Metagenome / Metatranscriptome Family F083292

Overview

Basic Information

• Family ID: F083292
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 113
• Average Sequence Length: 43 residues
• Representative Sequence: EYELTRWLRLRTNVLQGSSTQQQLFQRMQGSGVDLLFFFSY
• Number of Associated Samples: 101
• Number of Associated Scaffolds: 113

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 0.00 %
• % of genes near scaffold ends (potentially truncated): 100.00 %
• % of genes from short scaffolds (< 2000 bps): 94.69 %
• Associated GOLD sequencing projects: 94
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.32

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (96.460 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere (8.850 % of family members)
• Environment Ontology (ENVO): Unclassified (40.708 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant rhizosphere (58.407 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 56.52%
  β-sheet: 0.00%
  Coil/Unstructured: 43.48%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 113 Family Scaffolds
PF01568	Molydop_binding	70.80
PF00929	RNase_T	3.54
PF01161	PBP	2.65
PF00465	Fe-ADH	0.88
PF07681	DoxX	0.88
PF01850	PIN	0.88
PF01019	G_glu_transpept	0.88
PF12146	Hydrolase_4	0.88
PF02537	CRCB	0.88
PF06039	Mqo	0.88
PF03551	PadR	0.88
PF04972	BON	0.88
PF00499	Oxidored_q3	0.88
PF00573	Ribosomal_L4	0.88
PF04357	TamB	0.88
PF07992	Pyr_redox_2	0.88
PF00936	BMC	0.88
PF13532	2OG-FeII_Oxy_2	0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 113 Family Scaffolds
COG1881	Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) family	General function prediction only [R]	2.65
COG0088	Ribosomal protein L4	Translation, ribosomal structure and biogenesis [J]	0.88
COG0239	Fluoride ion exporter CrcB/FEX, affects chromosome condensation	Cell cycle control, cell division, chromosome partitioning [D]	0.88
COG0337	3-dehydroquinate synthetase	Amino acid transport and metabolism [E]	0.88
COG0371	Glycerol dehydrogenase or related enzyme, iron-containing ADH family	Energy production and conversion [C]	0.88
COG0405	Gamma-glutamyltranspeptidase	Amino acid transport and metabolism [E]	0.88
COG0579	L-2-hydroxyglutarate oxidase LhgO	Carbohydrate transport and metabolism [G]	0.88
COG0839	NADH:ubiquinone oxidoreductase subunit 6 (chain J)	Energy production and conversion [C]	0.88
COG1454	Alcohol dehydrogenase, class IV	Energy production and conversion [C]	0.88
COG1695	DNA-binding transcriptional regulator, PadR family	Transcription [K]	0.88
COG1733	DNA-binding transcriptional regulator, HxlR family	Transcription [K]	0.88
COG1846	DNA-binding transcriptional regulator, MarR family	Transcription [K]	0.88
COG1979	Alcohol dehydrogenase YqhD, Fe-dependent ADH family	Energy production and conversion [C]	0.88
COG2259	Uncharacterized membrane protein YphA, DoxX/SURF4 family	Function unknown [S]	0.88
COG2911	Phospholipid transport to the outer membrane protein TamB	Cell wall/membrane/envelope biogenesis [M]	0.88
COG4270	Uncharacterized membrane protein	Function unknown [S]	0.88

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	96.46 %
Unclassified	root	N/A	3.54 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	96.46 %
Unclassified	root	N/A	3.54 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	96.46 %
Unclassified	root	N/A	3.54 %

Level 4

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	84.96 %
Unclassified	root	N/A	3.54 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.88 %

Level 5

Name	Rank	Taxonomy	Distribution
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	76.99 %
Unclassified	root	N/A	3.54 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.88 %

