| Basic Information | |
|---|---|
| Family ID | F083300 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 43 residues |
| Representative Sequence | RWRYQPGSLTRELAEKLAALAEVTDRLPQPVRVPPGEEFVA |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 92.04 % |
| % of genes from short scaffolds (< 2000 bps) | 83.19 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (66.372 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (10.620 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.779 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.212 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.29% β-sheet: 0.00% Coil/Unstructured: 79.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF01381 | HTH_3 | 13.27 |
| PF13393 | tRNA-synt_His | 13.27 |
| PF00005 | ABC_tran | 11.50 |
| PF00528 | BPD_transp_1 | 6.19 |
| PF13444 | Acetyltransf_5 | 6.19 |
| PF01553 | Acyltransferase | 3.54 |
| PF00171 | Aldedh | 2.65 |
| PF01966 | HD | 1.77 |
| PF16321 | Ribosom_S30AE_C | 1.77 |
| PF00575 | S1 | 1.77 |
| PF13419 | HAD_2 | 0.88 |
| PF00587 | tRNA-synt_2b | 0.88 |
| PF00069 | Pkinase | 0.88 |
| PF03030 | H_PPase | 0.88 |
| PF02735 | Ku | 0.88 |
| PF09821 | AAA_assoc_C | 0.88 |
| PF02661 | Fic | 0.88 |
| PF00378 | ECH_1 | 0.88 |
| PF00221 | Lyase_aromatic | 0.88 |
| PF01416 | PseudoU_synth_1 | 0.88 |
| PF01713 | Smr | 0.88 |
| PF13432 | TPR_16 | 0.88 |
| PF10543 | ORF6N | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.54 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 2.65 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 2.65 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 2.65 |
| COG0101 | tRNA U38,U39,U40 pseudouridine synthase TruA | Translation, ribosomal structure and biogenesis [J] | 0.88 |
| COG1273 | Non-homologous end joining protein Ku, dsDNA break repair | Replication, recombination and repair [L] | 0.88 |
| COG2986 | Histidine ammonia-lyase | Amino acid transport and metabolism [E] | 0.88 |
| COG3808 | Na+ or H+-translocating membrane pyrophosphatase | Energy production and conversion [C] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 66.37 % |
| Unclassified | root | N/A | 33.63 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459005|F1BAP7Q01CTZDF | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300001661|JGI12053J15887_10351199 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 713 | Open in IMG/M |
| 3300004091|Ga0062387_101568930 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300005166|Ga0066674_10410862 | Not Available | 625 | Open in IMG/M |
| 3300005167|Ga0066672_10013279 | All Organisms → cellular organisms → Bacteria | 4070 | Open in IMG/M |
| 3300005337|Ga0070682_100221091 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1348 | Open in IMG/M |
| 3300005343|Ga0070687_101445749 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300005436|Ga0070713_100160165 | All Organisms → cellular organisms → Bacteria | 2008 | Open in IMG/M |
| 3300005445|Ga0070708_101024075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 774 | Open in IMG/M |
| 3300005458|Ga0070681_10700020 | Not Available | 929 | Open in IMG/M |
