| Basic Information | |
|---|---|
| Family ID | F083292 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 43 residues |
| Representative Sequence | EYELTRWLRLRTNVLQGSSTQQQLFQRMQGSGVDLLFFFSY |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 94.69 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.460 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere (8.850 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.708 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (58.407 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.52% β-sheet: 0.00% Coil/Unstructured: 43.48% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF01568 | Molydop_binding | 70.80 |
| PF00929 | RNase_T | 3.54 |
| PF01161 | PBP | 2.65 |
| PF00465 | Fe-ADH | 0.88 |
| PF07681 | DoxX | 0.88 |
| PF01850 | PIN | 0.88 |
| PF01019 | G_glu_transpept | 0.88 |
| PF12146 | Hydrolase_4 | 0.88 |
| PF02537 | CRCB | 0.88 |
| PF06039 | Mqo | 0.88 |
| PF03551 | PadR | 0.88 |
| PF04972 | BON | 0.88 |
| PF00499 | Oxidored_q3 | 0.88 |
| PF00573 | Ribosomal_L4 | 0.88 |
| PF04357 | TamB | 0.88 |
| PF07992 | Pyr_redox_2 | 0.88 |
| PF00936 | BMC | 0.88 |
| PF13532 | 2OG-FeII_Oxy_2 | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG1881 | Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) family | General function prediction only [R] | 2.65 |
| COG0088 | Ribosomal protein L4 | Translation, ribosomal structure and biogenesis [J] | 0.88 |
| COG0239 | Fluoride ion exporter CrcB/FEX, affects chromosome condensation | Cell cycle control, cell division, chromosome partitioning [D] | 0.88 |
| COG0337 | 3-dehydroquinate synthetase | Amino acid transport and metabolism [E] | 0.88 |
| COG0371 | Glycerol dehydrogenase or related enzyme, iron-containing ADH family | Energy production and conversion [C] | 0.88 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.88 |
| COG0579 | L-2-hydroxyglutarate oxidase LhgO | Carbohydrate transport and metabolism [G] | 0.88 |
| COG0839 | NADH:ubiquinone oxidoreductase subunit 6 (chain J) | Energy production and conversion [C] | 0.88 |
| COG1454 | Alcohol dehydrogenase, class IV | Energy production and conversion [C] | 0.88 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.88 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.88 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.88 |
| COG1979 | Alcohol dehydrogenase YqhD, Fe-dependent ADH family | Energy production and conversion [C] | 0.88 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.88 |
| COG2911 | Phospholipid transport to the outer membrane protein TamB | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.46 % |
| Unclassified | root | N/A | 3.54 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004156|Ga0062589_101632408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
| 3300004157|Ga0062590_102398826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
| 3300004463|Ga0063356_103559128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 671 | Open in IMG/M |
| 3300004479|Ga0062595_101399711 | Not Available | 637 | Open in IMG/M |
| 3300005172|Ga0066683_10180566 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1301 | Open in IMG/M |
| 3300005187|Ga0066675_10592086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 833 | Open in IMG/M |
| 3300005334|Ga0068869_100653985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 892 | Open in IMG/M |
| 3300005335|Ga0070666_10018039 | All Organisms → cellular organisms → Bacteria | 4531 | Open in IMG/M |
| 3300005335|Ga0070666_11134925 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
| 3300005353|Ga0070669_101444344 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300005355|Ga0070671_100902738 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 772 | Open in IMG/M |