Level 6

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	76.99 %
Unclassified	root	N/A	3.54 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.88 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300004156|Ga0062589_101632408	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	640
3300004157|Ga0062590_102398826	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	557
3300004463|Ga0063356_103559128	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	671
3300004479|Ga0062595_101399711	Not Available	637
3300005172|Ga0066683_10180566	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1301
3300005187|Ga0066675_10592086	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	833
3300005334|Ga0068869_100653985	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	892
3300005335|Ga0070666_10018039	All Organisms → cellular organisms → Bacteria	4531
3300005335|Ga0070666_11134925	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	581
3300005353|Ga0070669_101444344	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	597
3300005355|Ga0070671_100902738	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	772
3300005456|Ga0070678_102198288	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	523
3300005457|Ga0070662_100246423	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1435
3300005529|Ga0070741_11638332	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	526
3300005540|Ga0066697_10806999	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	510
3300005548|Ga0070665_102521390	All Organisms → cellular organisms → Bacteria → Acidobacteria	516
3300005552|Ga0066701_10098400	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1705
3300005576|Ga0066708_10064482	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2089
3300005615|Ga0070702_100633687	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	806
3300005617|Ga0068859_102803425	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	535
3300005719|Ga0068861_102118492	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	562
3300005764|Ga0066903_103979063	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	792
3300005834|Ga0068851_10837933	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	573
3300005843|Ga0068860_100506336	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1206
3300006046|Ga0066652_100589369	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1047
3300006163|Ga0070715_10910995	All Organisms → cellular organisms → Bacteria	542
3300006163|Ga0070715_10915101	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	541
3300006581|Ga0074048_13290189	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1643
3300006852|Ga0075433_10793582	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	827
3300006852|Ga0075433_11950204	All Organisms → cellular organisms → Bacteria → Acidobacteria	503
3300006854|Ga0075425_101313848	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	820
3300006871|Ga0075434_101193279	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	773
3300006871|Ga0075434_102263964	All Organisms → cellular organisms → Bacteria	547
3300006871|Ga0075434_102388302	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	531
3300006904|Ga0075424_101988976	Not Available	613
3300006954|Ga0079219_10420636	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	896
3300009012|Ga0066710_100947336	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1327
3300009137|Ga0066709_103297034	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	587
3300009156|Ga0111538_13753565	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	526
3300009162|Ga0075423_13130874	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	507
3300009176|Ga0105242_11769375	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	656
3300009176|Ga0105242_12276647	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	588
3300009177|Ga0105248_11126066	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	887
3300009551|Ga0105238_10933434	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	887
3300009553|Ga0105249_12455772	All Organisms → cellular organisms → Bacteria → Acidobacteria	594
3300010362|Ga0126377_10372932	All Organisms → cellular organisms → Bacteria → Acidobacteria	1430
3300010366|Ga0126379_11038789	Not Available	925
3300010371|Ga0134125_12480319	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	564
3300010398|Ga0126383_11405418	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	788
3300010401|Ga0134121_10298672	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1425
3300011119|Ga0105246_12222564	All Organisms → cellular organisms → Bacteria → Acidobacteria	534
3300012208|Ga0137376_11418563	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	585
3300012212|Ga0150985_106471443	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	647
3300012212|Ga0150985_111457755	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	565
3300012212|Ga0150985_112794371	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	992