| 3300005468|Ga0070707_100822806 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300005534|Ga0070735_10555955 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300005541|Ga0070733_10377432 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300005546|Ga0070696_100224492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1411 | Open in IMG/M |
| 3300005554|Ga0066661_10894074 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300005556|Ga0066707_10396692 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 898 | Open in IMG/M |
| 3300005557|Ga0066704_10180370 | All Organisms → cellular organisms → Bacteria | 1424 | Open in IMG/M |
| 3300005563|Ga0068855_102512196 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300005764|Ga0066903_105635561 | Not Available | 659 | Open in IMG/M |
| 3300005944|Ga0066788_10006046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2461 | Open in IMG/M |
| 3300005993|Ga0080027_10316359 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300006028|Ga0070717_10437115 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
| 3300006047|Ga0075024_100532702 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300006163|Ga0070715_10781619 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300006176|Ga0070765_100496333 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
| 3300006854|Ga0075425_102515568 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_2_20CM_55_8 | 570 | Open in IMG/M |
| 3300006854|Ga0075425_102909660 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300006903|Ga0075426_10914512 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300007255|Ga0099791_10159112 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1057 | Open in IMG/M |
| 3300009092|Ga0105250_10407904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 604 | Open in IMG/M |
| 3300009093|Ga0105240_10443617 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1454 | Open in IMG/M |
| 3300009174|Ga0105241_10246176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1514 | Open in IMG/M |
| 3300009174|Ga0105241_10255437 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1488 | Open in IMG/M |
| 3300009698|Ga0116216_10620924 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300009700|Ga0116217_10125255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1735 | Open in IMG/M |
| 3300010320|Ga0134109_10259327 | Not Available | 658 | Open in IMG/M |
| 3300010359|Ga0126376_10279961 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_2_20CM_55_8 | 1438 | Open in IMG/M |
| 3300010379|Ga0136449_101596396 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 991 | Open in IMG/M |
| 3300010401|Ga0134121_12505898 | Not Available | 558 | Open in IMG/M |
| 3300011269|Ga0137392_11243068 | Not Available | 603 | Open in IMG/M |
| 3300011444|Ga0137463_1351292 | Not Available | 530 | Open in IMG/M |
| 3300012096|Ga0137389_10079538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2558 | Open in IMG/M |
| 3300012209|Ga0137379_10246353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1700 | Open in IMG/M |
| 3300012210|Ga0137378_11099849 | Not Available | 710 | Open in IMG/M |