| 3300005456|Ga0070678_102198288 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300005457|Ga0070662_100246423 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1435 | Open in IMG/M |
| 3300005529|Ga0070741_11638332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300005540|Ga0066697_10806999 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300005548|Ga0070665_102521390 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300005552|Ga0066701_10098400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1705 | Open in IMG/M |
| 3300005576|Ga0066708_10064482 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2089 | Open in IMG/M |
| 3300005615|Ga0070702_100633687 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 806 | Open in IMG/M |
| 3300005617|Ga0068859_102803425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300005719|Ga0068861_102118492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
| 3300005764|Ga0066903_103979063 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 792 | Open in IMG/M |
| 3300005834|Ga0068851_10837933 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
| 3300005843|Ga0068860_100506336 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1206 | Open in IMG/M |
| 3300006046|Ga0066652_100589369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1047 | Open in IMG/M |
| 3300006163|Ga0070715_10910995 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300006163|Ga0070715_10915101 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300006581|Ga0074048_13290189 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1643 | Open in IMG/M |
| 3300006852|Ga0075433_10793582 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 827 | Open in IMG/M |
| 3300006852|Ga0075433_11950204 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300006854|Ga0075425_101313848 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 820 | Open in IMG/M |
| 3300006871|Ga0075434_101193279 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 773 | Open in IMG/M |
| 3300006871|Ga0075434_102263964 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300006871|Ga0075434_102388302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
| 3300006904|Ga0075424_101988976 | Not Available | 613 | Open in IMG/M |
| 3300006954|Ga0079219_10420636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 896 | Open in IMG/M |
| 3300009012|Ga0066710_100947336 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1327 | Open in IMG/M |
| 3300009137|Ga0066709_103297034 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300009156|Ga0111538_13753565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300009162|Ga0075423_13130874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300009176|Ga0105242_11769375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
| 3300009176|Ga0105242_12276647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300009177|Ga0105248_11126066 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 887 | Open in IMG/M |
| 3300009551|Ga0105238_10933434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 887 | Open in IMG/M |
| 3300009553|Ga0105249_12455772 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300010362|Ga0126377_10372932 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1430 | Open in IMG/M |
| 3300010366|Ga0126379_11038789 | Not Available | 925 | Open in IMG/M |
| 3300010371|Ga0134125_12480319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300010398|Ga0126383_11405418 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 788 | Open in IMG/M |
| 3300010401|Ga0134121_10298672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1425 | Open in IMG/M |