3300012212|Ga0150985_121531749	All Organisms → cellular organisms → Bacteria	1222
3300012356|Ga0137371_10301694	All Organisms → cellular organisms → Bacteria	1247
3300012469|Ga0150984_106091098	All Organisms → cellular organisms → Bacteria	762
3300012906|Ga0157295_10140688	All Organisms → cellular organisms → Bacteria	712
3300012924|Ga0137413_11260294	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	592
3300012948|Ga0126375_11029246	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	673
3300012961|Ga0164302_10860636	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	691
3300013297|Ga0157378_12083131	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	618
3300013306|Ga0163162_13001615	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	542
3300013307|Ga0157372_13471255	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	501
3300013308|Ga0157375_10673047	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1190
3300013308|Ga0157375_13562610	All Organisms → cellular organisms → Bacteria	518
3300014157|Ga0134078_10173972	All Organisms → cellular organisms → Bacteria → Acidobacteria	862
3300015372|Ga0132256_101017160	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	944
3300018060|Ga0187765_10210148	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1129
3300018067|Ga0184611_1270894	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	596
3300018073|Ga0184624_10510426	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	522
3300018422|Ga0190265_10726163	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1115
3300018476|Ga0190274_12206406	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	648
3300019362|Ga0173479_10266932	Not Available	762
3300022713|Ga0242677_1068406	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	553
3300023073|Ga0247744_1070712	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	595
3300025893|Ga0207682_10348808	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	697
3300025899|Ga0207642_10065565	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1707
3300025905|Ga0207685_10097299	All Organisms → cellular organisms → Bacteria	1252
3300025923|Ga0207681_11289439	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	613
3300025924|Ga0207694_10962766	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	722
3300025925|Ga0207650_11462514	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	581
3300025930|Ga0207701_11642067	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	516
3300025932|Ga0207690_10529826	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	956
3300025936|Ga0207670_10200026	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1517
3300025942|Ga0207689_10505825	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1012
3300025960|Ga0207651_11177605	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	688
3300025972|Ga0207668_11083704	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	718
3300025986|Ga0207658_11596960	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	596
3300026035|Ga0207703_10508849	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1131
3300026118|Ga0207675_101979584	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	600
3300026301|Ga0209238_1146620	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	729
3300026523|Ga0209808_1043236	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2098
3300027910|Ga0209583_10393392	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	658
3300028380|Ga0268265_11585453	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	659
3300028381|Ga0268264_10137845	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2172
3300028381|Ga0268264_10678933	All Organisms → cellular organisms → Bacteria → Acidobacteria	1021
3300028381|Ga0268264_11762145	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	629
3300028803|Ga0307281_10224435	All Organisms → cellular organisms → Bacteria	683
3300031226|Ga0307497_10265560	All Organisms → cellular organisms → Bacteria	773
3300031366|Ga0307506_10410065	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	557
3300031716|Ga0310813_11843076	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	569
3300031740|Ga0307468_102436964	All Organisms → cellular organisms → Bacteria → Acidobacteria	511
3300031751|Ga0318494_10424226	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	773
3300031764|Ga0318535_10114180	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1190
3300031846|Ga0318512_10586320	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	568
3300031847|Ga0310907_10024426	All Organisms → cellular organisms → Bacteria → Acidobacteria	2098
3300031858|Ga0310892_10964481	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	599
3300032059|Ga0318533_10387055	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1020
3300032076|Ga0306924_10270431	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1952
3300032180|Ga0307471_100065254	All Organisms → cellular organisms → Bacteria	3103
3300034149|Ga0364929_0322870	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	531