| 3300012210|Ga0137378_11339352 | Not Available | 631 | Open in IMG/M |
| 3300012224|Ga0134028_1191900 | Not Available | 639 | Open in IMG/M |
| 3300012363|Ga0137390_10580626 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1090 | Open in IMG/M |
| 3300012377|Ga0134029_1084641 | Not Available | 587 | Open in IMG/M |
| 3300012403|Ga0134049_1105921 | Not Available | 630 | Open in IMG/M |
| 3300012405|Ga0134041_1069162 | Not Available | 611 | Open in IMG/M |
| 3300012918|Ga0137396_10151158 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1690 | Open in IMG/M |
| 3300012929|Ga0137404_10131275 | All Organisms → cellular organisms → Bacteria | 2061 | Open in IMG/M |
| 3300012929|Ga0137404_11885369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_2_20CM_55_8 | 556 | Open in IMG/M |
| 3300012930|Ga0137407_10177079 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1901 | Open in IMG/M |
| 3300012971|Ga0126369_13164631 | Not Available | 539 | Open in IMG/M |
| 3300012986|Ga0164304_10151266 | All Organisms → cellular organisms → Bacteria | 1462 | Open in IMG/M |
| 3300012987|Ga0164307_11470612 | Not Available | 575 | Open in IMG/M |
| 3300013307|Ga0157372_10436075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1527 | Open in IMG/M |
| 3300014157|Ga0134078_10416598 | Not Available | 606 | Open in IMG/M |
| 3300014495|Ga0182015_10817960 | Not Available | 585 | Open in IMG/M |
| 3300015199|Ga0167647_1061970 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1010 | Open in IMG/M |
| 3300015357|Ga0134072_10344648 | Not Available | 570 | Open in IMG/M |
| 3300017955|Ga0187817_10710295 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
| 3300017961|Ga0187778_10165199 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1401 | Open in IMG/M |
| 3300017975|Ga0187782_10040847 | All Organisms → cellular organisms → Bacteria | 3376 | Open in IMG/M |
| 3300018012|Ga0187810_10411787 | Not Available | 569 | Open in IMG/M |
| 3300018027|Ga0184605_10333598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_2_20CM_55_8 | 685 | Open in IMG/M |
| 3300018034|Ga0187863_10151216 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1295 | Open in IMG/M |
| 3300018046|Ga0187851_10544528 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
| 3300018064|Ga0187773_10891271 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300018085|Ga0187772_10399008 | Not Available | 957 | Open in IMG/M |
| 3300019278|Ga0187800_1304803 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
| 3300019879|Ga0193723_1086574 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 894 | Open in IMG/M |
| 3300019881|Ga0193707_1164476 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_2_20CM_55_8 | 605 | Open in IMG/M |
| 3300020580|Ga0210403_11494650 | Not Available | 508 | Open in IMG/M |
| 3300020581|Ga0210399_11609639 | Not Available | 500 | Open in IMG/M |
| 3300021170|Ga0210400_10867789 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 738 | Open in IMG/M |
| 3300021170|Ga0210400_10891396 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 726 | Open in IMG/M |
| 3300021171|Ga0210405_10291208 | Not Available | 1291 | Open in IMG/M |