| 3300011119|Ga0105246_12222564 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300012208|Ga0137376_11418563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300012212|Ga0150985_106471443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
| 3300012212|Ga0150985_111457755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300012212|Ga0150985_112794371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 992 | Open in IMG/M |
| 3300012212|Ga0150985_121531749 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300012356|Ga0137371_10301694 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
| 3300012469|Ga0150984_106091098 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300012906|Ga0157295_10140688 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300012924|Ga0137413_11260294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300012948|Ga0126375_11029246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
| 3300012961|Ga0164302_10860636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 691 | Open in IMG/M |
| 3300013297|Ga0157378_12083131 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
| 3300013306|Ga0163162_13001615 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300013307|Ga0157372_13471255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300013308|Ga0157375_10673047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1190 | Open in IMG/M |
| 3300013308|Ga0157375_13562610 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300014157|Ga0134078_10173972 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 862 | Open in IMG/M |
| 3300015372|Ga0132256_101017160 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 944 | Open in IMG/M |
| 3300018060|Ga0187765_10210148 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1129 | Open in IMG/M |
| 3300018067|Ga0184611_1270894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
| 3300018073|Ga0184624_10510426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300018422|Ga0190265_10726163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1115 | Open in IMG/M |
| 3300018476|Ga0190274_12206406 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 648 | Open in IMG/M |
| 3300019362|Ga0173479_10266932 | Not Available | 762 | Open in IMG/M |
| 3300022713|Ga0242677_1068406 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300023073|Ga0247744_1070712 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300025893|Ga0207682_10348808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
| 3300025899|Ga0207642_10065565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1707 | Open in IMG/M |
| 3300025905|Ga0207685_10097299 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
| 3300025923|Ga0207681_11289439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300025924|Ga0207694_10962766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 722 | Open in IMG/M |
| 3300025925|Ga0207650_11462514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
| 3300025930|Ga0207701_11642067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300025932|Ga0207690_10529826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 956 | Open in IMG/M |
| 3300025936|Ga0207670_10200026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1517 | Open in IMG/M |
| 3300025942|Ga0207689_10505825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1012 | Open in IMG/M |
| 3300025960|Ga0207651_11177605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 688 | Open in IMG/M |
| 3300025972|Ga0207668_11083704 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 718 | Open in IMG/M |
| 3300025986|Ga0207658_11596960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
| 3300026035|Ga0207703_10508849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1131 | Open in IMG/M |
