose Zone Soil | MLAALLAATTGDVTKAGKAIGLAMGVGLGALGAGI |
| Ga0268266_101452201 | 3300028379 | Switchgrass Rhizosphere | MVGYILAQTTGDVTKAGKAIGLALGVGLGALGAGVGIG |
| Ga0268265_127156232 | 3300028380 | Switchgrass Rhizosphere | VVATILAAVDGDVTKAGKAIGLALGVGLGALGAGI |
| Ga0265334_101369422 | 3300028573 | Rhizosphere | MHLILAATTGDVTKAGKAIGLALGVGLGAAGAGVGIG |
| Ga0307291_10326381 | 3300028707 | Soil | VNTLLAATSGDVTKAGKAIGLALGVGLGALGAGIGI |
| Ga0307291_11017871 | 3300028707 | Soil | VLGTVLAATTGDVTKAGKAIGLALGVGLGALGAGI |
| Ga0307303_101339271 | 3300028713 | Soil | VVATILAAVDGDVTKAGKAIGLALGVGLGALGAGVGI |
| Ga0307298_100916391 | 3300028717 | Soil | MLSTLIAATSGDVTKAGKAIGLALGVGLGALGAGIG |
| Ga0307316_101999711 | 3300028755 | Soil | VLATVLAATTGDVTKAGKAIGLALGVGLGALGAGV |
| Ga0307316_103900281 | 3300028755 | Soil | VVATILAAVDGDVTKAGKAIGLALGVGLGALGAGV |
| Ga0307280_102291581 | 3300028768 | Soil | VLATILAATSGDVTKAGKAIGLALGVGLGAAGAGVGIGLIF |
| Ga0307299_103605781 | 3300028793 | Soil | MLATLIAATSGDVTKAGKAVGLALGVGLGARGAGVGIG |
| Ga0307503_100746663 | 3300028802 | Soil | MHSLLAATTGDVTKAGKAIGLALGVGLGALGAGVGIGNI |
| Ga0307302_101119283 | 3300028814 | Soil | VLATILAATSGDVTKAGKAIGLALGVGLGAAGAGVGIGLIFS |
| Ga0307308_100233301 | 3300028884 | Soil | VLATILAATSGDVTKAGKAIGLALGVGLGALGAGVGIGNI |
| Ga0308202_10058284 | 3300030902 | Soil | VLATILAATSGDVTKAGKAIGLALGVGLGAAGAGVGI |
| Ga0308193_10945502 | 3300031096 | Soil | MLGYILAATTGDVTKAGKAIGLALGVGLGALGAGVGIGN |
| Ga0307497_105099072 | 3300031226 | Soil | MLAALIAATTGDVTKAGKAIGLALGVGLGALGAGVGIGN |
| Ga0265342_104052062 | 3300031712 | Rhizosphere | MHGIILAATTGDVTKAGKAIGLALGVGLGALGAGVG |
| Ga0335085_123267582 | 3300032770 | Soil | MSTLLAATTGDVTKAGKAIGLALGVGLGALGAGVG |
| Ga0335082_107193141 | 3300032782 | Soil | MFSLLLSAASNSPITHAGKAIGLALGVGLGALGAGV |
| Ga0326723_0190987_3_113 | 3300034090 | Peat Soil | VIAAVLAATTGDVTKAGKAIGLALGVGLGALGAGVGI |
| Ga0314780_194613_421_525 | 3300034659 | Soil | VLAAIAILAQVEGDVTKAGKAIGLALGVGLGATGA |
| Ga0314788_101264_3_116 | 3300034666 | Soil | MATLQLLFATTGDVTKAGKAIGLALGVGLGALGAGVGI |
| Ga0373959_0028684_1_105 | 3300034820 | Rhizosphere Soil | MLATVLAATSGDVTKAGKAIGLALGVGLGAAGAGV |
| ⦗Top⦘ |