| 3300021405|Ga0210387_11186629 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
| 3300021407|Ga0210383_10707575 | Not Available | 866 | Open in IMG/M |
| 3300021433|Ga0210391_10418908 | Not Available | 1051 | Open in IMG/M |
| 3300021433|Ga0210391_10986082 | Not Available | 656 | Open in IMG/M |
| 3300022533|Ga0242662_10191130 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
| 3300022722|Ga0242657_1156300 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300025854|Ga0209176_10064429 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 831 | Open in IMG/M |
| 3300025911|Ga0207654_10073343 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2040 | Open in IMG/M |
| 3300025911|Ga0207654_10433991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 919 | Open in IMG/M |
| 3300025912|Ga0207707_10628232 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 907 | Open in IMG/M |
| 3300025928|Ga0207700_10873896 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 805 | Open in IMG/M |
| 3300025939|Ga0207665_10054749 | All Organisms → cellular organisms → Bacteria | 2691 | Open in IMG/M |
| 3300025941|Ga0207711_11415480 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300026297|Ga0209237_1011634 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5221 | Open in IMG/M |
| 3300026497|Ga0257164_1076699 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_2_20CM_55_8 | 561 | Open in IMG/M |
| 3300027047|Ga0208730_1001916 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1846 | Open in IMG/M |
| 3300027548|Ga0209523_1007516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1930 | Open in IMG/M |
| 3300027625|Ga0208044_1018386 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2530 | Open in IMG/M |
| 3300027915|Ga0209069_10233474 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 950 | Open in IMG/M |
| 3300028381|Ga0268264_12025768 | Not Available | 585 | Open in IMG/M |
| 3300031708|Ga0310686_117151778 | Not Available | 615 | Open in IMG/M |
| 3300031715|Ga0307476_10529636 | Not Available | 873 | Open in IMG/M |
| 3300031820|Ga0307473_10122192 | All Organisms → cellular organisms → Bacteria | 1431 | Open in IMG/M |
| 3300032770|Ga0335085_11723073 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300032783|Ga0335079_12192521 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.62% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.73% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 6.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.31% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 4.42% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.54% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.54% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.65% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.65% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.65% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.65% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.77% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.77% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.77% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.77% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