| 3300026118|Ga0207675_101979584 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300026301|Ga0209238_1146620 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 729 | Open in IMG/M |
| 3300026523|Ga0209808_1043236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2098 | Open in IMG/M |
| 3300027910|Ga0209583_10393392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
| 3300028380|Ga0268265_11585453 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 659 | Open in IMG/M |
| 3300028381|Ga0268264_10137845 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2172 | Open in IMG/M |
| 3300028381|Ga0268264_10678933 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1021 | Open in IMG/M |
| 3300028381|Ga0268264_11762145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| 3300028803|Ga0307281_10224435 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300031226|Ga0307497_10265560 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300031366|Ga0307506_10410065 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
| 3300031716|Ga0310813_11843076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300031740|Ga0307468_102436964 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300031751|Ga0318494_10424226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 773 | Open in IMG/M |
| 3300031764|Ga0318535_10114180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1190 | Open in IMG/M |
| 3300031846|Ga0318512_10586320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300031847|Ga0310907_10024426 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2098 | Open in IMG/M |
| 3300031858|Ga0310892_10964481 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
| 3300032059|Ga0318533_10387055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1020 | Open in IMG/M |
| 3300032076|Ga0306924_10270431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1952 | Open in IMG/M |
| 3300032180|Ga0307471_100065254 | All Organisms → cellular organisms → Bacteria | 3103 | Open in IMG/M |
| 3300034149|Ga0364929_0322870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 8.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 7.96% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.42% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.54% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.54% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 3.54% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.65% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.77% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.77% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.77% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.77% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.77% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.89% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.89% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.89% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.89% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.89% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.89% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300022713 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023073 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S154-409C-5 | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062589_1016324081 | 3300004156 | Soil | ELTRWLRFRTKIVQGSFTQPQMFQKIETSGVDLLFFFSY* |
| Ga0062590_1023988262 | 3300004157 | Soil | GQTNLILEYELTNWLRLRTNMIQGNATQQSLFQRNQGSGVDLLFFFSY* |
| Ga0063356_1035591282 | 3300004463 | Arabidopsis Thaliana Rhizosphere | QTNLILEYELTRWLRLRTNVLQGSPSQASMFQRAQGSGADLLFFFSY* |
| Ga0062595_1013997111 | 3300004479 | Soil | YELTKWLRFRTNVMQGSSTQTQLFQRQPGSGADLLFFFGY* |
| Ga0066683_101805661 | 3300005172 | Soil | ILEYELTKWLRFQTNLLQGSSTQQSIFQRAQGSGFNLLFFFSY* |