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	51.33%
Host-Associated	Host-Associated	48.67%

Class

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	48.67%
Plants	Host-Associated → Plants	48.67%
Aquatic	Environmental → Aquatic	2.65%

Category

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	47.79%
Rhizosphere	Host-Associated → Plants → Rhizosphere	30.97%
Rhizoplane	Host-Associated → Plants → Rhizoplane	17.70%
Sediment	Environmental → Aquatic → Sediment	2.65%
Floodplain	Environmental → Terrestrial → Floodplain	0.89%

Type

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	41.59%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	17.70%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	13.27%
Soil	Host-Associated → Plants → Rhizosphere → Soil	13.27%
Loam	Environmental → Terrestrial → Soil → Loam	5.31%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	3.54%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	2.65%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.89%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.89%
Soil	Host-Associated → Plants → Rhizoplane → Soil	0.89%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	18.58%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	17.70%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	13.27%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	13.27%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	9.73%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	7.08%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	4.42%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	4.42%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	3.54%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	2.65%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.77%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.89%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	0.89%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.89%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	0.89%

Habitat

Habitat	Taxonomy	Distribution
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	8.85%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	7.96%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	7.96%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	7.96%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	6.19%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	4.42%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	3.54%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	3.54%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	3.54%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	2.65%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	2.65%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	2.65%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	2.65%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.65%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.65%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.77%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.77%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.77%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.77%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.77%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.77%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	1.77%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.89%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.89%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.89%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	0.89%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.89%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.89%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere	0.89%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.89%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.89%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.89%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.89%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.89%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.89%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.89%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.89%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	0.89%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.89%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.89%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.89%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.89%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental
3300004157	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2	Environmental
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental
3300005172	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132	Environmental
3300005187	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124	Environmental
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated
3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Host-Associated
3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Host-Associated
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated
3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Host-Associated
3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Host-Associated
3300005529	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1	Environmental
3300005540	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146	Environmental
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated
3300005552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150	Environmental
3300005576	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157	Environmental
3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Environmental
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental
3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Host-Associated
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental
3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Environmental
3300006581	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)	Environmental
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated
3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Host-Associated
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated
3300012208	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG	Environmental
3300012212	Combined assembly of Hopland grassland soil	Host-Associated
3300012356	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG	Environmental
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated
3300012906	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1	Environmental
3300012924	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)	Environmental
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental
3300012961	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG	Environmental
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated
3300014157	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG	Environmental
3300015372	Soil combined assembly	Host-Associated
3300018060	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG	Environmental
3300018067	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex	Environmental
3300018073	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1	Environmental
3300018422	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T	Environmental
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental
3300019362	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)	Environmental
3300022713	Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O (Metagenome Metatranscriptome) (v2)	Environmental
3300023073	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S154-409C-5	Environmental
3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)	Host-Associated
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated
3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)	Environmental
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated
3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)	Host-Associated
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated
3300025930	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Environmental
3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)	Host-Associated
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated
3300026301	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes)	Environmental
3300026523	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)	Environmental
3300027910	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)	Environmental
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated
3300028803	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120	Environmental
3300031226	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S	Environmental
3300031366	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S	Environmental
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental
3300031751	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24	Environmental
3300031764	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27	Environmental
3300031846	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19	Environmental
3300031847	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4	Environmental
3300031858	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2	Environmental
3300032059	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27	Environmental
3300032076	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)	Environmental
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental
3300034149	Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0062589_1016324081	3300004156	Soil	ELTRWLRFRTKIVQGSFTQPQMFQKIETSGVDLLFFFSY*
Ga0062590_1023988262	3300004157	Soil	GQTNLILEYELTNWLRLRTNMIQGNATQQSLFQRNQGSGVDLLFFFSY*
Ga0063356_1035591282	3300004463	Arabidopsis Thaliana Rhizosphere	QTNLILEYELTRWLRLRTNVLQGSPSQASMFQRAQGSGADLLFFFSY*
Ga0062595_1013997111	3300004479	Soil	YELTKWLRFRTNVMQGSSTQTQLFQRQPGSGADLLFFFGY*
Ga0066683_101805661	3300005172	Soil	ILEYELTKWLRFQTNLLQGSSTQQSIFQRAQGSGFNLLFFFSY*
Ga0066675_105920861	3300005187	Soil	NFILEYELTKWLRLRTNVLQGSSTQASLFQRQQGSGADLLFFFSY*
Ga0068869_1006539851	3300005334	Miscanthus Rhizosphere	NFIVEYELTRWLRFRTKIVQGSFTQPQMFQKIETSGVDLLFFFSY*
Ga0070666_100180391	3300005335	Switchgrass Rhizosphere	ETNFILEYELTRWLRLRTNMLQGSGTQQQLFQRAQGSGADLLFFFSY*
Ga0070666_111349252	3300005335	Switchgrass Rhizosphere	TNFILEYELTNWLRFRTNVLQGSSAQAQMFRRMQGSGADLLFFFSY*
Ga0070669_1014443442	3300005353	Switchgrass Rhizosphere	LEYELAKWLRLRTNWLQGSTTQPMIFQRTQDSGLDLLFFFTR*
Ga0070671_1009027381	3300005355	Switchgrass Rhizosphere	EYELTKWLRLRTNVLQGSTTQANLFQRQQGSGADLLFFFSY*
Ga0070678_1021982881	3300005456	Miscanthus Rhizosphere	NETNFILEYELTRWLRLRTNMLQGSGTQQQLFQRAQGSGADLLFFFSY*
Ga0070662_1002464232	3300005457	Corn Rhizosphere	LEYELTRWLRLRTNVLQGTPNQSSVFQRLQGSGADLLFFFSY*
Ga0070741_116383321	3300005529	Surface Soil	TKWLRLRTNVLQGSSTQAQLFQRMQGSGVDLLFFFSY*
Ga0066697_108069992	3300005540	Soil	TKWLRLRTNVLQGSSTQMNLFQRQQGSGADLLFFFSY*
Ga0070665_1025213901	3300005548	Switchgrass Rhizosphere	EYELTRWLRLRTNVLQGTANQRSVFQRAQGSGVDLLFFFTY*
Ga0066701_100984001	3300005552	Soil	LTKWLRLRTNVLQGSSTQQQLFQRLQGSGADLLFFFNY*
Ga0066708_100644821	3300005576	Soil	LEYELTKWLRLRTNVLQGSSTQASLFQRQQGSGADLLFFFSY*
Ga0070702_1006336872	3300005615	Corn, Switchgrass And Miscanthus Rhizosphere	ELATWLRLQTNVMQSSSTQQQLFQRMQGSGVDLLFFFSY*
Ga0068859_1028034251	3300005617	Switchgrass Rhizosphere	YELTNWLRLQTNVLQGSNTQQMLFQRAHGTGIDLLFFFSY*
Ga0068861_1021184922	3300005719	Switchgrass Rhizosphere	LILEYELTNWLRLRTNVIQGNATQQSLFQRAQGSGLDLLFFFSY*
Ga0066903_1039790631	3300005764	Tropical Forest Soil	LRFRTNVLQGSPSQTQLFQRSQSTGLDLLFFFSY*
Ga0068851_108379332	3300005834	Corn Rhizosphere	VNQTNLILEYELTKWLRLRTNVLQGSTTQANLFQRQQGSGADLLFFFSY*
Ga0068860_1005063361	3300005843	Switchgrass Rhizosphere	SQTNFILEYELTRWLRLRSNVLQGSSNQQLLFQRAQGSGADLLFFFSY*
Ga0066652_1005893691	3300006046	Soil	SQTNFIVEYELARWVRLQTNVVQGSSTQQQLFQRAQGSGVDLLFFFSY*
Ga0070715_109109952	3300006163	Corn, Switchgrass And Miscanthus Rhizosphere	AKWLRLRTNWLQGSNAQPLLFQKTQDSGVDLLFTFTH*
Ga0070715_109151012	3300006163	Corn, Switchgrass And Miscanthus Rhizosphere	QTNFILEYELAKWLRLRTNVLQGSSTQASLFQRQQGSGADLLFFFSY*