.89% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.89% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.89% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.89% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.89% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.89% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.89% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.89% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.89% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.89% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012224 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012377 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012403 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012405 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300015199 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-2c, rock/snow interface) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025854 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
| 3300027047 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes) | Environmental | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E41_04135660 | 2170459005 | Grass Soil | TGNYHWRYQAGSLTHDLAERLANLAEVTDRLPQPVSLPPSEDFIA |
| JGI1027J12803_1008093011 | 3300000955 | Soil | RGGNWRWRLQPGALTPGLAKKMALLAEVSDRLPEPPPQPADHDFAA* |
| JGI12053J15887_103511992 | 3300001661 | Forest Soil | SVTDGNFRWRYQPGSLTRALAEKLAALAEVTDRVPPSMPVPRDEDFAA* |
| Ga0062387_1015689302 | 3300004091 | Bog Forest Soil | RWRYQPGSLTQQLAGRLAGLAEVTDRLPPAVPAPPAEDFSA* |
| Ga0066674_104108621 | 3300005166 | Soil | LNTPSKHDGNYHWRMQPGSLTRELADKLSRLAEVTDRLPQPVPVQNEEDFMA* |
| Ga0066672_100132796 | 3300005167 | Soil | WRLQPGALTQELAAKLARLAEVTDRLPQPLPVPPEEEFAA* |
| Ga0070682_1002210911 | 3300005337 | Corn Rhizosphere | VSEGNFLWRYQPGSLTRALAEKLAALAEVTDRVPPPMPVPQDEDFAA* |
| Ga0070687_1014457492 | 3300005343 | Switchgrass Rhizosphere | YEGNYHWRYQPGSLTRNLSEKLAALAEVTDRLPQRVPLPAEEDFAA* |
| Ga0070709_100243235 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | NWRWRLQPGVLTPELAKKMAALAEVTDRSPEPLPEPPAEEFAA* |
| Ga0070713_1001601652 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | WRWRLRPGALTQGLAEKMALLAEVTDRLPQPVPVPPEEDFAA* |
| Ga0070708_1010240752 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LNTPSVHDGNYRWRYQPGSPTRHMAEKLAILAEVTDRLPQPVPIPSGEDFAA* |
| Ga0070681_107000202 | 3300005458 | Corn Rhizosphere | FLWRYQPGSLTRALAEKLAALAEVTDRVPPPMPVPQDEDFAA* |
| Ga0070707_1008228062 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | IHEGNYRWRYQPGVLTRDLAEKLAQLAEVTDRLPQPVPVPPSEDFAA* |
| Ga0070735_105559551 | 3300005534 | Surface Soil | KTGNYHWRYQPGSLTRDLVNRLANLAEVTDRLPQPVSMPPGEDFVA* |
| Ga0070733_103774322 | 3300005541 | Surface Soil | RLNTPSVKTGNYLWRCQPGSLTPSLAERLVNLAEVTDRLPQPVSVPSSEDFIA* |
| Ga0070696_1002244922 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | TPSVSEGNFRWRYQPGSLTRALAEKLAALAEVTDRVPPPMPVPPDEEFGA* |
| Ga0066661_108940742 | 3300005554 | Soil | RLNTPSVCEGNFRWRYSPGLLTGALAEKLAALAAVTDRLPQHFPPPPSEDFVA* |
| Ga0066707_103966921 | 3300005556 | Soil | EGNYHWRYQPGSLTRNLSEKLAALAEVTDRLPQPVPLPAEEDFAA* |