| Ga0066675_105920861 | 3300005187 | Soil | NFILEYELTKWLRLRTNVLQGSSTQASLFQRQQGSGADLLFFFSY* |
| Ga0068869_1006539851 | 3300005334 | Miscanthus Rhizosphere | NFIVEYELTRWLRFRTKIVQGSFTQPQMFQKIETSGVDLLFFFSY* |
| Ga0070666_100180391 | 3300005335 | Switchgrass Rhizosphere | ETNFILEYELTRWLRLRTNMLQGSGTQQQLFQRAQGSGADLLFFFSY* |
| Ga0070666_111349252 | 3300005335 | Switchgrass Rhizosphere | TNFILEYELTNWLRFRTNVLQGSSAQAQMFRRMQGSGADLLFFFSY* |
| Ga0070669_1014443442 | 3300005353 | Switchgrass Rhizosphere | LEYELAKWLRLRTNWLQGSTTQPMIFQRTQDSGLDLLFFFTR* |
| Ga0070671_1009027381 | 3300005355 | Switchgrass Rhizosphere | EYELTKWLRLRTNVLQGSTTQANLFQRQQGSGADLLFFFSY* |
| Ga0070678_1021982881 | 3300005456 | Miscanthus Rhizosphere | NETNFILEYELTRWLRLRTNMLQGSGTQQQLFQRAQGSGADLLFFFSY* |
| Ga0070662_1002464232 | 3300005457 | Corn Rhizosphere | LEYELTRWLRLRTNVLQGTPNQSSVFQRLQGSGADLLFFFSY* |
| Ga0070741_116383321 | 3300005529 | Surface Soil | TKWLRLRTNVLQGSSTQAQLFQRMQGSGVDLLFFFSY* |
| Ga0066697_108069992 | 3300005540 | Soil | TKWLRLRTNVLQGSSTQMNLFQRQQGSGADLLFFFSY* |
| Ga0070665_1025213901 | 3300005548 | Switchgrass Rhizosphere | EYELTRWLRLRTNVLQGTANQRSVFQRAQGSGVDLLFFFTY* |
| Ga0066701_100984001 | 3300005552 | Soil | LTKWLRLRTNVLQGSSTQQQLFQRLQGSGADLLFFFNY* |
| Ga0066708_100644821 | 3300005576 | Soil | LEYELTKWLRLRTNVLQGSSTQASLFQRQQGSGADLLFFFSY* |
| Ga0070702_1006336872 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | ELATWLRLQTNVMQSSSTQQQLFQRMQGSGVDLLFFFSY* |
| Ga0068859_1028034251 | 3300005617 | Switchgrass Rhizosphere | YELTNWLRLQTNVLQGSNTQQMLFQRAHGTGIDLLFFFSY* |
| Ga0068861_1021184922 | 3300005719 | Switchgrass Rhizosphere | LILEYELTNWLRLRTNVIQGNATQQSLFQRAQGSGLDLLFFFSY* |
| Ga0066903_1039790631 | 3300005764 | Tropical Forest Soil | LRFRTNVLQGSPSQTQLFQRSQSTGLDLLFFFSY* |
| Ga0068851_108379332 | 3300005834 | Corn Rhizosphere | VNQTNLILEYELTKWLRLRTNVLQGSTTQANLFQRQQGSGADLLFFFSY* |
| Ga0068860_1005063361 | 3300005843 | Switchgrass Rhizosphere | SQTNFILEYELTRWLRLRSNVLQGSSNQQLLFQRAQGSGADLLFFFSY* |
| Ga0066652_1005893691 | 3300006046 | Soil | SQTNFIVEYELARWVRLQTNVVQGSSTQQQLFQRAQGSGVDLLFFFSY* |
| Ga0070715_109109952 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | AKWLRLRTNWLQGSNAQPLLFQKTQDSGVDLLFTFTH* |
| Ga0070715_109151012 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | QTNFILEYELAKWLRLRTNVLQGSSTQASLFQRQQGSGADLLFFFSY* |
| Ga0074048_132901892 | 3300006581 | Soil | FEYELTRWLRLRTNVLQGSATQQVQFQRVQGSGADLLFFFSY* |
| Ga0075433_107935821 | 3300006852 | Populus Rhizosphere | KWLRLQTNVLQGASTQQNVFQRMQASGADLLFFFSY* |
| Ga0075433_119502041 | 3300006852 | Populus Rhizosphere | NFIMEYELSKWLRFRTNVLQGSSTQTQLFQRQAGSGADLLFFFGF* |
| Ga0075425_1013138481 | 3300006854 | Populus Rhizosphere | LQKWLRLRTNVIQGSSTQQQLFQRVQGSGVDLLFFFSY* |
| Ga0075434_1011932792 | 3300006871 | Populus Rhizosphere | ILEYELTKWLRFRTNVLEGSTTQQQLFQRMQGSGADVLFFFSY* |
| Ga0075434_1022639641 | 3300006871 | Populus Rhizosphere | LNKWLRLQTNLVQGSTTQQQLFQRMQGSGVDLLFFFSY* |
| Ga0075434_1023883022 | 3300006871 | Populus Rhizosphere | YLNIEQGIGDQSQTNVVLEYELQRWLRLQTNFTQGTQQHQLFQRVKGSGVDLLFFFSY* |
| Ga0075424_1019889761 | 3300006904 | Populus Rhizosphere | YELTRWLRFRTNVLQGSSTQAQLFQRMQGSGFDLLFFFSY* |
| Ga0079219_104206361 | 3300006954 | Agricultural Soil | TNWLRFRTNVLQGSATQQNLFQRAQGSGADLLFFFSY* |
| Ga0066710_1009473361 | 3300009012 | Grasslands Soil | KWLRLRTNVLQGASTQAQLFQRMQGSGADLLFFFSY |
| Ga0066709_1032970342 | 3300009137 | Grasslands Soil | YELTKWLRLQTNLLQGSSTQQSLFQRAQGSGFDLLFLFSY* |
| Ga0111538_137535651 | 3300009156 | Populus Rhizosphere | QRWLRLRTNVLQGSPVQQQLFQRMQGSGVDLLFFFSY* |
| Ga0075423_131308742 | 3300009162 | Populus Rhizosphere | LEYELAKWLRLQTNMLQGSSTQLHPFQRIQGSGADLLFFFSY* |