Ga0074048_132901892	3300006581	Soil	FEYELTRWLRLRTNVLQGSATQQVQFQRVQGSGADLLFFFSY*
Ga0075433_107935821	3300006852	Populus Rhizosphere	KWLRLQTNVLQGASTQQNVFQRMQASGADLLFFFSY*
Ga0075433_119502041	3300006852	Populus Rhizosphere	NFIMEYELSKWLRFRTNVLQGSSTQTQLFQRQAGSGADLLFFFGF*
Ga0075425_1013138481	3300006854	Populus Rhizosphere	LQKWLRLRTNVIQGSSTQQQLFQRVQGSGVDLLFFFSY*
Ga0075434_1011932792	3300006871	Populus Rhizosphere	ILEYELTKWLRFRTNVLEGSTTQQQLFQRMQGSGADVLFFFSY*
Ga0075434_1022639641	3300006871	Populus Rhizosphere	LNKWLRLQTNLVQGSTTQQQLFQRMQGSGVDLLFFFSY*
Ga0075434_1023883022	3300006871	Populus Rhizosphere	YLNIEQGIGDQSQTNVVLEYELQRWLRLQTNFTQGTQQHQLFQRVKGSGVDLLFFFSY*
Ga0075424_1019889761	3300006904	Populus Rhizosphere	YELTRWLRFRTNVLQGSSTQAQLFQRMQGSGFDLLFFFSY*
Ga0079219_104206361	3300006954	Agricultural Soil	TNWLRFRTNVLQGSATQQNLFQRAQGSGADLLFFFSY*
Ga0066710_1009473361	3300009012	Grasslands Soil	KWLRLRTNVLQGASTQAQLFQRMQGSGADLLFFFSY
Ga0066709_1032970342	3300009137	Grasslands Soil	YELTKWLRLQTNLLQGSSTQQSLFQRAQGSGFDLLFLFSY*
Ga0111538_137535651	3300009156	Populus Rhizosphere	QRWLRLRTNVLQGSPVQQQLFQRMQGSGVDLLFFFSY*
Ga0075423_131308742	3300009162	Populus Rhizosphere	LEYELAKWLRLQTNMLQGSSTQLHPFQRIQGSGADLLFFFSY*
Ga0105242_117693752	3300009176	Miscanthus Rhizosphere	EQIIGQQAQTNFIVEYELTRWLRFRTKIVQGSFTQPQMFQKVETSGVDLLFFFSY*
Ga0105242_122766471	3300009176	Miscanthus Rhizosphere	YELTRWLRLRTNVLQGSATQQVQFQRVQGSSADLLFFFSY*
Ga0105248_111260661	3300009177	Switchgrass Rhizosphere	TRWLRLRTNVLQGANSQPLFQRVQDSGVDLLFFFSY*
Ga0105238_109334341	3300009551	Corn Rhizosphere	NFILEYELTRWLRLRTNVLQGANSQPLFQRVQDSGVDLLFFFSY*
Ga0105249_124557723	3300009553	Switchgrass Rhizosphere	VLEYELQRWLRLQTNFVQGTQQHQLFQRVKGSGVDLLFFFSY*
Ga0126377_103729323	3300010362	Tropical Forest Soil	WLRLRTNVLQGASTQQNVFQRLQGSGADLLFFFSY*
Ga0126379_110387892	3300010366	Tropical Forest Soil	LEYELTKWLRFRTNMLQGASTQSQLFQRQQGSGADLLFFFGF*
Ga0134125_124803191	3300010371	Terrestrial Soil	ILEYELTKWLRLQTNVLQGSSTQQLFQRMQGSGVDLLFFFSF*
Ga0126383_114054181	3300010398	Tropical Forest Soil	ELTTWLRFRTNVLQGSSTQANLFQRAQGSGADVLFFFSY*
Ga0134121_102986721	3300010401	Terrestrial Soil	EIGQTNFILEYELAKWLRLRTNVLQGSSTQANLFQRQQGSGADLLFFFSY*
Ga0105246_122225641	3300011119	Miscanthus Rhizosphere	TNIILEYELAEWLRLRTNWLQGSNAQPLMFQRAQDSGVDLLFFFTR*
Ga0137376_114185631	3300012208	Vadose Zone Soil	KWLRLQTNVLQGSNTQQQLFQRMQGSGIDLLFFFSY*
Ga0150985_1064714432	3300012212	Avena Fatua Rhizosphere	RLRLRTNVLQGSSTTQQQMFQRAQDSGADLVFFFSY*
Ga0150985_1114577552	3300012212	Avena Fatua Rhizosphere	WLRLRTNVLQGSSTTQQLFQRAQGSGVDLLFFFSY*
Ga0150985_1127943711	3300012212	Avena Fatua Rhizosphere	LEYELAKWLRLRTNVLQGSSTQQQLFQRAQGSGADLLFFFSY*
Ga0150985_1215317491	3300012212	Avena Fatua Rhizosphere	KWLRLRTNWLQGSNAQPLLFQRTQDSGLDLLFTFSR*
Ga0137371_103016942	3300012356	Vadose Zone Soil	LRFRTNVLQGSSTQQQLFQRMQGSGADLLFFFSY*
Ga0150984_1060910982	3300012469	Avena Fatua Rhizosphere	AKWLRLRTNVLQGSSTQQQLFQRAQGSGADLLFFFSY*
Ga0157295_101406883	3300012906	Soil	LILEYELTNWLRLRTNVIQGNATQQSLFQRAQGSGADLLFFFSY*
Ga0137413_112602942	3300012924	Vadose Zone Soil	EQAVGGSSQTNFILEYELTRWLRLRTNVLQGANSQPLFQRVQDTGVDLLFFFSY*
Ga0126375_110292461	3300012948	Tropical Forest Soil	TQTNFIVEYELTKWLRLRTNFTQGSFTQQQLFQKVQSSGVDLLFFFSY*
Ga0164302_108606361	3300012961	Soil	TNWLRFRTNVLQGSSAQAQMFRRMQGSGADLLFFFSY*
Ga0157378_120831312	3300013297	Miscanthus Rhizosphere	EQGIGELNSTSFILEYELTNWMRLRTNIVQGTTTQTLFRRAQDSGGDIIFFFSY*
Ga0163162_130016151	3300013306	Switchgrass Rhizosphere	YELTKWLRLQTNVLQGSNTQQQLFQRMQGSGADLLFFFSY*
Ga0157372_134712552	3300013307	Corn Rhizosphere	YELTKWLRMRTNVLQGSTTQAQLFQRMQGSGVDLLFFFSY*
Ga0157375_106730471	3300013308	Miscanthus Rhizosphere	QMLGQQSQTNFIVEYELTRWLRFRTKIVQGSFTQPQMFQKVETSGVDLLFFFSY*
Ga0157375_135626101	3300013308	Miscanthus Rhizosphere	TTNFILEYEFAKWLRLRTNWLQGSNAQPLLFQKTQDSGVDLLFTFTH*
Ga0134078_101739722	3300014157	Grasslands Soil	TNFILEYELTKWLRFQANLIQGATTQLSIFQRLQSSGADLIFLFSY*
Ga0132256_1010171601	3300015372	Arabidopsis Rhizosphere	VLEYELLKWLRIRTNVLQGASTQAQLFQRMQGSGADLLFFFSY*