| Ga0066704_101803703 | 3300005557 | Soil | GNWRWRLQPGALTQELAAKLAQLAEVTDRLPQPLPVPPEEEFAA* |
| Ga0068855_1025121962 | 3300005563 | Corn Rhizosphere | NALQSYMAERLAQIAEVTDRLPTPAPIPPNEDFVA* |
| Ga0066903_1056355611 | 3300005764 | Tropical Forest Soil | GSLTRELAERLARLAELTDRLPDPVPLPTGQDFVA* |
| Ga0066788_100060461 | 3300005944 | Soil | ALTPQLAERLATLAEVTDRLPPPVPLPPSQVFVA* |
| Ga0080027_103163591 | 3300005993 | Prmafrost Soil | TEGNYHWRYQPGSLTPELAQRLADLAEVTDRLPKAINERQGENFPA* |
| Ga0070717_104371151 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | PGAYTPKMAEELAKLAEVTDRLPQPLPMPPEEEFSA* |
| Ga0075024_1005327022 | 3300006047 | Watersheds | RLQPGVLTQELTAKLALLAEVTDRLPQPIPEPPAEEFAA* |
| Ga0070715_107816193 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | ALTQKLAAKLARLAEVTDRLPQPLPVPAEEEFAA* |
| Ga0070765_1004963332 | 3300006176 | Soil | PSVPNGNFRWRYQPGVLTPGLAERLATLAVVTDRLAPPVPLPSGEDFVA* |
| Ga0075425_1025155682 | 3300006854 | Populus Rhizosphere | WRYQPGSLTRNLSEKLAALAEVTDRLPQRVPLPAEEDFAA* |
| Ga0075425_1029096602 | 3300006854 | Populus Rhizosphere | NGNFLWRYQLGSLTRELSDKLAALAEVSDRLPSVVPAPPAEEFVA* |
| Ga0075426_109145122 | 3300006903 | Populus Rhizosphere | NTPSVSEGNFRWRYQPGSLTRALAEKLAALAEVTDRVPPPMPVPHDEDFAA* |
| Ga0099791_101591121 | 3300007255 | Vadose Zone Soil | NYHWRYQPGSLTRNLSEKLAALAEVTDRLPQPVPPPAEEDFAA* |
| Ga0105250_104079041 | 3300009092 | Switchgrass Rhizosphere | GRLNTPSVTDGNFRWRYQPASLTSALAEKLAALAEVTDRVPPPMLVPRDEEFAA* |
| Ga0105240_104436171 | 3300009093 | Corn Rhizosphere | NFRWRYQPGSLTRALAEKLAALAEVTDRVPPPMPVPQHEDFAA* |
| Ga0105241_102461761 | 3300009174 | Corn Rhizosphere | VSEGNFRWRYQPGSLTRALAEKLAALAEVTDRVPPPMPVPHDEDFAA* |
| Ga0105241_102554371 | 3300009174 | Corn Rhizosphere | VSEGNFRWRYQPGSLTRALAEKLAALAEVTDRVPPPMPVPQHEDFAA* |
| Ga0116216_106209242 | 3300009698 | Peatlands Soil | VANGSFRWRYQPGSLTRELADRLERLDEVTERTPKPMPAPPGEDFSA* |
| Ga0116217_101252551 | 3300009700 | Peatlands Soil | NYLWRYQPGSLTPALAAKLASLAEVTDRLPQPLPVPPSEDFAA* |
| Ga0126380_112284741 | 3300010043 | Tropical Forest Soil | WRWRLQPGALMPELAKEMAALSEVTDRSPESLPEPSTEEFAA* |
| Ga0134109_102593272 | 3300010320 | Grasslands Soil | SLTRELADKLSRLAEVTDRLPQPIQVPTEQDFFA* |
| Ga0126376_101762042 | 3300010359 | Tropical Forest Soil | QPGSLTPELAEKMADLSEVTDRSPEPLPEPPAEEFAA* |
| Ga0126376_102799614 | 3300010359 | Tropical Forest Soil | YHWRYQPGSLKPELAEKLARIAEVTDRLPQPVAQPAPEDFVA* |
| Ga0126372_104655301 | 3300010360 | Tropical Forest Soil | PGSLTPELAEKMADLSEVTDRSPEPLPEPPAEEFAA* |
| Ga0136449_1015963961 | 3300010379 | Peatlands Soil | GSFRWRYQPGSLTRDLAERLASLAEVTDRLPPPVLVPLVEDFAA* |
| Ga0134121_125058981 | 3300010401 | Terrestrial Soil | PGSLTDRLAEKLAALATVTDRLPSHVLPPPSEDFAA* |
| Ga0137392_112430681 | 3300011269 | Vadose Zone Soil | RWRYQPGSLTRHMAEKLAILAEVTDRLPQPVPIPPGEDFAA* |
| Ga0137463_13512921 | 3300011444 | Soil | GNFRWRYQPGSLTRALAEKLAALAEVTDRVPPPMPVPQDEEFAA* |
| Ga0137389_100795384 | 3300012096 | Vadose Zone Soil | LNTPSVSEGNFRWRYQPGSLTRALAEKLAALAAVTDRLPPHVLPPPSEDFVA* |
| Ga0137379_102463531 | 3300012209 | Vadose Zone Soil | PEGSLRPELADKLAALAEVTDRLPELIPVPSHADFFA* |
| Ga0137378_110998491 | 3300012210 | Vadose Zone Soil | RLNTPSKHDGNYHWRMQPGSLTRELADKLSRLAEVTDRLPRPIQLPTEQEFFA* |