| Ga0105242_117693752 | 3300009176 | Miscanthus Rhizosphere | EQIIGQQAQTNFIVEYELTRWLRFRTKIVQGSFTQPQMFQKVETSGVDLLFFFSY* |
| Ga0105242_122766471 | 3300009176 | Miscanthus Rhizosphere | YELTRWLRLRTNVLQGSATQQVQFQRVQGSSADLLFFFSY* |
| Ga0105248_111260661 | 3300009177 | Switchgrass Rhizosphere | TRWLRLRTNVLQGANSQPLFQRVQDSGVDLLFFFSY* |
| Ga0105238_109334341 | 3300009551 | Corn Rhizosphere | NFILEYELTRWLRLRTNVLQGANSQPLFQRVQDSGVDLLFFFSY* |
| Ga0105249_124557723 | 3300009553 | Switchgrass Rhizosphere | VLEYELQRWLRLQTNFVQGTQQHQLFQRVKGSGVDLLFFFSY* |
| Ga0126377_103729323 | 3300010362 | Tropical Forest Soil | WLRLRTNVLQGASTQQNVFQRLQGSGADLLFFFSY* |
| Ga0126379_110387892 | 3300010366 | Tropical Forest Soil | LEYELTKWLRFRTNMLQGASTQSQLFQRQQGSGADLLFFFGF* |
| Ga0134125_124803191 | 3300010371 | Terrestrial Soil | ILEYELTKWLRLQTNVLQGSSTQQLFQRMQGSGVDLLFFFSF* |
| Ga0126383_114054181 | 3300010398 | Tropical Forest Soil | ELTTWLRFRTNVLQGSSTQANLFQRAQGSGADVLFFFSY* |
| Ga0134121_102986721 | 3300010401 | Terrestrial Soil | EIGQTNFILEYELAKWLRLRTNVLQGSSTQANLFQRQQGSGADLLFFFSY* |
| Ga0105246_122225641 | 3300011119 | Miscanthus Rhizosphere | TNIILEYELAEWLRLRTNWLQGSNAQPLMFQRAQDSGVDLLFFFTR* |
| Ga0137376_114185631 | 3300012208 | Vadose Zone Soil | KWLRLQTNVLQGSNTQQQLFQRMQGSGIDLLFFFSY* |
| Ga0150985_1064714432 | 3300012212 | Avena Fatua Rhizosphere | RLRLRTNVLQGSSTTQQQMFQRAQDSGADLVFFFSY* |
| Ga0150985_1114577552 | 3300012212 | Avena Fatua Rhizosphere | WLRLRTNVLQGSSTTQQLFQRAQGSGVDLLFFFSY* |
| Ga0150985_1127943711 | 3300012212 | Avena Fatua Rhizosphere | LEYELAKWLRLRTNVLQGSSTQQQLFQRAQGSGADLLFFFSY* |
| Ga0150985_1215317491 | 3300012212 | Avena Fatua Rhizosphere | KWLRLRTNWLQGSNAQPLLFQRTQDSGLDLLFTFSR* |
| Ga0137371_103016942 | 3300012356 | Vadose Zone Soil | LRFRTNVLQGSSTQQQLFQRMQGSGADLLFFFSY* |
| Ga0150984_1060910982 | 3300012469 | Avena Fatua Rhizosphere | AKWLRLRTNVLQGSSTQQQLFQRAQGSGADLLFFFSY* |
| Ga0157295_101406883 | 3300012906 | Soil | LILEYELTNWLRLRTNVIQGNATQQSLFQRAQGSGADLLFFFSY* |
| Ga0137413_112602942 | 3300012924 | Vadose Zone Soil | EQAVGGSSQTNFILEYELTRWLRLRTNVLQGANSQPLFQRVQDTGVDLLFFFSY* |
| Ga0126375_110292461 | 3300012948 | Tropical Forest Soil | TQTNFIVEYELTKWLRLRTNFTQGSFTQQQLFQKVQSSGVDLLFFFSY* |
| Ga0164302_108606361 | 3300012961 | Soil | TNWLRFRTNVLQGSSAQAQMFRRMQGSGADLLFFFSY* |
| Ga0157378_120831312 | 3300013297 | Miscanthus Rhizosphere | EQGIGELNSTSFILEYELTNWMRLRTNIVQGTTTQTLFRRAQDSGGDIIFFFSY* |
| Ga0163162_130016151 | 3300013306 | Switchgrass Rhizosphere | YELTKWLRLQTNVLQGSNTQQQLFQRMQGSGADLLFFFSY* |
| Ga0157372_134712552 | 3300013307 | Corn Rhizosphere | YELTKWLRMRTNVLQGSTTQAQLFQRMQGSGVDLLFFFSY* |
| Ga0157375_106730471 | 3300013308 | Miscanthus Rhizosphere | QMLGQQSQTNFIVEYELTRWLRFRTKIVQGSFTQPQMFQKVETSGVDLLFFFSY* |
| Ga0157375_135626101 | 3300013308 | Miscanthus Rhizosphere | TTNFILEYEFAKWLRLRTNWLQGSNAQPLLFQKTQDSGVDLLFTFTH* |
| Ga0134078_101739722 | 3300014157 | Grasslands Soil | TNFILEYELTKWLRFQANLIQGATTQLSIFQRLQSSGADLIFLFSY* |
| Ga0132256_1010171601 | 3300015372 | Arabidopsis Rhizosphere | VLEYELLKWLRIRTNVLQGASTQAQLFQRMQGSGADLLFFFSY* |
| Ga0187765_102101482 | 3300018060 | Tropical Peatland | FVLEYELAEWLRLQTNVLQGSATQQQLFQRMQGSGADLLFYFTF |
| Ga0184611_12708941 | 3300018067 | Groundwater Sediment | TNFIVEYELTRWLRFRTKIVQGSFTQPQMFQKVETSGVDLLFFFSY |
| Ga0184624_105104262 | 3300018073 | Groundwater Sediment | QMIGQQSQTNFIVEYELTRWLRFRTKIVQGSFTQPQMFQKVETSGVDLLFFFSY |
| Ga0190265_107261631 | 3300018422 | Soil | TNFILEYELADWLRLQTNVVEGSSTNPSIFRRAQGTGADLIFFFSY |
| Ga0190274_122064062 | 3300018476 | Soil | QGTTNLILEYELTNWLRMQTNVVQGSSNNPSLFRRAQSTGGDLLFFFSY |
| Ga0173479_102669322 | 3300019362 | Soil | YELSKWLRFRTNVLQGSSTQTQLFQRQAGSGADLLFFFGF |
| Ga0242677_10684061 | 3300022713 | Soil | NFILEYELARWLRLRTNVLEGSSAQQQLFQRAQGSGADLIFFFSY |