Ga0187765_102101482	3300018060	Tropical Peatland	FVLEYELAEWLRLQTNVLQGSATQQQLFQRMQGSGADLLFYFTF
Ga0184611_12708941	3300018067	Groundwater Sediment	TNFIVEYELTRWLRFRTKIVQGSFTQPQMFQKVETSGVDLLFFFSY
Ga0184624_105104262	3300018073	Groundwater Sediment	QMIGQQSQTNFIVEYELTRWLRFRTKIVQGSFTQPQMFQKVETSGVDLLFFFSY
Ga0190265_107261631	3300018422	Soil	TNFILEYELADWLRLQTNVVEGSSTNPSIFRRAQGTGADLIFFFSY
Ga0190274_122064062	3300018476	Soil	QGTTNLILEYELTNWLRMQTNVVQGSSNNPSLFRRAQSTGGDLLFFFSY
Ga0173479_102669322	3300019362	Soil	YELSKWLRFRTNVLQGSSTQTQLFQRQAGSGADLLFFFGF
Ga0242677_10684061	3300022713	Soil	NFILEYELARWLRLRTNVLEGSSAQQQLFQRAQGSGADLIFFFSY
Ga0247744_10707122	3300023073	Soil	VEQGVGDQAQTNVVLEYELQRWLRLQTNFKQGAQQQQLFQRVQGSGIDLLFFFSY
Ga0207682_103488081	3300025893	Miscanthus Rhizosphere	DQNQTNLILEYELTRWLRLRTNVLQGTPNQSSVFQRLQGSGADLLFFFSY
Ga0207642_100655652	3300025899	Miscanthus Rhizosphere	TNFILEYELTRWLRLRTNVLQGANSQPLFQRVQDSGVDLLFFFSY
Ga0207685_100972994	3300025905	Corn, Switchgrass And Miscanthus Rhizosphere	IAKWLRLRTNWLQGSNAQPLLFQRTQDSGLDLLFTFSR
Ga0207681_112894391	3300025923	Switchgrass Rhizosphere	YELTNWLRLRTNVIQGNATQQSLFQRAQGSGADLLFFFSY
Ga0207694_109627662	3300025924	Corn Rhizosphere	QAVGGNSQTNFILEYELTRWLRLRTNVLQGANSQPLFQRVQDSGVDLLFFFSY
Ga0207650_114625142	3300025925	Switchgrass Rhizosphere	LTRWLRLRTNVIQGVPTQQSMFQRAQGSGADLLFFFSY
Ga0207701_116420672	3300025930	Corn, Switchgrass And Miscanthus Rhizosphere	LQRWLRLQTNFTQGTQQHQLFQRVKGSGVDLLFFFSY
Ga0207690_105298262	3300025932	Corn Rhizosphere	ELTKWLRLRTNVLQGSTTQANLFQRQQGSGADLLFFFSY
Ga0207670_102000262	3300025936	Switchgrass Rhizosphere	IVEYELTRWLRFRTKIVQGSFTQPQMFQKIETSGVDLLFFFSY
Ga0207689_105058251	3300025942	Miscanthus Rhizosphere	QSQTNFILEDELTNWLRLQTNVLQGSNTQQSLFQRAQGSGADLLFFFSY
Ga0207651_111776051	3300025960	Switchgrass Rhizosphere	ILEYELTNWLRLQTNVLQGSNTQQMLFQRAHGTGIDLLFFFSY
Ga0207668_110837042	3300025972	Switchgrass Rhizosphere	ELNKWLRLQTNMLQGSSNQQQLFQKMQGSGVDLFFFFSY
Ga0207658_115969602	3300025986	Switchgrass Rhizosphere	TRWLRLRTNVLQGSSTQQQLFQRAQGSGVDLLFFFSY
Ga0207703_105088491	3300026035	Switchgrass Rhizosphere	KWLRLRSNIVQGSSTQQQLFQRVQGTGADLLFFFSY
Ga0207675_1019795842	3300026118	Switchgrass Rhizosphere	EYELTRWLRFRTKIVQGSFTQPQMFQKVETSGVDLLFFFSY
Ga0209238_11466202	3300026301	Grasslands Soil	FVLEYELLKWLRLRTNVLQGSSTQAQLFQRMQGSGADLLFFFNY
Ga0209808_10432361	3300026523	Soil	LEYELTKWLRLRTNVLQGSSTQASLFQRQQGSGADLLFFFSY
Ga0209583_103933921	3300027910	Watersheds	LMLEYELTKWLRFRTNVQQGSSTQQQLFQRSQGSGVDLLFIFSY
Ga0268265_115854532	3300028380	Switchgrass Rhizosphere	YELTRWLRFRTKIVQGSFTQPQMFQKIETSGVDLLFFFSY
Ga0268264_101378452	3300028381	Switchgrass Rhizosphere	ELAKWLRLRTNWLQGSTTQPMIFQRTQDSGLDLLFFFTR
Ga0268264_106789331	3300028381	Switchgrass Rhizosphere	ILEYELSKWLRFRTNVLQGSSTQTQLFQRQSGSGADLLFFFGF
Ga0268264_117621452	3300028381	Switchgrass Rhizosphere	EYELTRWLRLRTNVLQGSSTQQQLFQRMQGSGVDLLFFFSY
Ga0307281_102244352	3300028803	Soil	EFAKWLRLRTNWLQGANAQPLLFQKTQDSGVDLLFTFTH
Ga0307497_102655601	3300031226	Soil	EFAKWLRLRTNWLQGSNAQPLLFQKTQDSGVDLLFTFTH
Ga0307506_104100651	3300031366	Soil	WLRLRTNFLQGTSTQPSLFQRAQGSGADLLFFFSY
Ga0310813_118430761	3300031716	Soil	GQSGTNFILEYELTRWLRLRTNVLQGSSTQQQLFQRAQGSGADLLFFFSY
Ga0307468_1024369641	3300031740	Hardwood Forest Soil	FVLEYELTKWLRLQTNLLQGSSTQQSLFQRAQGSGFDLLFLFSY
Ga0318494_104242261	3300031751	Soil	EYELTRWLRFRTNYLQGSSAQTQLFQRTQSSGVDVLFFFSY
Ga0318535_101141802	3300031764	Soil	SQTNLVLEYELTRWLRFRTNYLQGSSAQTQLFQRTQSSGVDVLFFFSY
Ga0318512_105863201	3300031846	Soil	YELTRWLRLRTNMLQGSSTQQQQFQRAQGSGADLLFFFSY
Ga0310907_100244261	3300031847	Soil	FILEYELTKWLRLRTNVLQGSSTQTQLFQRQAGSGADLLFFFGF
Ga0310892_109644812	3300031858	Soil	GDQSSTNFILEYELTQWMRLQTNVLQNSNVQQQMFRPIHGTGVDLLFFLSY
Ga0318533_103870552	3300032059	Soil	GQTNLVLEYELTRWLRFRTNYLQGSSAQTQLFQRTQSSGVDVLFFFSY
Ga0306924_102704311	3300032076	Soil	NIILEYELTGWLRFRTNMLQGSSTQQSLFQRAQSSGADLLFLFNY
Ga0307471_1000652541	3300032180	Hardwood Forest Soil	AKWLRLRTNVLQGSSTQASLFQRQQGSGADLLFFFSY
Ga0364929_0322870_410_529	3300034149	Sediment	ELTRWLRFRTKIVQGSFTQPQMFQKVETSGVDLLFFFSY