| Ga0137378_113393521 | 3300012210 | Vadose Zone Soil | RLNTPSKHDGNYHWRMQPGSLTRELADKLSRLAEVTDRLPQPVPVQNEEDFMA* |
| Ga0134028_11919001 | 3300012224 | Grasslands Soil | GKHDGNYHWRMQPGSLTRELADKLSRLAEVTDRLPRPIQLPTEQEFFA* |
| Ga0137390_105806261 | 3300012363 | Vadose Zone Soil | HWRYLPGSLKSELAEKLAALAEVTDRVPESFPVRVPEDFVA* |
| Ga0134029_10846411 | 3300012377 | Grasslands Soil | HDGNYHWRMQPGSLTRELADKLSRLAEVTDRLPRPIQLPTEQEFFA* |
| Ga0134049_11059212 | 3300012403 | Grasslands Soil | YHWRMQPGSLTRELAEKLARLAEVTDRLPQPIQLPTEQEFFA* |
| Ga0134041_10691622 | 3300012405 | Grasslands Soil | QPGSLTRELADKLSRLAEVTDRLPRPIQLPTEQEFFA* |
| Ga0137396_101511581 | 3300012918 | Vadose Zone Soil | PGALNPGLAAKLAHLAEVTDRLPEPIAALGPDEFVA* |
| Ga0137404_101312751 | 3300012929 | Vadose Zone Soil | MQPGSLTRELADKLSRLAEVTDRLPQPVPVQNEEDFMA* |
| Ga0137404_118853692 | 3300012929 | Vadose Zone Soil | NTPSHHEGNYHWRYQPGSLTRALSEKLAALAEVTDRLPQHVPLLPEEDFAA* |
| Ga0137407_101770791 | 3300012930 | Vadose Zone Soil | STINGNFLWRFKPGSLTRELSEKLAALAEVSDRLPTSMPVPQAEEFVA* |
| Ga0126369_131646312 | 3300012971 | Tropical Forest Soil | NTPSTHEGNYRWRMQPGSLMPAVRDKLAQLAEVCDRLPQPVPVPSKDNFVA* |
| Ga0164304_101512661 | 3300012986 | Soil | IGNYHWRCQPGSLKAELAQKLASLAEVTDRLPHPKPL* |
| Ga0164307_114706122 | 3300012987 | Soil | NFRWRYQPGSLTPALATKLAALAEVTDRVRTPMPVPEDEDFAA* |
| Ga0164305_121512902 | 3300012989 | Soil | QPGVLTSDLAKKMASLSEVADRLPQPLPQPPAEEFAA* |
| Ga0157372_104360751 | 3300013307 | Corn Rhizosphere | TPSVSEGNFRWRYQPGSLTRALAEKLAALAEVTDRVPPPMPVPQHEDFAA* |
| Ga0134078_104165982 | 3300014157 | Grasslands Soil | YHWRMQPGSLTRELADKLSRLAEVTDRLPQPVPVQNEEDFMA* |
| Ga0182015_108179602 | 3300014495 | Palsa | WRYQPGSLDHSLAERLANLAEVTDRLPQPVPEPPNEDFVA* |
| Ga0167647_10619701 | 3300015199 | Glacier Forefield Soil | NYHWRFQAGSLTKKLAEQLAALAEVTDRLPAKIPIPPNENFAA* |
| Ga0134072_103446482 | 3300015357 | Grasslands Soil | WRMQPGSFTRDLADKLARLAEVTDRLPQPVPVQNEEDFMA* |
| Ga0187817_107102951 | 3300017955 | Freshwater Sediment | SVANGSFRWRYQPGSLTRELADRLACLAEVTDRTPPPMPSPPAEDFAA |
| Ga0187778_101651994 | 3300017961 | Tropical Peatland | GSLKPELAQKLAALAEVTDRLPQPVRVPPSEEFLA |
| Ga0187782_100408471 | 3300017975 | Tropical Peatland | AGSLTPSLAEKLANLAEVTDRLPQPVPVPADEGFVA |
| Ga0187810_104117872 | 3300018012 | Freshwater Sediment | HWRYLPGSLTRDLAERLASLAELTDRLPPPVPVPPAEDFAA |
| Ga0184605_103335982 | 3300018027 | Groundwater Sediment | TPSRHEGNYHWRYQPGSLTHNLSEKLAALAEVTDRLPQPVPLPAEEDFAA |
| Ga0187863_101512162 | 3300018034 | Peatland | HGNYHWRMQPGALTSQMAEKLANLAEVTDRLPQPVPIPPAEDFIA |
| Ga0187851_105445281 | 3300018046 | Peatland | FRWRMASGSLTPALAEKLADLAEVTDRLPQKTPVPADEGFVA |
| Ga0187773_108912712 | 3300018064 | Tropical Peatland | RWRYQPGSLTRELAEKLAALAEVTDRLPQPVRVPPGEEFVA |
| Ga0187772_103990082 | 3300018085 | Tropical Peatland | FNIPSTKQGNFRWRYAEGSLARPLAEKLAALAEVTDRLPQAFPGPPDEEFAA |
| Ga0187800_13048032 | 3300019278 | Peatland | GNFHWRFQADALTRPLAEKLANLAEVTDRIPQPVPVPPSENFAA |
| Ga0193723_10865741 | 3300019879 | Soil | QPGSLTRNLSEKLAALAEVTDRLPQPVPVPKEEDFAA |
| Ga0193707_11644761 | 3300019881 | Soil | GNYHWRYQPGSLTRNLSEKLAALAEVTDRLPQPVPLPKEEDFAT |
| Ga0210403_114946502 | 3300020580 | Soil | VKTGNYLWRCKPGALTRDLAQHLSRLAEVADRLPQPVSVPPGEDFVA |