| Ga0247744_10707122 | 3300023073 | Soil | VEQGVGDQAQTNVVLEYELQRWLRLQTNFKQGAQQQQLFQRVQGSGIDLLFFFSY |
| Ga0207682_103488081 | 3300025893 | Miscanthus Rhizosphere | DQNQTNLILEYELTRWLRLRTNVLQGTPNQSSVFQRLQGSGADLLFFFSY |
| Ga0207642_100655652 | 3300025899 | Miscanthus Rhizosphere | TNFILEYELTRWLRLRTNVLQGANSQPLFQRVQDSGVDLLFFFSY |
| Ga0207685_100972994 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | IAKWLRLRTNWLQGSNAQPLLFQRTQDSGLDLLFTFSR |
| Ga0207681_112894391 | 3300025923 | Switchgrass Rhizosphere | YELTNWLRLRTNVIQGNATQQSLFQRAQGSGADLLFFFSY |
| Ga0207694_109627662 | 3300025924 | Corn Rhizosphere | QAVGGNSQTNFILEYELTRWLRLRTNVLQGANSQPLFQRVQDSGVDLLFFFSY |
| Ga0207650_114625142 | 3300025925 | Switchgrass Rhizosphere | LTRWLRLRTNVIQGVPTQQSMFQRAQGSGADLLFFFSY |
| Ga0207701_116420672 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | LQRWLRLQTNFTQGTQQHQLFQRVKGSGVDLLFFFSY |
| Ga0207690_105298262 | 3300025932 | Corn Rhizosphere | ELTKWLRLRTNVLQGSTTQANLFQRQQGSGADLLFFFSY |
| Ga0207670_102000262 | 3300025936 | Switchgrass Rhizosphere | IVEYELTRWLRFRTKIVQGSFTQPQMFQKIETSGVDLLFFFSY |
| Ga0207689_105058251 | 3300025942 | Miscanthus Rhizosphere | QSQTNFILEDELTNWLRLQTNVLQGSNTQQSLFQRAQGSGADLLFFFSY |
| Ga0207651_111776051 | 3300025960 | Switchgrass Rhizosphere | ILEYELTNWLRLQTNVLQGSNTQQMLFQRAHGTGIDLLFFFSY |
| Ga0207668_110837042 | 3300025972 | Switchgrass Rhizosphere | ELNKWLRLQTNMLQGSSNQQQLFQKMQGSGVDLFFFFSY |
| Ga0207658_115969602 | 3300025986 | Switchgrass Rhizosphere | TRWLRLRTNVLQGSSTQQQLFQRAQGSGVDLLFFFSY |
| Ga0207703_105088491 | 3300026035 | Switchgrass Rhizosphere | KWLRLRSNIVQGSSTQQQLFQRVQGTGADLLFFFSY |
| Ga0207675_1019795842 | 3300026118 | Switchgrass Rhizosphere | EYELTRWLRFRTKIVQGSFTQPQMFQKVETSGVDLLFFFSY |
| Ga0209238_11466202 | 3300026301 | Grasslands Soil | FVLEYELLKWLRLRTNVLQGSSTQAQLFQRMQGSGADLLFFFNY |
| Ga0209808_10432361 | 3300026523 | Soil | LEYELTKWLRLRTNVLQGSSTQASLFQRQQGSGADLLFFFSY |
| Ga0209583_103933921 | 3300027910 | Watersheds | LMLEYELTKWLRFRTNVQQGSSTQQQLFQRSQGSGVDLLFIFSY |
| Ga0268265_115854532 | 3300028380 | Switchgrass Rhizosphere | YELTRWLRFRTKIVQGSFTQPQMFQKIETSGVDLLFFFSY |
| Ga0268264_101378452 | 3300028381 | Switchgrass Rhizosphere | ELAKWLRLRTNWLQGSTTQPMIFQRTQDSGLDLLFFFTR |
| Ga0268264_106789331 | 3300028381 | Switchgrass Rhizosphere | ILEYELSKWLRFRTNVLQGSSTQTQLFQRQSGSGADLLFFFGF |
| Ga0268264_117621452 | 3300028381 | Switchgrass Rhizosphere | EYELTRWLRLRTNVLQGSSTQQQLFQRMQGSGVDLLFFFSY |
| Ga0307281_102244352 | 3300028803 | Soil | EFAKWLRLRTNWLQGANAQPLLFQKTQDSGVDLLFTFTH |
| Ga0307497_102655601 | 3300031226 | Soil | EFAKWLRLRTNWLQGSNAQPLLFQKTQDSGVDLLFTFTH |
| Ga0307506_104100651 | 3300031366 | Soil | WLRLRTNFLQGTSTQPSLFQRAQGSGADLLFFFSY |
| Ga0310813_118430761 | 3300031716 | Soil | GQSGTNFILEYELTRWLRLRTNVLQGSSTQQQLFQRAQGSGADLLFFFSY |
| Ga0307468_1024369641 | 3300031740 | Hardwood Forest Soil | FVLEYELTKWLRLQTNLLQGSSTQQSLFQRAQGSGFDLLFLFSY |
| Ga0318494_104242261 | 3300031751 | Soil | EYELTRWLRFRTNYLQGSSAQTQLFQRTQSSGVDVLFFFSY |
| Ga0318535_101141802 | 3300031764 | Soil | SQTNLVLEYELTRWLRFRTNYLQGSSAQTQLFQRTQSSGVDVLFFFSY |
| Ga0318512_105863201 | 3300031846 | Soil | YELTRWLRLRTNMLQGSSTQQQQFQRAQGSGADLLFFFSY |
| Ga0310907_100244261 | 3300031847 | Soil | FILEYELTKWLRLRTNVLQGSSTQTQLFQRQAGSGADLLFFFGF |
| Ga0310892_109644812 | 3300031858 | Soil | GDQSSTNFILEYELTQWMRLQTNVLQNSNVQQQMFRPIHGTGVDLLFFLSY |
| Ga0318533_103870552 | 3300032059 | Soil | GQTNLVLEYELTRWLRFRTNYLQGSSAQTQLFQRTQSSGVDVLFFFSY |
| Ga0306924_102704311 | 3300032076 | Soil | NIILEYELTGWLRFRTNMLQGSSTQQSLFQRAQSSGADLLFLFNY |
| Ga0307471_1000652541 | 3300032180 | Hardwood Forest Soil | AKWLRLRTNVLQGSSTQASLFQRQQGSGADLLFFFSY |
| Ga0364929_0322870_410_529 | 3300034149 | Sediment | ELTRWLRFRTKIVQGSFTQPQMFQKVETSGVDLLFFFSY |
| ⦗Top⦘ |