| Ga0210399_116096391 | 3300020581 | Soil | GNWRWRFSLAQITPELIAKLAQLAELTDRLPQPLSVRPDEDFAA |
| Ga0210400_108677891 | 3300021170 | Soil | FQPGALTPALAAKLASLAEVTDRLPQPLTIPRAEEWVA |
| Ga0210400_108913962 | 3300021170 | Soil | SVKTGNYLWRYQPGALTRERAERLANLAAVTDRLPQPVSVPPAEEFVA |
| Ga0210405_102912082 | 3300021171 | Soil | PGLLTPNLAERLANLAEVTDRLPQPVTVPSSEGFIA |
| Ga0210387_111866292 | 3300021405 | Soil | EPGSLTRDLSERLANLAEVTDRLPQPVSLPASEDFIA |
| Ga0210383_107075751 | 3300021407 | Soil | LNIPSVASGNFRWRFQPDALTGDLAQRLATLAEVTDRLPQPVPAPPNEDFAA |
| Ga0210391_104189082 | 3300021433 | Soil | SVTNGNYRWRYQPGSLTRELAERLASLAEVADRQAQSVPVPPEEDFVA |
| Ga0210391_109860822 | 3300021433 | Soil | KTCNYLWRYQPGLLTPNLAERLANLAEVTDRLPQPVTVPSSEGFIA |
| Ga0242662_101911302 | 3300022533 | Soil | GALTPALAAKLASLAEVTDRLPQLLTIPRAEEWVA |
| Ga0242657_11563002 | 3300022722 | Soil | RWRYQRGALTPALAAKLALLAEVTDRLPQPLPVPPDETFVA |
| Ga0209176_100644291 | 3300025854 | Arctic Peat Soil | TGNYRWRYQPGSLTPQLAERLASLAEVTDRLPPAVSVPPNEDFAA |
| Ga0207654_100733433 | 3300025911 | Corn Rhizosphere | SVSEGNFRWRYQPGSLTRALAEKLAALAEVTDRVPPPMPVPHDEDFAA |
| Ga0207654_104339911 | 3300025911 | Corn Rhizosphere | SVSEGNFRWRYQPGSLTRALAEKLAALAEVTDRVPPPMPVPQHEDFAA |
| Ga0207707_106282322 | 3300025912 | Corn Rhizosphere | GNFLWRYQPGSLTRALAEKLAALAEVTDRVPPPMPVPQDEDFAA |
| Ga0207700_108738962 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | RPGALTQGLAEKMALLAEVTDRLPQPVPVPPEEDFAA |
| Ga0207665_100547494 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | GSLKDALAQKLAALATVTDRLPPHVLPPPSEDFVA |
| Ga0207711_114154801 | 3300025941 | Switchgrass Rhizosphere | TPSTSVGNYLWRFQPNALQSYMAERLAQIAEVTDRLPTPAPIPPNEDFVA |
| Ga0209237_10116348 | 3300026297 | Grasslands Soil | KHDGNYHWRMQPGSLTRELADKLSRLAEVTDRLPRPIQLPTEQEFFA |
| Ga0257164_10766991 | 3300026497 | Soil | RWRYQPGSLTRALAEKLAALAAVTDRLPPHVLPPPSEDFVA |
| Ga0208730_10019161 | 3300027047 | Forest Soil | RLQPGALTQELAAKLARLAEVTDRLPQPLPVPPEEEFAA |
| Ga0209523_10075161 | 3300027548 | Forest Soil | PGALTQELAAKLALLAEVTDRLPQPLPVPGQEEFAA |
| Ga0208044_10183861 | 3300027625 | Peatlands Soil | QPGSLTAALAEKLANLAEVTDRVPQPLPVPPSEHFIA |
| Ga0209069_102334742 | 3300027915 | Watersheds | RWRLKPGVLTQELTAKLALLAEVTDRLPQPIPEPPAEEFAA |
| Ga0268264_120257682 | 3300028381 | Switchgrass Rhizosphere | RLNTPSVTDGNFRWRYQPASLTSALAEKLAALAEVTDRVPPPMLVPRDEEFAA |
| Ga0310686_1171517782 | 3300031708 | Soil | WRYQPGSLTRELAERLASLAEVSDRLPQPVSVPPTEDFVA |
| Ga0307476_105296361 | 3300031715 | Hardwood Forest Soil | PGSLTHSLAERLANLAEVTDRLPQPVPKPPSEDFIA |
| Ga0307473_101221924 | 3300031820 | Hardwood Forest Soil | HWRMQPRSLTRELAEKLARLAEVTDRLPQPIQVPMEQDFFA |
| Ga0306925_100501271 | 3300031890 | Soil | KEVGNYHWRCAPGMLTAPLAEKLAALAEVADRLPQPFAVPPDEPFLA |
| Ga0307471_1010352691 | 3300032180 | Hardwood Forest Soil | GGNWRWRLQPGVLTPELAKQMAALAEVTDRLPEPLPEPPAEEFAA |
| Ga0335085_117230732 | 3300032770 | Soil | YRWRLQSGALTSALAAKLASMAEVTDRLPQALPVPADEPFAA |
| Ga0335079_109013232 | 3300032783 | Soil | VGNYHWRYQPGSLKPELAQKLAALAEVSDRLPPPVRVPPSEEFLA |
| Ga0335079_121925211 | 3300032783 | Soil | KWRFEASALTSELAEKLAQLAEVTDRLPQPAKPQKDEDFAA |
| ⦗Top⦘ |